TMEM18 (transmembrane protein 18)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 129787
• Gene name: Transmembrane protein 18
• Gene symbol: TMEM18
• Synonyms (NCBI Gene): lncND
• Chromosome: 2
• Chromosome location: 2p25.3

miRNA Show/Hide all (253)

miRTarBase ID	miRNA	Experiments	Reference
MIRT531415	hsa-miR-548ac	PAR-CLIP	22012620
MIRT531413	hsa-miR-548bb-3p	PAR-CLIP	22012620
MIRT531412	hsa-miR-548d-3p	PAR-CLIP	22012620
MIRT531411	hsa-miR-548h-3p	PAR-CLIP	22012620
MIRT531410	hsa-miR-548z	PAR-CLIP	22012620
MIRT531409	hsa-miR-548ae-3p	PAR-CLIP	22012620
MIRT531408	hsa-miR-548ah-3p	PAR-CLIP	22012620
MIRT531407	hsa-miR-548aj-3p	PAR-CLIP	22012620
MIRT531406	hsa-miR-548am-3p	PAR-CLIP	22012620
MIRT531405	hsa-miR-548aq-3p	PAR-CLIP	22012620
MIRT531404	hsa-miR-548j-3p	PAR-CLIP	22012620
MIRT531403	hsa-miR-548x-3p	PAR-CLIP	22012620
MIRT531402	hsa-miR-5094	PAR-CLIP	22012620
MIRT531401	hsa-miR-936	PAR-CLIP	22012620
MIRT531400	hsa-miR-199a-3p	PAR-CLIP	22012620
MIRT531399	hsa-miR-199b-3p	PAR-CLIP	22012620
MIRT531398	hsa-miR-3129-5p	PAR-CLIP	22012620
MIRT531397	hsa-miR-361-5p	PAR-CLIP	22012620
MIRT531396	hsa-miR-222-5p	PAR-CLIP	22012620
MIRT531395	hsa-miR-374a-3p	PAR-CLIP	22012620
MIRT531415	hsa-miR-548ac	PAR-CLIP	22012620
MIRT531413	hsa-miR-548bb-3p	PAR-CLIP	22012620
MIRT531412	hsa-miR-548d-3p	PAR-CLIP	22012620
MIRT531411	hsa-miR-548h-3p	PAR-CLIP	22012620
MIRT531410	hsa-miR-548z	PAR-CLIP	22012620
MIRT531409	hsa-miR-548ae-3p	PAR-CLIP	22012620
MIRT531408	hsa-miR-548ah-3p	PAR-CLIP	22012620
MIRT531407	hsa-miR-548aj-3p	PAR-CLIP	22012620
MIRT531406	hsa-miR-548am-3p	PAR-CLIP	22012620
MIRT531405	hsa-miR-548aq-3p	PAR-CLIP	22012620
MIRT531404	hsa-miR-548j-3p	PAR-CLIP	22012620
MIRT531403	hsa-miR-548x-3p	PAR-CLIP	22012620
MIRT531402	hsa-miR-5094	PAR-CLIP	22012620
MIRT531401	hsa-miR-936	PAR-CLIP	22012620
MIRT531400	hsa-miR-199a-3p	PAR-CLIP	22012620
MIRT531399	hsa-miR-199b-3p	PAR-CLIP	22012620
MIRT531398	hsa-miR-3129-5p	PAR-CLIP	22012620
MIRT531397	hsa-miR-361-5p	PAR-CLIP	22012620
MIRT531396	hsa-miR-222-5p	PAR-CLIP	22012620
MIRT531395	hsa-miR-374a-3p	PAR-CLIP	22012620
MIRT1433194	hsa-miR-106a	CLIP-seq
MIRT1433195	hsa-miR-106b	CLIP-seq
MIRT1433196	hsa-miR-1208	CLIP-seq
MIRT1433197	hsa-miR-1279	CLIP-seq
MIRT1433198	hsa-miR-1293	CLIP-seq
MIRT1433199	hsa-miR-142-5p	CLIP-seq
MIRT1433200	hsa-miR-17	CLIP-seq
MIRT1433201	hsa-miR-184	CLIP-seq
MIRT1433202	hsa-miR-1913	CLIP-seq
MIRT1433203	hsa-miR-20a	CLIP-seq
MIRT1433204	hsa-miR-20b	CLIP-seq
MIRT1433205	hsa-miR-223	CLIP-seq
MIRT1433206	hsa-miR-25	CLIP-seq
MIRT1433207	hsa-miR-3145-5p	CLIP-seq
MIRT1433208	hsa-miR-32	CLIP-seq
MIRT1433209	hsa-miR-3201	CLIP-seq
MIRT1433210	hsa-miR-324-3p	CLIP-seq
MIRT1433211	hsa-miR-340	CLIP-seq
MIRT1433212	hsa-miR-3609	CLIP-seq
MIRT1433213	hsa-miR-363	CLIP-seq
MIRT1433214	hsa-miR-367	CLIP-seq
MIRT1433215	hsa-miR-3671	CLIP-seq
MIRT1433216	hsa-miR-3681	CLIP-seq
MIRT1433217	hsa-miR-3692	CLIP-seq
MIRT1433218	hsa-miR-374a	CLIP-seq
MIRT1433219	hsa-miR-374b	CLIP-seq
MIRT1433220	hsa-miR-3973	CLIP-seq
MIRT1433221	hsa-miR-4276	CLIP-seq
MIRT1433222	hsa-miR-4277	CLIP-seq
MIRT1433223	hsa-miR-4461	CLIP-seq
MIRT1433224	hsa-miR-4483	CLIP-seq
MIRT1433225	hsa-miR-452	CLIP-seq
MIRT1433226	hsa-miR-4533	CLIP-seq
MIRT1433227	hsa-miR-4676-3p	CLIP-seq
MIRT1433228	hsa-miR-4681	CLIP-seq
MIRT1433229	hsa-miR-4697-3p	CLIP-seq
MIRT1433230	hsa-miR-4717-3p	CLIP-seq
MIRT1433231	hsa-miR-4731-3p	CLIP-seq
MIRT1433232	hsa-miR-4743	CLIP-seq
MIRT1433233	hsa-miR-4747-5p	CLIP-seq
MIRT1433234	hsa-miR-4791	CLIP-seq
MIRT1433235	hsa-miR-4795-3p	CLIP-seq
MIRT1433236	hsa-miR-4796-3p	CLIP-seq
MIRT1433237	hsa-miR-4801	CLIP-seq
MIRT1433238	hsa-miR-4804-5p	CLIP-seq
MIRT1433239	hsa-miR-518a-5p	CLIP-seq
MIRT1433240	hsa-miR-519d	CLIP-seq
MIRT1433241	hsa-miR-527	CLIP-seq
MIRT1433242	hsa-miR-548a-5p	CLIP-seq
MIRT1433243	hsa-miR-548ab	CLIP-seq
MIRT1433244	hsa-miR-548ah	CLIP-seq
MIRT1433245	hsa-miR-548ak	CLIP-seq
MIRT1433246	hsa-miR-548b-5p	CLIP-seq
MIRT1433247	hsa-miR-548c-5p	CLIP-seq
MIRT1433248	hsa-miR-548d-5p	CLIP-seq
MIRT1433249	hsa-miR-548h	CLIP-seq
MIRT1433250	hsa-miR-548i	CLIP-seq
MIRT1433251	hsa-miR-548j	CLIP-seq
MIRT1433252	hsa-miR-548w	CLIP-seq
MIRT1433253	hsa-miR-548y	CLIP-seq
MIRT1433254	hsa-miR-552	CLIP-seq
MIRT1433255	hsa-miR-559	CLIP-seq
MIRT1433256	hsa-miR-646	CLIP-seq
MIRT1433257	hsa-miR-802	CLIP-seq
MIRT1433258	hsa-miR-92a	CLIP-seq
MIRT1433259	hsa-miR-92b	CLIP-seq
MIRT1433260	hsa-miR-93	CLIP-seq
MIRT2129858	hsa-miR-1273f	CLIP-seq
MIRT2129859	hsa-miR-1283	CLIP-seq
MIRT2129860	hsa-miR-143	CLIP-seq
MIRT2129861	hsa-miR-148a	CLIP-seq
MIRT2129862	hsa-miR-148b	CLIP-seq
MIRT2129863	hsa-miR-152	CLIP-seq
MIRT2129864	hsa-miR-181a	CLIP-seq
MIRT2129865	hsa-miR-181b	CLIP-seq
MIRT2129866	hsa-miR-181c	CLIP-seq
MIRT2129867	hsa-miR-181d	CLIP-seq
MIRT1433205	hsa-miR-223	CLIP-seq
MIRT2129868	hsa-miR-3134	CLIP-seq
MIRT2129869	hsa-miR-3622a-3p	CLIP-seq
MIRT2129870	hsa-miR-3622b-3p	CLIP-seq
MIRT1433215	hsa-miR-3671	CLIP-seq
MIRT1433217	hsa-miR-3692	CLIP-seq
MIRT2129871	hsa-miR-425	CLIP-seq
MIRT2129872	hsa-miR-4262	CLIP-seq
MIRT2129873	hsa-miR-4269	CLIP-seq
MIRT1433221	hsa-miR-4276	CLIP-seq
MIRT1433222	hsa-miR-4277	CLIP-seq
MIRT2129874	hsa-miR-4292	CLIP-seq
MIRT2129875	hsa-miR-4293	CLIP-seq
MIRT2129876	hsa-miR-4308	CLIP-seq
MIRT2129877	hsa-miR-4450	CLIP-seq
MIRT2129878	hsa-miR-4514	CLIP-seq
MIRT2129879	hsa-miR-4534	CLIP-seq
MIRT2129880	hsa-miR-4643	CLIP-seq
MIRT2129881	hsa-miR-4652-3p	CLIP-seq
MIRT2129882	hsa-miR-4692	CLIP-seq
MIRT1433229	hsa-miR-4697-3p	CLIP-seq
MIRT2129883	hsa-miR-4708-5p	CLIP-seq
MIRT1433230	hsa-miR-4717-3p	CLIP-seq
MIRT2129884	hsa-miR-4742-5p	CLIP-seq
MIRT1433232	hsa-miR-4743	CLIP-seq
MIRT2129885	hsa-miR-4762-5p	CLIP-seq
MIRT2129886	hsa-miR-4770	CLIP-seq
MIRT2129887	hsa-miR-4772-5p	CLIP-seq
MIRT2129888	hsa-miR-4778-3p	CLIP-seq
MIRT2129889	hsa-miR-4802-3p	CLIP-seq
MIRT2129890	hsa-miR-512-3p	CLIP-seq
MIRT2129891	hsa-miR-520d-5p	CLIP-seq
MIRT2129892	hsa-miR-524-5p	CLIP-seq
MIRT2129893	hsa-miR-607	CLIP-seq
MIRT2129894	hsa-miR-642b	CLIP-seq
MIRT2351294	hsa-miR-1184	CLIP-seq
MIRT2351295	hsa-miR-1205	CLIP-seq
MIRT2351296	hsa-miR-1262	CLIP-seq
MIRT2351297	hsa-miR-127-5p	CLIP-seq
MIRT1433198	hsa-miR-1293	CLIP-seq
MIRT2351298	hsa-miR-1470	CLIP-seq
MIRT2351299	hsa-miR-2467-3p	CLIP-seq
MIRT2351300	hsa-miR-3144-5p	CLIP-seq
MIRT2351301	hsa-miR-3145-3p	CLIP-seq
MIRT2351302	hsa-miR-3157-3p	CLIP-seq
MIRT2351303	hsa-miR-3158-5p	CLIP-seq
MIRT2351304	hsa-miR-3162-3p	CLIP-seq
MIRT2351305	hsa-miR-3191	CLIP-seq
MIRT2351306	hsa-miR-3194-3p	CLIP-seq
MIRT1433209	hsa-miR-3201	CLIP-seq
MIRT2351307	hsa-miR-335	CLIP-seq
MIRT1433215	hsa-miR-3671	CLIP-seq
MIRT2351308	hsa-miR-3678-3p	CLIP-seq
MIRT2351309	hsa-miR-3691-5p	CLIP-seq
MIRT1433221	hsa-miR-4276	CLIP-seq
MIRT2351310	hsa-miR-4287	CLIP-seq
MIRT2351311	hsa-miR-4302	CLIP-seq
MIRT2351312	hsa-miR-4318	CLIP-seq
MIRT2351313	hsa-miR-4423-3p	CLIP-seq
MIRT2129877	hsa-miR-4450	CLIP-seq
MIRT1433224	hsa-miR-4483	CLIP-seq
MIRT2129880	hsa-miR-4643	CLIP-seq
MIRT2351314	hsa-miR-4652-5p	CLIP-seq
MIRT2351315	hsa-miR-4666-3p	CLIP-seq
MIRT2351316	hsa-miR-4667-3p	CLIP-seq
MIRT2351317	hsa-miR-4685-3p	CLIP-seq
MIRT2351318	hsa-miR-4701-3p	CLIP-seq
MIRT1433230	hsa-miR-4717-3p	CLIP-seq
MIRT2351319	hsa-miR-4722-5p	CLIP-seq
MIRT1433232	hsa-miR-4743	CLIP-seq
MIRT2351320	hsa-miR-4752	CLIP-seq
MIRT2129885	hsa-miR-4762-5p	CLIP-seq
MIRT2129888	hsa-miR-4778-3p	CLIP-seq
MIRT2351321	hsa-miR-4780	CLIP-seq
MIRT1433234	hsa-miR-4791	CLIP-seq
MIRT2351322	hsa-miR-4793-3p	CLIP-seq
MIRT2129889	hsa-miR-4802-3p	CLIP-seq
MIRT2351323	hsa-miR-491-5p	CLIP-seq
MIRT2351324	hsa-miR-514	CLIP-seq
MIRT2351325	hsa-miR-514b-3p	CLIP-seq
MIRT1433254	hsa-miR-552	CLIP-seq
MIRT2129893	hsa-miR-607	CLIP-seq
MIRT2351326	hsa-miR-623	CLIP-seq
MIRT2129894	hsa-miR-642b	CLIP-seq
MIRT2461737	hsa-miR-29a	CLIP-seq
MIRT2461738	hsa-miR-29b	CLIP-seq
MIRT2461739	hsa-miR-29c	CLIP-seq
MIRT2461740	hsa-miR-3663-3p	CLIP-seq
MIRT1433217	hsa-miR-3692	CLIP-seq
MIRT1433222	hsa-miR-4277	CLIP-seq
MIRT2461741	hsa-miR-4434	CLIP-seq
MIRT2461742	hsa-miR-4516	CLIP-seq
MIRT1433230	hsa-miR-4717-3p	CLIP-seq
MIRT1433232	hsa-miR-4743	CLIP-seq
MIRT2461743	hsa-miR-4768-3p	CLIP-seq
MIRT2461744	hsa-miR-4786-3p	CLIP-seq
MIRT2461745	hsa-miR-665	CLIP-seq
MIRT1433217	hsa-miR-3692	CLIP-seq
MIRT1433222	hsa-miR-4277	CLIP-seq
MIRT1433230	hsa-miR-4717-3p	CLIP-seq
MIRT1433232	hsa-miR-4743	CLIP-seq
MIRT2351296	hsa-miR-1262	CLIP-seq
MIRT2129858	hsa-miR-1273f	CLIP-seq
MIRT1433198	hsa-miR-1293	CLIP-seq
MIRT2129860	hsa-miR-143	CLIP-seq
MIRT2351300	hsa-miR-3144-5p	CLIP-seq
MIRT2351305	hsa-miR-3191	CLIP-seq
MIRT1433217	hsa-miR-3692	CLIP-seq
MIRT1433222	hsa-miR-4277	CLIP-seq
MIRT2129877	hsa-miR-4450	CLIP-seq
MIRT1433224	hsa-miR-4483	CLIP-seq
MIRT2129880	hsa-miR-4643	CLIP-seq
MIRT2351314	hsa-miR-4652-5p	CLIP-seq
MIRT2351318	hsa-miR-4701-3p	CLIP-seq
MIRT2129883	hsa-miR-4708-5p	CLIP-seq
MIRT1433230	hsa-miR-4717-3p	CLIP-seq
MIRT1433232	hsa-miR-4743	CLIP-seq
MIRT2129886	hsa-miR-4770	CLIP-seq
MIRT2351323	hsa-miR-491-5p	CLIP-seq
MIRT2129894	hsa-miR-642b	CLIP-seq
MIRT2351294	hsa-miR-1184	CLIP-seq
MIRT2351295	hsa-miR-1205	CLIP-seq
MIRT2351297	hsa-miR-127-5p	CLIP-seq
MIRT2351299	hsa-miR-2467-3p	CLIP-seq
MIRT2351303	hsa-miR-3158-5p	CLIP-seq
MIRT2351306	hsa-miR-3194-3p	CLIP-seq
MIRT1433215	hsa-miR-3671	CLIP-seq
MIRT2351308	hsa-miR-3678-3p	CLIP-seq
MIRT1433217	hsa-miR-3692	CLIP-seq
MIRT1433222	hsa-miR-4277	CLIP-seq
MIRT1433230	hsa-miR-4717-3p	CLIP-seq
MIRT1433232	hsa-miR-4743	CLIP-seq
MIRT2129885	hsa-miR-4762-5p	CLIP-seq
MIRT2129888	hsa-miR-4778-3p	CLIP-seq
MIRT2129889	hsa-miR-4802-3p	CLIP-seq
MIRT2129893	hsa-miR-607	CLIP-seq

Gene ontology (GO) Show/Hide all (11)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003677	Function	DNA binding	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0016020	Component	Membrane	IEA
GO:0016477	Process	Cell migration	IDA	18559506
GO:0031965	Component	Nuclear membrane	IBA
GO:0031965	Component	Nuclear membrane	IDA	18559506
GO:0031965	Component	Nuclear membrane	IEA
GO:0042755	Process	Eating behavior	IEA
GO:0097009	Process	Energy homeostasis	IEA

Other IDs

• MIM: 613220
• HGNC: 25257
• e!Ensembl: ENSG00000151353

Protein

• UniProt ID: Q96B42
• Protein name: Transmembrane protein 18
• Protein function: Transcription repressor. Sequence-specific ssDNA and dsDNA binding protein, with preference for GCT end CTG repeats. Cell migration modulator which enhances the glioma-specific migration ability of neural stem cells (NSC) and neural precursor ce
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF14770	TMEM18	16 → 133	Transmembrane protein 18	Family

• Sequence:

  MPSAFSVSSFPVSIPAVLTQTDWTEPWLMGLATFHALCVLLTCLSSRSYRLQIGHFLCLV
  ILVYCAEYINEAAAMNWRLFSKYQYFDSRGMFISIVFSAPLLVNAMIIVVMWVWKTLNVM
  TDLKNAQERRKEKKRRRKED

• Sequence length: 140

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (45)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Acute myeloid leukemia	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	GWAS catalog	40050429, 41022758	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	34446935, 36137488, 36738649, 37689771, 40962958	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	36929942, 37340002	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANCER	—	GWAS catalog	36929942	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANNABIS DEPENDENCE	—	GWAS catalog	37156939	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC KIDNEY DISEASE	—	GWAS catalog	40465716	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal cancer	Likely benign	ClinVar GWAS catalog	36929942	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
CORONARY ARTERY DISEASE	—	GWAS catalog	33910581, 35186008	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, TYPE 2	—	CTD	28869590	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEUROPATHY	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EDEMA	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESSENTIAL HYPERTENSION	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN-RECEPTOR NEGATIVE BREAST CANCER	—	GWAS catalog	36929942	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	31578528, 33356394, 39024449, 39406924	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	GWAS catalog	36376295, 37429843, 40195560, 41184235	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	38965376, 39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IGA GLOMERULONEPHRITIS	—	GWAS catalog	37337107	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE	—	GWAS catalog	40465716	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	36929942	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	36929942	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	31589552, 39349817	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MORBID OBESITY	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	19079261, 20421936, 23563607, 23563609, 30677029, 31504550, 36137488, 39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	GWAS catalog	36889626, 40205036	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, HIP	—	GWAS catalog	34450027, 40205036	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, KNEE	—	GWAS catalog	34450027, 36889626, 40205036	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	36929942	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN ENDOMETRIOID CARCINOMA	—	GWAS catalog	36929942	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN SEROUS CARCINOMA	—	GWAS catalog	36929942	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL ARTERIAL DISEASE	—	GWAS catalog	35186008	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	36929942, 37340002	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	35235886	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SLEEP APNEA	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SPONDYLOSIS	—	GWAS catalog	33332786	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	36929942	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	34446935	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	24509480, 28869590, 30054458, 30297969, 31589552, 32499647, 32514122, 32541925, 34594039, 35551307, 36738649, 38374256, 38685053, 39024449, 39349817	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (21)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Arteriosclerosis	Arteriosclerosis	BEFREE	24951660		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	26504195		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	24951660		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	29073238	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	22466342, 23860325		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	22466342, 23860325		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	31167208, 32228543	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	23860325, 27029472, 31167208, 31361511		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	CTD_human_DG	28869590		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioblastoma	Glioblastoma	BEFREE	18559506		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	18559506		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	18559506		★☆☆☆☆ Found in Text Mining only
Glucocorticoid Receptor Deficiency	Glucocorticoid receptor deficiency/resistance	Pubtator	30026463	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	33299884	Inhibit	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	30199869		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	27029472		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	CTD_human_DG	19079261		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	19164386, 19910938, 20628085, 20724581, 20725061, 21720444, 21779088, 21796137, 21976109, 21980424, 22051089, 22095114, 23347264, 23349760, 23408508, 23505181, 23820787, 24059907, 24129437, 24626232, 26365393, 27421018, 28025578, 31167208, 32228543, 33299884, 33801339, 33859285, 36678137, 37709841	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	BEFREE	19851340, 20380707, 20628085, 20725061, 21720444, 21796137, 21980424, 22041983, 22083549, 22466342, 23505181, 23843577, 23860325, 24064335, 24528214, 24670271, 26263223, 27029472, 27650258, 28025578, 30311592, 30341978, 30753134, 31167208, 31288024, 31354816, 31361511, 31628562		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pediatric Obesity	Childhood obesity	BEFREE	20380707, 23505181		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	24498077		★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

ATAD5 4 shared diseasesCancer, Estrogen-receptor negative breast cancer, Ovarian serous carcinoma, Peripheral arterial disease 4 shared evidence sourcesGWAS catalog (Cancer), GWAS catalog (Estrogen-receptor negative breast cancer), GWAS catalog (Ovarian serous carcinoma), GWAS catalog (Peripheral arterial disease) Related via 4 shared diseases including Cancer, Estrogen-receptor negative breast cancer — evidence mostly GWAS catalog. SLC22A3 3 shared diseasesCancer, Estrogen-receptor negative breast cancer, Ovarian serous carcinoma 7 shared evidence sourcesGWAS catalog (Cancer), Disgenet (Obesity), Disgenet (Diabetes mellitus type 2), CTD (Diabetes mellitus type 2), GWAS catalog (Estrogen-receptor negative breast cancer), CTD (Obesity), GWAS catalog (Ovarian serous carcinoma) Related via 3 shared diseases including Cancer, Estrogen-receptor negative breast cancer — evidence mostly GWAS catalog. EBF1 4 shared diseasesCancer, Diabetes mellitus, Estrogen-receptor negative breast cancer, Ovarian serous carcinoma 5 shared evidence sourcesGWAS catalog (Cancer), GWAS catalog (Diabetes mellitus), GWAS catalog (Estrogen-receptor negative breast cancer), GWAS catalog (Heart failure), GWAS catalog (Ovarian serous carcinoma) Related via 4 shared diseases including Cancer, Diabetes mellitus — evidence mostly GWAS catalog. RBMS1 4 shared diseasesCancer, Estrogen-receptor negative breast cancer, Ovarian serous carcinoma, Peripheral arterial disease 4 shared evidence sourcesGWAS catalog (Cancer), GWAS catalog (Estrogen-receptor negative breast cancer), GWAS catalog (Ovarian serous carcinoma), GWAS catalog (Peripheral arterial disease) Related via 4 shared diseases including Cancer, Estrogen-receptor negative breast cancer — evidence mostly GWAS catalog. RFX6 4 shared diseasesCancer, Diabetes mellitus, Estrogen-receptor negative breast cancer, Ovarian serous carcinoma 3 shared evidence sourcesGWAS catalog (Cancer), GWAS catalog (Estrogen-receptor negative breast cancer), GWAS catalog (Ovarian serous carcinoma) Related via 4 shared diseases including Cancer, Diabetes mellitus — evidence mostly GWAS catalog.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
ATAD5	4	["Cancer","Estrogen-receptor negative breast cancer","Ovarian serous carcinoma","Peripheral arterial disease"]	0	[]	4	["GWAS catalog (Cancer)","GWAS catalog (Estrogen-receptor negative breast cancer)","GWAS catalog (Ovarian serous carcinoma)","GWAS catalog (Peripheral arterial disease)"]
SLC22A3	3	["Cancer","Estrogen-receptor negative breast cancer","Ovarian serous carcinoma"]	0	[]	7	["GWAS catalog (Cancer)","Disgenet (Obesity)","Disgenet (Diabetes mellitus type 2)","CTD (Diabetes mellitus type 2)","GWAS catalog (Estrogen-receptor negative breast cancer)","CTD (Obesity)","GWAS catalog (Ovarian serous carcinoma)"]
EBF1	4	["Cancer","Diabetes mellitus","Estrogen-receptor negative breast cancer","Ovarian serous carcinoma"]	0	[]	5	["GWAS catalog (Cancer)","GWAS catalog (Diabetes mellitus)","GWAS catalog (Estrogen-receptor negative breast cancer)","GWAS catalog (Heart failure)","GWAS catalog (Ovarian serous carcinoma)"]
RBMS1	4	["Cancer","Estrogen-receptor negative breast cancer","Ovarian serous carcinoma","Peripheral arterial disease"]	0	[]	4	["GWAS catalog (Cancer)","GWAS catalog (Estrogen-receptor negative breast cancer)","GWAS catalog (Ovarian serous carcinoma)","GWAS catalog (Peripheral arterial disease)"]
RFX6	4	["Cancer","Diabetes mellitus","Estrogen-receptor negative breast cancer","Ovarian serous carcinoma"]	0	[]	3	["GWAS catalog (Cancer)","GWAS catalog (Estrogen-receptor negative breast cancer)","GWAS catalog (Ovarian serous carcinoma)"]

Diseases Linked via Similar Genes

Cardiovascular disease Linked via 2 of 5 related genesSLC22A3, EBF1 Prostatic neoplasms Linked via 2 of 5 related genesSLC22A3, RFX6 Alzheimer disease Linked via 2 of 5 related genesEBF1, RFX6 Anorexia nervosa Linked via 2 of 5 related genesEBF1, RBMS1 Major depressive disorder Linked via 2 of 5 related genesEBF1, RBMS1

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Cardiovascular disease	2	["SLC22A3","EBF1"]
Prostatic neoplasms	2	["SLC22A3","RFX6"]
Alzheimer disease	2	["EBF1","RFX6"]
Anorexia nervosa	2	["EBF1","RBMS1"]
Major depressive disorder	2	["EBF1","RBMS1"]