SLC22A3 (solute carrier family 22 member 3)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 6581
• Gene name: Solute carrier family 22 member 3
• Gene symbol: SLC22A3
• Synonyms (NCBI Gene): EMT, EMTH, OCT3
• Chromosome: 6
• Chromosome location: 6q25.3
• Summary: Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. This gene is one of three similar c

miRNA Show/Hide all (202)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019444	hsa-miR-148b-3p	Microarray	17612493
MIRT021441	hsa-miR-9-5p	Microarray	17612493
MIRT022967	hsa-miR-124-3p	Microarray	18668037
MIRT639284	hsa-miR-1272	HITS-CLIP	19536157
MIRT639283	hsa-miR-1322	HITS-CLIP	19536157
MIRT639282	hsa-miR-4639-3p	HITS-CLIP	19536157
MIRT639281	hsa-miR-519d-5p	HITS-CLIP	19536157
MIRT639280	hsa-miR-5695	HITS-CLIP	19536157
MIRT639279	hsa-miR-515-5p	HITS-CLIP	19536157
MIRT639278	hsa-miR-519e-5p	HITS-CLIP	19536157
MIRT639284	hsa-miR-1272	HITS-CLIP	19536157
MIRT639283	hsa-miR-1322	HITS-CLIP	19536157
MIRT639282	hsa-miR-4639-3p	HITS-CLIP	19536157
MIRT639281	hsa-miR-519d-5p	HITS-CLIP	19536157
MIRT639280	hsa-miR-5695	HITS-CLIP	19536157
MIRT639279	hsa-miR-515-5p	HITS-CLIP	19536157
MIRT639278	hsa-miR-519e-5p	HITS-CLIP	19536157
MIRT639284	hsa-miR-1272	HITS-CLIP	19536157
MIRT639283	hsa-miR-1322	HITS-CLIP	19536157
MIRT639282	hsa-miR-4639-3p	HITS-CLIP	19536157
MIRT639281	hsa-miR-519d-5p	HITS-CLIP	19536157
MIRT639280	hsa-miR-5695	HITS-CLIP	19536157
MIRT639279	hsa-miR-515-5p	HITS-CLIP	19536157
MIRT639278	hsa-miR-519e-5p	HITS-CLIP	19536157
MIRT713248	hsa-miR-4494	HITS-CLIP	19536157
MIRT713247	hsa-miR-499b-5p	HITS-CLIP	19536157
MIRT713246	hsa-miR-4330	HITS-CLIP	19536157
MIRT713245	hsa-miR-130b-5p	HITS-CLIP	19536157
MIRT713244	hsa-miR-4753-3p	HITS-CLIP	19536157
MIRT639284	hsa-miR-1272	HITS-CLIP	19536157
MIRT639283	hsa-miR-1322	HITS-CLIP	19536157
MIRT639282	hsa-miR-4639-3p	HITS-CLIP	19536157
MIRT639281	hsa-miR-519d-5p	HITS-CLIP	19536157
MIRT639280	hsa-miR-5695	HITS-CLIP	19536157
MIRT639279	hsa-miR-515-5p	HITS-CLIP	19536157
MIRT639278	hsa-miR-519e-5p	HITS-CLIP	19536157
MIRT666311	hsa-miR-545-3p	HITS-CLIP	23824327
MIRT666310	hsa-miR-23a-5p	HITS-CLIP	23824327
MIRT666309	hsa-miR-23b-5p	HITS-CLIP	23824327
MIRT666307	hsa-miR-4291	HITS-CLIP	23824327
MIRT666308	hsa-miR-452-3p	HITS-CLIP	23824327
MIRT666306	hsa-miR-3940-5p	HITS-CLIP	23824327
MIRT666305	hsa-miR-4507	HITS-CLIP	23824327
MIRT666304	hsa-miR-6839-3p	HITS-CLIP	23824327
MIRT639284	hsa-miR-1272	HITS-CLIP	23824327
MIRT639283	hsa-miR-1322	HITS-CLIP	23824327
MIRT639282	hsa-miR-4639-3p	HITS-CLIP	23824327
MIRT639281	hsa-miR-519d-5p	HITS-CLIP	23824327
MIRT639280	hsa-miR-5695	HITS-CLIP	23824327
MIRT639279	hsa-miR-515-5p	HITS-CLIP	23824327
MIRT639278	hsa-miR-519e-5p	HITS-CLIP	23824327
MIRT639284	hsa-miR-1272	HITS-CLIP	23824327
MIRT639283	hsa-miR-1322	HITS-CLIP	23824327
MIRT639282	hsa-miR-4639-3p	HITS-CLIP	23824327
MIRT639281	hsa-miR-519d-5p	HITS-CLIP	23824327
MIRT639280	hsa-miR-5695	HITS-CLIP	23824327
MIRT639279	hsa-miR-515-5p	HITS-CLIP	23824327
MIRT639278	hsa-miR-519e-5p	HITS-CLIP	23824327
MIRT639284	hsa-miR-1272	HITS-CLIP	19536157
MIRT639283	hsa-miR-1322	HITS-CLIP	19536157
MIRT639282	hsa-miR-4639-3p	HITS-CLIP	19536157
MIRT639281	hsa-miR-519d-5p	HITS-CLIP	19536157
MIRT639280	hsa-miR-5695	HITS-CLIP	19536157
MIRT639279	hsa-miR-515-5p	HITS-CLIP	19536157
MIRT639278	hsa-miR-519e-5p	HITS-CLIP	19536157
MIRT639284	hsa-miR-1272	HITS-CLIP	19536157
MIRT639283	hsa-miR-1322	HITS-CLIP	19536157
MIRT639282	hsa-miR-4639-3p	HITS-CLIP	19536157
MIRT639281	hsa-miR-519d-5p	HITS-CLIP	19536157
MIRT639280	hsa-miR-5695	HITS-CLIP	19536157
MIRT639279	hsa-miR-515-5p	HITS-CLIP	19536157
MIRT639278	hsa-miR-519e-5p	HITS-CLIP	19536157
MIRT639284	hsa-miR-1272	HITS-CLIP	19536157
MIRT639283	hsa-miR-1322	HITS-CLIP	19536157
MIRT639282	hsa-miR-4639-3p	HITS-CLIP	19536157
MIRT639281	hsa-miR-519d-5p	HITS-CLIP	19536157
MIRT639280	hsa-miR-5695	HITS-CLIP	19536157
MIRT639279	hsa-miR-515-5p	HITS-CLIP	19536157
MIRT639278	hsa-miR-519e-5p	HITS-CLIP	19536157
MIRT713248	hsa-miR-4494	HITS-CLIP	19536157
MIRT713247	hsa-miR-499b-5p	HITS-CLIP	19536157
MIRT713246	hsa-miR-4330	HITS-CLIP	19536157
MIRT713245	hsa-miR-130b-5p	HITS-CLIP	19536157
MIRT713244	hsa-miR-4753-3p	HITS-CLIP	19536157
MIRT639284	hsa-miR-1272	HITS-CLIP	19536157
MIRT639283	hsa-miR-1322	HITS-CLIP	19536157
MIRT639282	hsa-miR-4639-3p	HITS-CLIP	19536157
MIRT639281	hsa-miR-519d-5p	HITS-CLIP	19536157
MIRT639280	hsa-miR-5695	HITS-CLIP	19536157
MIRT639279	hsa-miR-515-5p	HITS-CLIP	19536157
MIRT639278	hsa-miR-519e-5p	HITS-CLIP	19536157
MIRT666311	hsa-miR-545-3p	HITS-CLIP	23824327
MIRT666310	hsa-miR-23a-5p	HITS-CLIP	23824327
MIRT666309	hsa-miR-23b-5p	HITS-CLIP	23824327
MIRT666307	hsa-miR-4291	HITS-CLIP	23824327
MIRT666308	hsa-miR-452-3p	HITS-CLIP	23824327
MIRT666306	hsa-miR-3940-5p	HITS-CLIP	23824327
MIRT666305	hsa-miR-4507	HITS-CLIP	23824327
MIRT666304	hsa-miR-6839-3p	HITS-CLIP	23824327
MIRT639284	hsa-miR-1272	HITS-CLIP	23824327
MIRT639283	hsa-miR-1322	HITS-CLIP	23824327
MIRT639282	hsa-miR-4639-3p	HITS-CLIP	23824327
MIRT639281	hsa-miR-519d-5p	HITS-CLIP	23824327
MIRT639280	hsa-miR-5695	HITS-CLIP	23824327
MIRT639279	hsa-miR-515-5p	HITS-CLIP	23824327
MIRT639278	hsa-miR-519e-5p	HITS-CLIP	23824327
MIRT639284	hsa-miR-1272	HITS-CLIP	23824327
MIRT639283	hsa-miR-1322	HITS-CLIP	23824327
MIRT639282	hsa-miR-4639-3p	HITS-CLIP	23824327
MIRT639281	hsa-miR-519d-5p	HITS-CLIP	23824327
MIRT639280	hsa-miR-5695	HITS-CLIP	23824327
MIRT639279	hsa-miR-515-5p	HITS-CLIP	23824327
MIRT639278	hsa-miR-519e-5p	HITS-CLIP	23824327
MIRT1354481	hsa-miR-1227	CLIP-seq
MIRT1354482	hsa-miR-124	CLIP-seq
MIRT1354483	hsa-miR-1257	CLIP-seq
MIRT1354484	hsa-miR-1287	CLIP-seq
MIRT1354485	hsa-miR-134	CLIP-seq
MIRT1354486	hsa-miR-1825	CLIP-seq
MIRT1354487	hsa-miR-199a-5p	CLIP-seq
MIRT1354488	hsa-miR-199b-5p	CLIP-seq
MIRT1354489	hsa-miR-2276	CLIP-seq
MIRT1354490	hsa-miR-3118	CLIP-seq
MIRT1354491	hsa-miR-3135	CLIP-seq
MIRT1354492	hsa-miR-3135b	CLIP-seq
MIRT1354493	hsa-miR-3163	CLIP-seq
MIRT1354494	hsa-miR-3194-3p	CLIP-seq
MIRT1354495	hsa-miR-335	CLIP-seq
MIRT1354496	hsa-miR-33a	CLIP-seq
MIRT1354497	hsa-miR-33b	CLIP-seq
MIRT1354498	hsa-miR-3908	CLIP-seq
MIRT1354499	hsa-miR-3942-5p	CLIP-seq
MIRT1354500	hsa-miR-3974	CLIP-seq
MIRT1354501	hsa-miR-410	CLIP-seq
MIRT1354502	hsa-miR-4252	CLIP-seq
MIRT1354503	hsa-miR-4275	CLIP-seq
MIRT1354504	hsa-miR-4436a	CLIP-seq
MIRT1354505	hsa-miR-4459	CLIP-seq
MIRT1354506	hsa-miR-4474-5p	CLIP-seq
MIRT1354507	hsa-miR-4700-3p	CLIP-seq
MIRT1354508	hsa-miR-4703-5p	CLIP-seq
MIRT1354509	hsa-miR-4708-3p	CLIP-seq
MIRT1354510	hsa-miR-4738-3p	CLIP-seq
MIRT1354511	hsa-miR-4766-3p	CLIP-seq
MIRT1354512	hsa-miR-4766-5p	CLIP-seq
MIRT1354513	hsa-miR-4772-3p	CLIP-seq
MIRT1354514	hsa-miR-4786-5p	CLIP-seq
MIRT1354515	hsa-miR-499a-5p	CLIP-seq
MIRT1354516	hsa-miR-506	CLIP-seq
MIRT1354517	hsa-miR-517b	CLIP-seq
MIRT1354518	hsa-miR-548a-3p	CLIP-seq
MIRT1354519	hsa-miR-548c-3p	CLIP-seq
MIRT1354520	hsa-miR-548e	CLIP-seq
MIRT1354521	hsa-miR-548f	CLIP-seq
MIRT1354522	hsa-miR-548l	CLIP-seq
MIRT1354523	hsa-miR-548n	CLIP-seq
MIRT1354524	hsa-miR-582-3p	CLIP-seq
MIRT1354525	hsa-miR-875-3p	CLIP-seq
MIRT1354526	hsa-miR-943	CLIP-seq
MIRT1354492	hsa-miR-3135b	CLIP-seq
MIRT1553714	hsa-miR-3612	CLIP-seq
MIRT1553715	hsa-miR-3652	CLIP-seq
MIRT1553716	hsa-miR-3660	CLIP-seq
MIRT1553717	hsa-miR-4430	CLIP-seq
MIRT1553718	hsa-miR-4443	CLIP-seq
MIRT1553719	hsa-miR-4505	CLIP-seq
MIRT1553720	hsa-miR-4526	CLIP-seq
MIRT1553721	hsa-miR-4645-3p	CLIP-seq
MIRT1553722	hsa-miR-647	CLIP-seq
MIRT1553723	hsa-miR-650	CLIP-seq
MIRT2104876	hsa-miR-19a	CLIP-seq
MIRT2104877	hsa-miR-19b	CLIP-seq
MIRT1354489	hsa-miR-2276	CLIP-seq
MIRT2104878	hsa-miR-3140-3p	CLIP-seq
MIRT1354494	hsa-miR-3194-3p	CLIP-seq
MIRT2104879	hsa-miR-3650	CLIP-seq
MIRT2104880	hsa-miR-4307	CLIP-seq
MIRT2104881	hsa-miR-4315	CLIP-seq
MIRT2104882	hsa-miR-4716-5p	CLIP-seq
MIRT2104883	hsa-miR-4790-5p	CLIP-seq
MIRT2329572	hsa-miR-142-5p	CLIP-seq
MIRT2329573	hsa-miR-181a	CLIP-seq
MIRT2329574	hsa-miR-181b	CLIP-seq
MIRT2329575	hsa-miR-181c	CLIP-seq
MIRT2329576	hsa-miR-181d	CLIP-seq
MIRT2104876	hsa-miR-19a	CLIP-seq
MIRT2104877	hsa-miR-19b	CLIP-seq
MIRT2329577	hsa-miR-3158-5p	CLIP-seq
MIRT2329578	hsa-miR-340	CLIP-seq
MIRT2329579	hsa-miR-3686	CLIP-seq
MIRT2329580	hsa-miR-4262	CLIP-seq
MIRT2329581	hsa-miR-4652-3p	CLIP-seq
MIRT2329582	hsa-miR-4777-3p	CLIP-seq
MIRT2329583	hsa-miR-513b	CLIP-seq
MIRT2329584	hsa-miR-520d-5p	CLIP-seq
MIRT2329585	hsa-miR-524-5p	CLIP-seq
MIRT2394649	hsa-miR-1238	CLIP-seq
MIRT2394650	hsa-miR-3942-3p	CLIP-seq
MIRT2690966	hsa-miR-3919	CLIP-seq
MIRT2690967	hsa-miR-3925-5p	CLIP-seq
MIRT2690968	hsa-miR-4468	CLIP-seq
MIRT2690969	hsa-miR-4792	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
KLF8	Unknown	17671186

Gene ontology (GO) Show/Hide all (81)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001692	Process	Histamine metabolic process	TAS	23505051
GO:0005326	Function	Neurotransmitter transmembrane transporter activity	IDA	10196521, 16581093, 20858707
GO:0005326	Function	Neurotransmitter transmembrane transporter activity	IEA
GO:0005326	Function	Neurotransmitter transmembrane transporter activity	IMP	23505051
GO:0005515	Function	Protein binding	IPI	17474147
GO:0005634	Component	Nucleus	IEA
GO:0005640	Component	Nuclear outer membrane	IEA
GO:0005739	Component	Mitochondrion	IEA
GO:0005886	Component	Plasma membrane	IDA	20858707, 23137377
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	9933568
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006836	Process	Neurotransmitter transport	IDA	20858707
GO:0006836	Process	Neurotransmitter transport	IEA
GO:0006837	Process	Serotonin transport	IDA	10196521, 16581093, 20858707
GO:0006837	Process	Serotonin transport	IEA
GO:0008504	Function	Monoamine transmembrane transporter activity	IDA	10196521, 16581093, 20858707
GO:0008504	Function	Monoamine transmembrane transporter activity	IEA
GO:0008504	Function	Monoamine transmembrane transporter activity	IMP	23505051
GO:0008514	Function	Organic anion transmembrane transporter activity	ISS
GO:0009925	Component	Basal plasma membrane	IEA
GO:0012505	Component	Endomembrane system	IEA
GO:0012505	Component	Endomembrane system	ISS
GO:0015101	Function	Organic cation transmembrane transporter activity	EXP	19141712
GO:0015101	Function	Organic cation transmembrane transporter activity	IBA
GO:0015101	Function	Organic cation transmembrane transporter activity	IDA	10966924, 16024787, 17460754, 22806583, 24291757
GO:0015101	Function	Organic cation transmembrane transporter activity	IEA
GO:0015101	Function	Organic cation transmembrane transporter activity	TAS	9933568
GO:0015606	Function	Spermidine transmembrane transporter activity	ISS
GO:0015651	Function	Quaternary ammonium group transmembrane transporter activity	IDA	10966924, 20858707
GO:0015651	Function	Quaternary ammonium group transmembrane transporter activity	IEA
GO:0015695	Process	Organic cation transport	IBA
GO:0015695	Process	Organic cation transport	IDA	10966924, 16024787
GO:0015695	Process	Organic cation transport	IDA	22806583, 24291757
GO:0015695	Process	Organic cation transport	IEA
GO:0015695	Process	Organic cation transport	TAS	9933568
GO:0015697	Process	Quaternary ammonium group transport	IDA	10966924
GO:0015697	Process	Quaternary ammonium group transport	IDA	20858707
GO:0015697	Process	Quaternary ammonium group transport	IEA
GO:0015711	Process	Organic anion transport	ISS
GO:0015718	Process	Monocarboxylic acid transport	IEA
GO:0015844	Process	Monoamine transport	IEA
GO:0015844	Process	Monoamine transport	IMP	23505051
GO:0015848	Process	Spermidine transport	ISS
GO:0015850	Process	Organic hydroxy compound transport	IEA
GO:0015872	Process	Dopamine transport	IDA	16581093, 20858707
GO:0015872	Process	Dopamine transport	IEA
GO:0015874	Process	Norepinephrine transport	IDA	10196521, 16581093, 20858707
GO:0015874	Process	Norepinephrine transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	9933568
GO:0016323	Component	Basolateral plasma membrane	IDA	15817714
GO:0016323	Component	Basolateral plasma membrane	IEA
GO:0016324	Component	Apical plasma membrane	IDA	15817714, 16263091
GO:0016324	Component	Apical plasma membrane	IEA
GO:0019534	Function	Toxin transmembrane transporter activity	IDA	22806583, 24291757
GO:0022857	Function	Transmembrane transporter activity	IEA
GO:0031965	Component	Nuclear membrane	IEA
GO:0031966	Component	Mitochondrial membrane	IEA
GO:0031966	Component	Mitochondrial membrane	ISS
GO:0032098	Process	Regulation of appetite	IEA
GO:0042908	Process	Xenobiotic transport	IDA	20858707, 22806583, 24291757
GO:0043025	Component	Neuronal cell body	IEA
GO:0048241	Process	Epinephrine transport	IDA	10196521, 16581093, 20858707
GO:0051608	Process	Histamine transport	IDA	16581093, 20858707
GO:0051608	Process	Histamine transport	IEA
GO:0051608	Process	Histamine transport	IEA
GO:0051610	Process	Serotonin uptake	IDA	20858707
GO:0051615	Process	Histamine uptake	IDA	20858707
GO:0051615	Process	Histamine uptake	IEA
GO:0051615	Process	Histamine uptake	IMP	23505051
GO:0051620	Process	Norepinephrine uptake	IDA	20858707
GO:0051625	Process	Epinephrine uptake	IDA	20858707
GO:0051649	Process	Establishment of localization in cell	IEA
GO:0055085	Process	Transmembrane transport	IEA
GO:0072530	Process	Purine-containing compound transmembrane transport	TAS
GO:0090494	Process	Dopamine uptake	IDA	20858707
GO:0098793	Component	Presynapse	IEA
GO:0150104	Process	Transport across blood-brain barrier	NAS	26590417, 30280653
GO:1903711	Process	Spermidine transmembrane transport	IEA
GO:1990748	Process	Cellular detoxification	IDA	22806583, 24291757

Other IDs

• MIM: 604842
• HGNC: 10967
• e!Ensembl: ENSG00000146477

Protein

• UniProt ID: O75751
• Protein name: Solute carrier family 22 member 3 (Extraneuronal monoamine transporter) (EMT) (Organic cation transporter 3) (OCT3)
• Protein function: Electrogenic voltage-dependent transporter that mediates the transport of a variety of organic cations such as endogenous bioactive amines, cationic drugs and xenobiotics (PubMed:10196521, PubMed:10966924, PubMed:12538837, PubMed:17460754, PubMe
• PDB: 7ZH0 , 7ZH6 , 7ZHA
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07690	MFS_1	142 → 485	Major Facilitator Superfamily	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in liver (PubMed:10196521, PubMed:9933568). Expressed in intestine (PubMed:16263091, PubMed:20858707). Expressed in kidney in proximal tubular cells (PubMed:10966924). Expressed in placenta (PubMed:10966924, PubMed:9933568).
• Sequence:

  MPSFDEALQRVGEFGRFQRRVFLLLCLTGVTFAFLFVGVVFLGTQPDHYWCRGPSAAALA
  ERCGWSPEEEWNRTAPASRGPEPPERRGRCQRYLLEAANDSASATSALSCADPLAAFPNR
  SAPLVPCRGGWRYAQAHSTIVSEFDLVCVNAWMLDLTQAILNLGFLTGAFTLGYAADRYG
  RIVIYLLSCLGVGVTGVVVAFAPNFPVFVIFRFLQGVFGKGTWMTCYVIVTEIVGSKQRR
  IVGIVIQMFFTLGIIILPGIAYFIPNWQGIQLAITLPSFLFLLYYWVVPESPRWLITRKK
  GDKALQILRRIAKCNGKYLSSNYSEITVTDEEVSNPSFLDLVRTPQMRKCTLILMFAWFT
  SAVVYQGLVMRLGIIGGNLYIDFFISGVVELPGALLILLTIERLGRRLPFAASNIVAGVA
  CLVTAFLPEGIAWLRTTVATLGRLGITMAFEIVYLVNSELYPTTLRNFGVSLCSGLCDFG
  GIIAPFLLFRLAAVWLELPLIIFGILASICGGLVMLLPETKGIALPETVDDVEKLGSPHS
  CKCGRNKKTPVSRSHL

• Sequence length: 556

Pathways

KEGG Pathway	Reactome Pathway
Choline metabolism in cancer	Abacavir transmembrane transport
	Organic cation transport

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (29)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
BARRETT'S ESOPHAGUS	—	GWAS catalog	35882562	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	32887889	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANCER	—	GWAS catalog	32887889	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASE	—	GWAS catalog	37947095	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	21242260, 32887889	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	24262325, 33619380, 36474045, 37947095, 38062574	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, TYPE 2	—	CTD	28869590	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DUODENAL ULCER	—	GWAS catalog	38036781	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL ADENOCARCINOMA	—	GWAS catalog	35882562	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN-RECEPTOR NEGATIVE BREAST CANCER	—	GWAS catalog	32887889	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FAMILIAL HYPERLIPIDEMIA	—	GWAS catalog	34906840	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	33356394	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	32887889	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	32887889	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	39349817	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	GWAS catalog	34737426, 37947095, 38072966	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	CTD, Disgenet CTD, Disgenet	27401566	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	32887889	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN ENDOMETRIOID CARCINOMA	—	GWAS catalog	32887889	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN SEROUS CARCINOMA	—	GWAS catalog	32887889	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatic adenocarcinoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PEPTIC ULCER DISEASE	—	GWAS catalog	38036781	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	18264097, 25939597, 26034056, 27262462, 29892016, 32887889, 33293427, 34290314, 38538606, 39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	18264097, 25939597, 26034056, 27262462, 29892016, 32887889, 33293427, 34290314, 38538606, 39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	17173048	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	30019117	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	29924316, 32887889	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	28869590, 30054458, 30297969, 32541925, 34594039, 35551307, 38062574, 38374256, 38685053, 39349817, 39379762, 40465716	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (123)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma of large intestine	Colorectal Cancer	GWASCAT_DG	21242260		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	GWASDB_DG	22843504		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	19274762		★☆☆☆☆ Found in Text Mining only
Bicuspid aortic valve	Bicuspid aortic valve	BEFREE	30280445		★☆☆☆☆ Found in Text Mining only
Bladder neck obstruction	Bladder neck obstruction	BEFREE	22521288		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	18281558, 18676852, 21951846		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	12841847, 17268817, 20506227, 21535870, 25152370, 25373557, 27044595, 27412325, 29620155, 30305210, 30621769, 31260685		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cap Myopathy	Cap myopathy	Pubtator	21820706	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	28515962		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	22439694	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

SLC22A2 4 shared diseasesBarrett esophagus, Duodenal ulcer, Esophageal adenocarcinoma, Hyperlipidemia 3 shared pathwaysCholine metabolism in cancer, Organic cation transport, Abacavir transmembrane transport 6 shared evidence sourcesGWAS catalog (Barrett esophagus), Disgenet (Obesity), GWAS catalog (Duodenal ulcer), GWAS catalog (Esophageal adenocarcinoma), GWAS catalog (Hyperlipidemia), CTD (Obesity) Related via 4 shared diseases including Barrett esophagus, Duodenal ulcer — evidence mostly GWAS catalog. LMTK2 3 shared diseasesCancer, Estrogen-receptor negative breast cancer, Ovarian serous carcinoma 3 shared evidence sourcesGWAS catalog (Cancer), GWAS catalog (Estrogen-receptor negative breast cancer), GWAS catalog (Ovarian serous carcinoma) Related via 3 shared diseases including Cancer, Estrogen-receptor negative breast cancer — evidence mostly GWAS catalog. PRKCI 3 shared diseasesCancer, Estrogen-receptor negative breast cancer, Ovarian serous carcinoma 3 shared evidence sourcesGWAS catalog (Cancer), GWAS catalog (Estrogen-receptor negative breast cancer), GWAS catalog (Ovarian serous carcinoma) Related via 3 shared diseases including Cancer, Estrogen-receptor negative breast cancer — evidence mostly GWAS catalog. BCL3 5 shared diseasesBarrett esophagus, Cancer, Esophageal adenocarcinoma, Hyperlipidemia, Peptic ulcer disease 5 shared evidence sourcesGWAS catalog (Barrett esophagus), GWAS catalog (Cancer), GWAS catalog (Esophageal adenocarcinoma), GWAS catalog (Hyperlipidemia), GWAS catalog (Peptic ulcer disease) Related via 5 shared diseases including Barrett esophagus, Cancer — evidence mostly GWAS catalog. MSMB 3 shared diseasesCancer, Estrogen-receptor negative breast cancer, Ovarian serous carcinoma 3 shared evidence sourcesGWAS catalog (Cancer), GWAS catalog (Estrogen-receptor negative breast cancer), GWAS catalog (Ovarian serous carcinoma) Related via 3 shared diseases including Cancer, Estrogen-receptor negative breast cancer — evidence mostly GWAS catalog.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
SLC22A2	4	["Barrett esophagus","Duodenal ulcer","Esophageal adenocarcinoma","Hyperlipidemia"]	3	["Choline metabolism in cancer","Organic cation transport","Abacavir transmembrane transport"]	6	["GWAS catalog (Barrett esophagus)","Disgenet (Obesity)","GWAS catalog (Duodenal ulcer)","GWAS catalog (Esophageal adenocarcinoma)","GWAS catalog (Hyperlipidemia)","CTD (Obesity)"]
LMTK2	3	["Cancer","Estrogen-receptor negative breast cancer","Ovarian serous carcinoma"]	0	[]	3	["GWAS catalog (Cancer)","GWAS catalog (Estrogen-receptor negative breast cancer)","GWAS catalog (Ovarian serous carcinoma)"]
PRKCI	3	["Cancer","Estrogen-receptor negative breast cancer","Ovarian serous carcinoma"]	0	[]	3	["GWAS catalog (Cancer)","GWAS catalog (Estrogen-receptor negative breast cancer)","GWAS catalog (Ovarian serous carcinoma)"]
BCL3	5	["Barrett esophagus","Cancer","Esophageal adenocarcinoma","Hyperlipidemia","Peptic ulcer disease"]	0	[]	5	["GWAS catalog (Barrett esophagus)","GWAS catalog (Cancer)","GWAS catalog (Esophageal adenocarcinoma)","GWAS catalog (Hyperlipidemia)","GWAS catalog (Peptic ulcer disease)"]
MSMB	3	["Cancer","Estrogen-receptor negative breast cancer","Ovarian serous carcinoma"]	0	[]	3	["GWAS catalog (Cancer)","GWAS catalog (Estrogen-receptor negative breast cancer)","GWAS catalog (Ovarian serous carcinoma)"]

Diseases Linked via Similar Genes

Major depressive disorder Linked via 2 of 5 related genesSLC22A2, PRKCI Bladder calculus Linked via 1 of 5 related genesSLC22A2 Kidney disease Linked via 1 of 5 related genesSLC22A2 Hypertensive nephropathy Linked via 1 of 5 related genesSLC22A2 Kidney failure Linked via 1 of 5 related genesSLC22A2

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Major depressive disorder	2	["SLC22A2","PRKCI"]
Bladder calculus	1	["SLC22A2"]
Kidney disease	1	["SLC22A2"]
Hypertensive nephropathy	1	["SLC22A2"]
Kidney failure	1	["SLC22A2"]