Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID	6581
Gene name	Solute carrier family 22 member 3
Gene symbol	SLC22A3
Synonyms (NCBI Gene)	EMTEMTHOCT3
Chromosome	6
Chromosome location	6q25.3
Summary	Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. This gene is one of three similar c

202

Show/Hide all (202)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019444	hsa-miR-148b-3p	Microarray	17612493
MIRT021441	hsa-miR-9-5p	Microarray	17612493
MIRT022967	hsa-miR-124-3p	Microarray	18668037
MIRT639284	hsa-miR-1272	HITS-CLIP	19536157
MIRT639283	hsa-miR-1322	HITS-CLIP	19536157
MIRT639282	hsa-miR-4639-3p	HITS-CLIP	19536157
MIRT639281	hsa-miR-519d-5p	HITS-CLIP	19536157
MIRT639280	hsa-miR-5695	HITS-CLIP	19536157
MIRT639279	hsa-miR-515-5p	HITS-CLIP	19536157
MIRT639278	hsa-miR-519e-5p	HITS-CLIP	19536157
MIRT639284	hsa-miR-1272	HITS-CLIP	19536157
MIRT639283	hsa-miR-1322	HITS-CLIP	19536157
MIRT639282	hsa-miR-4639-3p	HITS-CLIP	19536157
MIRT639281	hsa-miR-519d-5p	HITS-CLIP	19536157
MIRT639280	hsa-miR-5695	HITS-CLIP	19536157
MIRT639279	hsa-miR-515-5p	HITS-CLIP	19536157
MIRT639278	hsa-miR-519e-5p	HITS-CLIP	19536157
MIRT639284	hsa-miR-1272	HITS-CLIP	19536157
MIRT639283	hsa-miR-1322	HITS-CLIP	19536157
MIRT639282	hsa-miR-4639-3p	HITS-CLIP	19536157
MIRT639281	hsa-miR-519d-5p	HITS-CLIP	19536157
MIRT639280	hsa-miR-5695	HITS-CLIP	19536157
MIRT639279	hsa-miR-515-5p	HITS-CLIP	19536157
MIRT639278	hsa-miR-519e-5p	HITS-CLIP	19536157
MIRT713248	hsa-miR-4494	HITS-CLIP	19536157
MIRT713247	hsa-miR-499b-5p	HITS-CLIP	19536157
MIRT713246	hsa-miR-4330	HITS-CLIP	19536157
MIRT713245	hsa-miR-130b-5p	HITS-CLIP	19536157
MIRT713244	hsa-miR-4753-3p	HITS-CLIP	19536157
MIRT639284	hsa-miR-1272	HITS-CLIP	19536157
MIRT639283	hsa-miR-1322	HITS-CLIP	19536157
MIRT639282	hsa-miR-4639-3p	HITS-CLIP	19536157
MIRT639281	hsa-miR-519d-5p	HITS-CLIP	19536157
MIRT639280	hsa-miR-5695	HITS-CLIP	19536157
MIRT639279	hsa-miR-515-5p	HITS-CLIP	19536157
MIRT639278	hsa-miR-519e-5p	HITS-CLIP	19536157
MIRT666311	hsa-miR-545-3p	HITS-CLIP	23824327
MIRT666310	hsa-miR-23a-5p	HITS-CLIP	23824327
MIRT666309	hsa-miR-23b-5p	HITS-CLIP	23824327
MIRT666307	hsa-miR-4291	HITS-CLIP	23824327
MIRT666308	hsa-miR-452-3p	HITS-CLIP	23824327
MIRT666306	hsa-miR-3940-5p	HITS-CLIP	23824327
MIRT666305	hsa-miR-4507	HITS-CLIP	23824327
MIRT666304	hsa-miR-6839-3p	HITS-CLIP	23824327
MIRT639284	hsa-miR-1272	HITS-CLIP	23824327
MIRT639283	hsa-miR-1322	HITS-CLIP	23824327
MIRT639282	hsa-miR-4639-3p	HITS-CLIP	23824327
MIRT639281	hsa-miR-519d-5p	HITS-CLIP	23824327
MIRT639280	hsa-miR-5695	HITS-CLIP	23824327
MIRT639279	hsa-miR-515-5p	HITS-CLIP	23824327
MIRT639278	hsa-miR-519e-5p	HITS-CLIP	23824327
MIRT639284	hsa-miR-1272	HITS-CLIP	23824327
MIRT639283	hsa-miR-1322	HITS-CLIP	23824327
MIRT639282	hsa-miR-4639-3p	HITS-CLIP	23824327
MIRT639281	hsa-miR-519d-5p	HITS-CLIP	23824327
MIRT639280	hsa-miR-5695	HITS-CLIP	23824327
MIRT639279	hsa-miR-515-5p	HITS-CLIP	23824327
MIRT639278	hsa-miR-519e-5p	HITS-CLIP	23824327
MIRT639284	hsa-miR-1272	HITS-CLIP	19536157
MIRT639283	hsa-miR-1322	HITS-CLIP	19536157
MIRT639282	hsa-miR-4639-3p	HITS-CLIP	19536157
MIRT639281	hsa-miR-519d-5p	HITS-CLIP	19536157
MIRT639280	hsa-miR-5695	HITS-CLIP	19536157
MIRT639279	hsa-miR-515-5p	HITS-CLIP	19536157
MIRT639278	hsa-miR-519e-5p	HITS-CLIP	19536157
MIRT639284	hsa-miR-1272	HITS-CLIP	19536157
MIRT639283	hsa-miR-1322	HITS-CLIP	19536157
MIRT639282	hsa-miR-4639-3p	HITS-CLIP	19536157
MIRT639281	hsa-miR-519d-5p	HITS-CLIP	19536157
MIRT639280	hsa-miR-5695	HITS-CLIP	19536157
MIRT639279	hsa-miR-515-5p	HITS-CLIP	19536157
MIRT639278	hsa-miR-519e-5p	HITS-CLIP	19536157
MIRT639284	hsa-miR-1272	HITS-CLIP	19536157
MIRT639283	hsa-miR-1322	HITS-CLIP	19536157
MIRT639282	hsa-miR-4639-3p	HITS-CLIP	19536157
MIRT639281	hsa-miR-519d-5p	HITS-CLIP	19536157
MIRT639280	hsa-miR-5695	HITS-CLIP	19536157
MIRT639279	hsa-miR-515-5p	HITS-CLIP	19536157
MIRT639278	hsa-miR-519e-5p	HITS-CLIP	19536157
MIRT713248	hsa-miR-4494	HITS-CLIP	19536157
MIRT713247	hsa-miR-499b-5p	HITS-CLIP	19536157
MIRT713246	hsa-miR-4330	HITS-CLIP	19536157
MIRT713245	hsa-miR-130b-5p	HITS-CLIP	19536157
MIRT713244	hsa-miR-4753-3p	HITS-CLIP	19536157
MIRT639284	hsa-miR-1272	HITS-CLIP	19536157
MIRT639283	hsa-miR-1322	HITS-CLIP	19536157
MIRT639282	hsa-miR-4639-3p	HITS-CLIP	19536157
MIRT639281	hsa-miR-519d-5p	HITS-CLIP	19536157
MIRT639280	hsa-miR-5695	HITS-CLIP	19536157
MIRT639279	hsa-miR-515-5p	HITS-CLIP	19536157
MIRT639278	hsa-miR-519e-5p	HITS-CLIP	19536157
MIRT666311	hsa-miR-545-3p	HITS-CLIP	23824327
MIRT666310	hsa-miR-23a-5p	HITS-CLIP	23824327
MIRT666309	hsa-miR-23b-5p	HITS-CLIP	23824327
MIRT666307	hsa-miR-4291	HITS-CLIP	23824327
MIRT666308	hsa-miR-452-3p	HITS-CLIP	23824327
MIRT666306	hsa-miR-3940-5p	HITS-CLIP	23824327
MIRT666305	hsa-miR-4507	HITS-CLIP	23824327
MIRT666304	hsa-miR-6839-3p	HITS-CLIP	23824327
MIRT639284	hsa-miR-1272	HITS-CLIP	23824327
MIRT639283	hsa-miR-1322	HITS-CLIP	23824327
MIRT639282	hsa-miR-4639-3p	HITS-CLIP	23824327
MIRT639281	hsa-miR-519d-5p	HITS-CLIP	23824327
MIRT639280	hsa-miR-5695	HITS-CLIP	23824327
MIRT639279	hsa-miR-515-5p	HITS-CLIP	23824327
MIRT639278	hsa-miR-519e-5p	HITS-CLIP	23824327
MIRT639284	hsa-miR-1272	HITS-CLIP	23824327
MIRT639283	hsa-miR-1322	HITS-CLIP	23824327
MIRT639282	hsa-miR-4639-3p	HITS-CLIP	23824327
MIRT639281	hsa-miR-519d-5p	HITS-CLIP	23824327
MIRT639280	hsa-miR-5695	HITS-CLIP	23824327
MIRT639279	hsa-miR-515-5p	HITS-CLIP	23824327
MIRT639278	hsa-miR-519e-5p	HITS-CLIP	23824327
MIRT1354481	hsa-miR-1227	CLIP-seq
MIRT1354482	hsa-miR-124	CLIP-seq
MIRT1354483	hsa-miR-1257	CLIP-seq
MIRT1354484	hsa-miR-1287	CLIP-seq
MIRT1354485	hsa-miR-134	CLIP-seq
MIRT1354486	hsa-miR-1825	CLIP-seq
MIRT1354487	hsa-miR-199a-5p	CLIP-seq
MIRT1354488	hsa-miR-199b-5p	CLIP-seq
MIRT1354489	hsa-miR-2276	CLIP-seq
MIRT1354490	hsa-miR-3118	CLIP-seq
MIRT1354491	hsa-miR-3135	CLIP-seq
MIRT1354492	hsa-miR-3135b	CLIP-seq
MIRT1354493	hsa-miR-3163	CLIP-seq
MIRT1354494	hsa-miR-3194-3p	CLIP-seq
MIRT1354495	hsa-miR-335	CLIP-seq
MIRT1354496	hsa-miR-33a	CLIP-seq
MIRT1354497	hsa-miR-33b	CLIP-seq
MIRT1354498	hsa-miR-3908	CLIP-seq
MIRT1354499	hsa-miR-3942-5p	CLIP-seq
MIRT1354500	hsa-miR-3974	CLIP-seq
MIRT1354501	hsa-miR-410	CLIP-seq
MIRT1354502	hsa-miR-4252	CLIP-seq
MIRT1354503	hsa-miR-4275	CLIP-seq
MIRT1354504	hsa-miR-4436a	CLIP-seq
MIRT1354505	hsa-miR-4459	CLIP-seq
MIRT1354506	hsa-miR-4474-5p	CLIP-seq
MIRT1354507	hsa-miR-4700-3p	CLIP-seq
MIRT1354508	hsa-miR-4703-5p	CLIP-seq
MIRT1354509	hsa-miR-4708-3p	CLIP-seq
MIRT1354510	hsa-miR-4738-3p	CLIP-seq
MIRT1354511	hsa-miR-4766-3p	CLIP-seq
MIRT1354512	hsa-miR-4766-5p	CLIP-seq
MIRT1354513	hsa-miR-4772-3p	CLIP-seq
MIRT1354514	hsa-miR-4786-5p	CLIP-seq
MIRT1354515	hsa-miR-499a-5p	CLIP-seq
MIRT1354516	hsa-miR-506	CLIP-seq
MIRT1354517	hsa-miR-517b	CLIP-seq
MIRT1354518	hsa-miR-548a-3p	CLIP-seq
MIRT1354519	hsa-miR-548c-3p	CLIP-seq
MIRT1354520	hsa-miR-548e	CLIP-seq
MIRT1354521	hsa-miR-548f	CLIP-seq
MIRT1354522	hsa-miR-548l	CLIP-seq
MIRT1354523	hsa-miR-548n	CLIP-seq
MIRT1354524	hsa-miR-582-3p	CLIP-seq
MIRT1354525	hsa-miR-875-3p	CLIP-seq
MIRT1354526	hsa-miR-943	CLIP-seq
MIRT1354492	hsa-miR-3135b	CLIP-seq
MIRT1553714	hsa-miR-3612	CLIP-seq
MIRT1553715	hsa-miR-3652	CLIP-seq
MIRT1553716	hsa-miR-3660	CLIP-seq
MIRT1553717	hsa-miR-4430	CLIP-seq
MIRT1553718	hsa-miR-4443	CLIP-seq
MIRT1553719	hsa-miR-4505	CLIP-seq
MIRT1553720	hsa-miR-4526	CLIP-seq
MIRT1553721	hsa-miR-4645-3p	CLIP-seq
MIRT1553722	hsa-miR-647	CLIP-seq
MIRT1553723	hsa-miR-650	CLIP-seq
MIRT2104876	hsa-miR-19a	CLIP-seq
MIRT2104877	hsa-miR-19b	CLIP-seq
MIRT1354489	hsa-miR-2276	CLIP-seq
MIRT2104878	hsa-miR-3140-3p	CLIP-seq
MIRT1354494	hsa-miR-3194-3p	CLIP-seq
MIRT2104879	hsa-miR-3650	CLIP-seq
MIRT2104880	hsa-miR-4307	CLIP-seq
MIRT2104881	hsa-miR-4315	CLIP-seq
MIRT2104882	hsa-miR-4716-5p	CLIP-seq
MIRT2104883	hsa-miR-4790-5p	CLIP-seq
MIRT2329572	hsa-miR-142-5p	CLIP-seq
MIRT2329573	hsa-miR-181a	CLIP-seq
MIRT2329574	hsa-miR-181b	CLIP-seq
MIRT2329575	hsa-miR-181c	CLIP-seq
MIRT2329576	hsa-miR-181d	CLIP-seq
MIRT2104876	hsa-miR-19a	CLIP-seq
MIRT2104877	hsa-miR-19b	CLIP-seq
MIRT2329577	hsa-miR-3158-5p	CLIP-seq
MIRT2329578	hsa-miR-340	CLIP-seq
MIRT2329579	hsa-miR-3686	CLIP-seq
MIRT2329580	hsa-miR-4262	CLIP-seq
MIRT2329581	hsa-miR-4652-3p	CLIP-seq
MIRT2329582	hsa-miR-4777-3p	CLIP-seq
MIRT2329583	hsa-miR-513b	CLIP-seq
MIRT2329584	hsa-miR-520d-5p	CLIP-seq
MIRT2329585	hsa-miR-524-5p	CLIP-seq
MIRT2394649	hsa-miR-1238	CLIP-seq
MIRT2394650	hsa-miR-3942-3p	CLIP-seq
MIRT2690966	hsa-miR-3919	CLIP-seq
MIRT2690967	hsa-miR-3925-5p	CLIP-seq
MIRT2690968	hsa-miR-4468	CLIP-seq
MIRT2690969	hsa-miR-4792	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
KLF8	Unknown	17671186

Show/Hide all (81)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001692	Process	Histamine metabolic process	TAS	23505051
GO:0005326	Function	Neurotransmitter transmembrane transporter activity	IDA	10196521, 16581093, 20858707
GO:0005326	Function	Neurotransmitter transmembrane transporter activity	IEA
GO:0005326	Function	Neurotransmitter transmembrane transporter activity	IMP	23505051
GO:0005515	Function	Protein binding	IPI	17474147
GO:0005634	Component	Nucleus	IEA
GO:0005640	Component	Nuclear outer membrane	IEA
GO:0005739	Component	Mitochondrion	IEA
GO:0005886	Component	Plasma membrane	IDA	20858707, 23137377
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	9933568
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006836	Process	Neurotransmitter transport	IDA	20858707
GO:0006836	Process	Neurotransmitter transport	IEA
GO:0006837	Process	Serotonin transport	IDA	10196521, 16581093, 20858707
GO:0006837	Process	Serotonin transport	IEA
GO:0008504	Function	Monoamine transmembrane transporter activity	IDA	10196521, 16581093, 20858707
GO:0008504	Function	Monoamine transmembrane transporter activity	IEA
GO:0008504	Function	Monoamine transmembrane transporter activity	IMP	23505051
GO:0008514	Function	Organic anion transmembrane transporter activity	ISS
GO:0009925	Component	Basal plasma membrane	IEA
GO:0012505	Component	Endomembrane system	IEA
GO:0012505	Component	Endomembrane system	ISS
GO:0015101	Function	Organic cation transmembrane transporter activity	EXP	19141712
GO:0015101	Function	Organic cation transmembrane transporter activity	IBA
GO:0015101	Function	Organic cation transmembrane transporter activity	IDA	10966924, 16024787, 17460754, 22806583, 24291757
GO:0015101	Function	Organic cation transmembrane transporter activity	IEA
GO:0015101	Function	Organic cation transmembrane transporter activity	TAS	9933568
GO:0015606	Function	Spermidine transmembrane transporter activity	ISS
GO:0015651	Function	Quaternary ammonium group transmembrane transporter activity	IDA	10966924, 20858707
GO:0015651	Function	Quaternary ammonium group transmembrane transporter activity	IEA
GO:0015695	Process	Organic cation transport	IBA
GO:0015695	Process	Organic cation transport	IDA	10966924, 16024787
GO:0015695	Process	Organic cation transport	IDA	22806583, 24291757
GO:0015695	Process	Organic cation transport	IEA
GO:0015695	Process	Organic cation transport	TAS	9933568
GO:0015697	Process	Quaternary ammonium group transport	IDA	10966924
GO:0015697	Process	Quaternary ammonium group transport	IDA	20858707
GO:0015697	Process	Quaternary ammonium group transport	IEA
GO:0015711	Process	Organic anion transport	ISS
GO:0015718	Process	Monocarboxylic acid transport	IEA
GO:0015844	Process	Monoamine transport	IEA
GO:0015844	Process	Monoamine transport	IMP	23505051
GO:0015848	Process	Spermidine transport	ISS
GO:0015850	Process	Organic hydroxy compound transport	IEA
GO:0015872	Process	Dopamine transport	IDA	16581093, 20858707
GO:0015872	Process	Dopamine transport	IEA
GO:0015874	Process	Norepinephrine transport	IDA	10196521, 16581093, 20858707
GO:0015874	Process	Norepinephrine transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	9933568
GO:0016323	Component	Basolateral plasma membrane	IDA	15817714
GO:0016323	Component	Basolateral plasma membrane	IEA
GO:0016324	Component	Apical plasma membrane	IDA	15817714, 16263091
GO:0016324	Component	Apical plasma membrane	IEA
GO:0019534	Function	Toxin transmembrane transporter activity	IDA	22806583, 24291757
GO:0022857	Function	Transmembrane transporter activity	IEA
GO:0031965	Component	Nuclear membrane	IEA
GO:0031966	Component	Mitochondrial membrane	IEA
GO:0031966	Component	Mitochondrial membrane	ISS
GO:0032098	Process	Regulation of appetite	IEA
GO:0042908	Process	Xenobiotic transport	IDA	20858707, 22806583, 24291757
GO:0043025	Component	Neuronal cell body	IEA
GO:0048241	Process	Epinephrine transport	IDA	10196521, 16581093, 20858707
GO:0051608	Process	Histamine transport	IDA	16581093, 20858707
GO:0051608	Process	Histamine transport	IEA
GO:0051608	Process	Histamine transport	IEA
GO:0051610	Process	Serotonin uptake	IDA	20858707
GO:0051615	Process	Histamine uptake	IDA	20858707
GO:0051615	Process	Histamine uptake	IEA
GO:0051615	Process	Histamine uptake	IMP	23505051
GO:0051620	Process	Norepinephrine uptake	IDA	20858707
GO:0051625	Process	Epinephrine uptake	IDA	20858707
GO:0051649	Process	Establishment of localization in cell	IEA
GO:0055085	Process	Transmembrane transport	IEA
GO:0072530	Process	Purine-containing compound transmembrane transport	TAS
GO:0090494	Process	Dopamine uptake	IDA	20858707
GO:0098793	Component	Presynapse	IEA
GO:0150104	Process	Transport across blood-brain barrier	NAS	26590417, 30280653
GO:1903711	Process	Spermidine transmembrane transport	IEA
GO:1990748	Process	Cellular detoxification	IDA	22806583, 24291757

MIM	HGNC	e!Ensembl
604842	10967	ENSG00000146477

O75751

Protein name

Solute carrier family 22 member 3 (Extraneuronal monoamine transporter) (EMT) (Organic cation transporter 3) (OCT3)

Protein function

Electrogenic voltage-dependent transporter that mediates the transport of a variety of organic cations such as endogenous bioactive amines, cationic drugs and xenobiotics (PubMed:10196521, PubMed:10966924, PubMed:12538837, PubMed:17460754, PubMe

PDB

7ZH0 , 7ZH6 , 7ZHA

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07690	MFS_1	142 → 485	Major Facilitator Superfamily	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in liver (PubMed:10196521, PubMed:9933568). Expressed in intestine (PubMed:16263091, PubMed:20858707). Expressed in kidney in proximal tubular cells (PubMed:10966924). Expressed in placenta (PubMed:10966924, PubMed:9933568).

Sequence

MPSFDEALQRVGEFGRFQRRVFLLLCLTGVTFAFLFVGVVFLGTQPDHYWCRGPSAAALA
ERCGWSPEEEWNRTAPASRGPEPPERRGRCQRYLLEAANDSASATSALSCADPLAAFPNR
SAPLVPCRGGWRYAQAHSTIVSEFDLVCVNAWMLDLTQAILNLGFLTGAFTLGYAADRYG
RIVIYLLSCLGVGVTGVVVAFAPNFPVFVIFRFLQGVFGKGTWMTCYVIVTEIVGSKQRR
IVGIVIQMFFTLGIIILPGIAYFIPNWQGIQLAITLPSFLFLLYYWVVPESPRWLITRKK
GDKALQILRRIAKCNGKYLSSNYSEITVTDEEVSNPSFLDLVRTPQMRKCTLILMFAWFT
SAVVYQGLVMRLGIIGGNLYIDFFISGVVELPGALLILLTIERLGRRLPFAASNIVAGVA
CLVTAFLPEGIAWLRTTVATLGRLGITMAFEIVYLVNSELYPTTLRNFGVSLCSGLCDFG
GIIAPFLLFRLAAVWLELPLIIFGILASICGGLVMLLPETKGIALPETVDDVEKLGSPHS
CKCGRNKKTPVSRSHL

Sequence length

556

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (30)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BARRETT'S ESOPHAGUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, TYPE 2	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DUODENAL ULCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL ADENOCARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN-RECEPTOR NEGATIVE BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FAMILIAL HYPERLIPIDEMIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDITIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN ENDOMETRIOID CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN SEROUS CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatic adenocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PEPTIC ULCER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (123)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of large intestine	Colorectal Cancer	GWASCAT_DG	21242260		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	GWASDB_DG	22843504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	19274762		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bicuspid aortic valve	Bicuspid aortic valve	BEFREE	30280445		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder neck obstruction	Bladder neck obstruction	BEFREE	22521288		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	18281558, 18676852, 21951846		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	12841847, 17268817, 20506227, 21535870, 25152370, 25373557, 27044595, 27412325, 29620155, 30305210, 30621769, 31260685		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cap Myopathy	Cap myopathy	Pubtator	21820706	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	28515962		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	22439694	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	18281558, 18676852, 21951846		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	28122356, 28440436		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	27160114		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	20665672, 27893421, 37948393	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	27893421, 30772277		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carditis	Carditis	CTD_human_DG	21641380		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	23917144, 24382987		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholestasis	BEFREE	19591196		★★★★★ ★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	8663260		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cleidocranial Dysplasia	Cleidocranial Dysplasia	BEFREE	29357927		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	21242260, 31524264		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	GWASCAT_DG	21242260		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	GWASDB_DG	21242260		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	23555006, 30561001, 31360304, 31524264, 31732877, 31827238		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	GWASCAT_DG	21242260		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	23555006, 30561001, 33976257	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	23440379		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	25011053		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	19198611, 23036009, 25561729, 27417586, 27893421		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	19198611, 23036009, 23278389, 25561729, 27417586, 27893421		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	GWASDB_DG	19198611, 23202125, 24262325		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	Pubtator	27893421, 31870308, 32685059	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease Autosomal Dominant 1	Coronary artery disease	Pubtator	22216278	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	25561729	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	19198611, 23036009, 23278389, 25561729, 27417586, 27893421		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	GWASCAT_DG	19198611, 24262325		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cryptorchidism	Cryptorchidism	BEFREE	27606906, 28838001		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	26225835		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystitis	Cystitis	BEFREE	21951846		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	29287830		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	21900290, 28947922	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	15531531, 20429798		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	27609360, 28392895, 28625319, 30297296		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	CTD_human_DG	28869590		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	20429798		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dysgerminoma	Dysgerminoma	BEFREE	22937135		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	28743982, 30416380	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	30416380	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial multiple trichoepitheliomata	Multiple Trichoepithelioma	BEFREE	29416661, 31553703		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	31241979		★★★★★ ★☆☆☆☆ Found in Text Mining only
Germ cell tumor	Tumor	BEFREE	12727846, 16540528, 17349529, 17549357		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	21938739, 25348671, 25644290, 28994107		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	21938739, 25348671, 25644290, 28994107		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	25527128, 30405767		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gonadoblastoma	Gonadoblastoma	BEFREE	15105401, 18403106, 22937135, 31060547		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia, Familial	Hypercholesterolemia	BEFREE	30772277		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type IIa	Hyperlipoproteinemia	BEFREE	30772277		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	20429798		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	20303530		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	36461046	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	36461046	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	22439694, 22732500, 30250594		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphedema distichiasis syndrome	Lymphedema-Distichiasis Syndrome	BEFREE	27346194		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	12841847, 17268817, 20506227, 25373557, 27044595, 27412325, 29620155, 30305210, 30621769, 31260685		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	30742940		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of large intestine	Colorectal Neoplasms	GWASCAT_DG	21242260		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	28122356, 28440436		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	28272475, 29048402, 29258566, 29574322		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	17173048		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	GWASDB_DG	18264097		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	19274762, 20303530, 22231567, 22730461, 29425687, 31122254, 31593800		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	19493275, 29302045		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	18281558, 18676852, 21951846		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12841847, 17261754, 18281558, 19414369, 20025723, 24078401, 24568610, 25644290, 27113741, 29025375, 29849920, 30210930, 30857552, 31776419		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	21242260, 31524264		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	GWASCAT_DG	21242260		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	31032880		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	31421458		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	29287830		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	30473490		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	30653498		★★★★★ ★☆☆☆☆ Found in Text Mining only
MOHR-TRANEBJAERG SYNDROME	MOHR-TRANEBJAERG SYNDROME	BEFREE	28056464		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	21820706	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	36461046	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	21493818	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocarditis	Myocarditis	CTD_human_DG	21641380		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	GWASDB_DG	20512145		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	17169757, 17261754, 17549357, 20929579, 21938739, 22156015, 22439694, 23216104, 23440379, 23917144, 24668028, 25348671, 28056464, 28314267, 30676751, 30871240, 31479484 View all (2 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	19219857		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	CTD_human_DG	27401566		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	28947922, 39766774	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obsessive-Compulsive Disorder	Obsessive-Compulsive Disorder	BEFREE	17477885		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	28884332		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	28122356, 28440436		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	28272475, 29048402, 29258566, 29574322		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	28272475, 31874997, 37604837	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	31234714		★★★★★ ★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	29287830		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	GWASCAT_DG	18264097, 25939597, 26034056, 27262462, 29892016		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate carcinoma	Prostate cancer	BEFREE	19274762, 20303530, 22231567, 22730461, 29425687, 31122254, 31593800		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	17173048		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	19274762, 22231567		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	19318432, 19336566, 20651075, 21538423, 21820706, 22730461, 29266682, 33509203, 36254631	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	22231567	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psychotic Disorders	Psychosis	BEFREE	19219857		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	30111857	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	19190342		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	19190342, 25011053, 28181950		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiration Disorders	Respiration Disorders	BEFREE	26225835		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory Tract Diseases	BEFREE	26225835		★★★★★ ★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	BEFREE	19226408		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sex Differentiation Disorders	Sex Differentiation Disorders	BEFREE	17875493, 18403106, 22937135, 25598272		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	31446534		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	28314267		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	19414369		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of mouth	Oral cavity carcinoma	BEFREE	31704557		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	29088791, 29198524, 31238980		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	26483189, 29523225		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	19493275, 29302045		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	26383524	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Teratoma	Teratoma	BEFREE	16540528, 24487392		★★★★★ ★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	18676852		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	30635009, 31308076		★★★★★ ★☆☆☆☆ Found in Text Mining only

SLC22A3 (solute carrier family 22 member 3)