Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID	6777
Gene name	Signal transducer and activator of transcription 5B
Gene symbol	STAT5B
Synonyms (NCBI Gene)	GHISID2STAT5
Chromosome	17
Chromosome location	17q21.2
Summary	The protein encoded by this gene is a member of the STAT family of transcription factors. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that tran

Show/Hide all (9)

SNP ID	Visualize variation	Clinical significance	Consequence
rs121908501	C>G	Pathogenic	Coding sequence variant, missense variant, genic downstream transcript variant
rs121908502	G>A	Pathogenic	Coding sequence variant, stop gained
rs143171571	C>T	Conflicting-interpretations-of-pathogenicity	Coding sequence variant, missense variant
rs143172354	C>G,T	Conflicting-interpretations-of-pathogenicity	Coding sequence variant, synonymous variant, genic downstream transcript variant
rs148793995	C>G	Conflicting-interpretations-of-pathogenicity	Missense variant, coding sequence variant
rs761761205	G>-,GG	Pathogenic	Coding sequence variant, frameshift variant
rs1555548678	G>A	Pathogenic	Coding sequence variant, missense variant
rs1555548680	T>C	Pathogenic	Coding sequence variant, missense variant
rs1555549674	T>G	Pathogenic	Coding sequence variant, missense variant

273

Show/Hide all (273)

miRTarBase ID	miRNA	Experiments	Reference
MIRT023476	hsa-miR-23b-3p	Sequencing	20371350
MIRT042849	hsa-miR-324-3p	CLASH	23622248
MIRT038811	hsa-miR-93-3p	CLASH	23622248
MIRT036362	hsa-miR-1229-3p	CLASH	23622248
MIRT054842	hsa-miR-134-5p	ImmunoblotLuciferase reporter assayqRT-PCRWestern blot	24440911
MIRT635719	hsa-miR-8485	HITS-CLIP	23313552
MIRT635718	hsa-miR-4789-3p	HITS-CLIP	23313552
MIRT287194	hsa-miR-19a-3p	HITS-CLIP	23313552
MIRT287195	hsa-miR-19b-3p	HITS-CLIP	23313552
MIRT635718	hsa-miR-4789-3p	HITS-CLIP	23313552
MIRT635719	hsa-miR-8485	HITS-CLIP	23824327
MIRT635718	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT635719	hsa-miR-8485	HITS-CLIP	23824327
MIRT635718	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT635719	hsa-miR-8485	HITS-CLIP	23824327
MIRT635719	hsa-miR-8485	HITS-CLIP	23824327
MIRT635718	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT635719	hsa-miR-8485	HITS-CLIP	23824327
MIRT635718	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT635719	hsa-miR-8485	HITS-CLIP	23824327
MIRT635718	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT635719	hsa-miR-8485	HITS-CLIP	23824327
MIRT635718	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT648654	hsa-miR-106b-3p	HITS-CLIP	23824327
MIRT635719	hsa-miR-8485	HITS-CLIP	23824327
MIRT635718	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT497821	hsa-miR-4762-5p	PAR-CLIP	22291592
MIRT497820	hsa-miR-3184-5p	PAR-CLIP	22291592
MIRT497819	hsa-miR-423-5p	PAR-CLIP	22291592
MIRT497818	hsa-miR-1914-3p	PAR-CLIP	22291592
MIRT497817	hsa-miR-5194	PAR-CLIP	22291592
MIRT497816	hsa-miR-6738-5p	PAR-CLIP	22291592
MIRT497815	hsa-miR-526b-5p	PAR-CLIP	22291592
MIRT497814	hsa-miR-6834-5p	PAR-CLIP	22291592
MIRT497813	hsa-miR-1226-5p	PAR-CLIP	22291592
MIRT497812	hsa-miR-6734-5p	PAR-CLIP	22291592
MIRT497811	hsa-miR-335-3p	PAR-CLIP	22291592
MIRT732355	hsa-miR-150-5p	Luciferase reporter assayqRT-PCRWestern blot	27447965
MIRT732355	hsa-miR-150-5p	Luciferase reporter assayqRT-PCRWestern blot	27447965
MIRT575420	hsa-miR-4789-3p	HITS-CLIP	27418678
MIRT575420	hsa-miR-4789-3p	HITS-CLIP	27418678
MIRT575420	hsa-miR-4789-3p	HITS-CLIP	27418678
MIRT575421	hsa-miR-8485	HITS-CLIP	27418678
MIRT575421	hsa-miR-8485	HITS-CLIP	27418678
MIRT575421	hsa-miR-8485	HITS-CLIP	27418678
MIRT735577	hsa-miR-5094	Luciferase reporter assayWestern blottingqRT-PCRFlow cytometry	32127949
MIRT575421	hsa-miR-8485	HITS-CLIP	23313552
MIRT575420	hsa-miR-4789-3p	HITS-CLIP	23313552
MIRT287194	hsa-miR-19a-3p	HITS-CLIP	23313552
MIRT287195	hsa-miR-19b-3p	HITS-CLIP	23313552
MIRT575420	hsa-miR-4789-3p	HITS-CLIP	23313552
MIRT575421	hsa-miR-8485	HITS-CLIP	23824327
MIRT575420	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT575421	hsa-miR-8485	HITS-CLIP	23824327
MIRT575420	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT575421	hsa-miR-8485	HITS-CLIP	23824327
MIRT575421	hsa-miR-8485	HITS-CLIP	23824327
MIRT575420	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT575421	hsa-miR-8485	HITS-CLIP	23824327
MIRT575420	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT575421	hsa-miR-8485	HITS-CLIP	23824327
MIRT575420	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT575421	hsa-miR-8485	HITS-CLIP	23824327
MIRT575420	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT648654	hsa-miR-106b-3p	HITS-CLIP	23824327
MIRT575421	hsa-miR-8485	HITS-CLIP	23824327
MIRT575420	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT497821	hsa-miR-4762-5p	PAR-CLIP	22291592
MIRT497820	hsa-miR-3184-5p	PAR-CLIP	22291592
MIRT497819	hsa-miR-423-5p	PAR-CLIP	22291592
MIRT497818	hsa-miR-1914-3p	PAR-CLIP	22291592
MIRT497817	hsa-miR-5194	PAR-CLIP	22291592
MIRT497816	hsa-miR-6738-5p	PAR-CLIP	22291592
MIRT497815	hsa-miR-526b-5p	PAR-CLIP	22291592
MIRT497814	hsa-miR-6834-5p	PAR-CLIP	22291592
MIRT497813	hsa-miR-1226-5p	PAR-CLIP	22291592
MIRT497812	hsa-miR-6734-5p	PAR-CLIP	22291592
MIRT497811	hsa-miR-335-3p	PAR-CLIP	22291592
MIRT1396002	hsa-miR-1229	CLIP-seq
MIRT1396003	hsa-miR-1237	CLIP-seq
MIRT1396004	hsa-miR-1248	CLIP-seq
MIRT1396005	hsa-miR-1251	CLIP-seq
MIRT1396006	hsa-miR-1273e	CLIP-seq
MIRT1396007	hsa-miR-1275	CLIP-seq
MIRT1396008	hsa-miR-129-5p	CLIP-seq
MIRT1396009	hsa-miR-1324	CLIP-seq
MIRT1396010	hsa-miR-134	CLIP-seq
MIRT1396011	hsa-miR-138	CLIP-seq
MIRT1396012	hsa-miR-1827	CLIP-seq
MIRT1396013	hsa-miR-19a	CLIP-seq
MIRT1396014	hsa-miR-19b	CLIP-seq
MIRT1396015	hsa-miR-302f	CLIP-seq
MIRT1396016	hsa-miR-3074-3p	CLIP-seq
MIRT1396017	hsa-miR-3118	CLIP-seq
MIRT1396018	hsa-miR-3131	CLIP-seq
MIRT1396019	hsa-miR-3155	CLIP-seq
MIRT1396020	hsa-miR-3155b	CLIP-seq
MIRT1396021	hsa-miR-3164	CLIP-seq
MIRT1396022	hsa-miR-3166	CLIP-seq
MIRT1396023	hsa-miR-3175	CLIP-seq
MIRT1396024	hsa-miR-3591-3p	CLIP-seq
MIRT1396025	hsa-miR-3613-3p	CLIP-seq
MIRT1396026	hsa-miR-3620	CLIP-seq
MIRT1396027	hsa-miR-3622a-5p	CLIP-seq
MIRT1396028	hsa-miR-3654	CLIP-seq
MIRT1396029	hsa-miR-3665	CLIP-seq
MIRT1396030	hsa-miR-3673	CLIP-seq
MIRT1396031	hsa-miR-3685	CLIP-seq
MIRT1396032	hsa-miR-3942-3p	CLIP-seq
MIRT1396033	hsa-miR-4299	CLIP-seq
MIRT1396034	hsa-miR-4423-3p	CLIP-seq
MIRT1396035	hsa-miR-4447	CLIP-seq
MIRT1396036	hsa-miR-4472	CLIP-seq
MIRT1396037	hsa-miR-4525	CLIP-seq
MIRT1396038	hsa-miR-4638-3p	CLIP-seq
MIRT1396039	hsa-miR-4639-3p	CLIP-seq
MIRT1396040	hsa-miR-4651	CLIP-seq
MIRT1396041	hsa-miR-4665-5p	CLIP-seq
MIRT1396042	hsa-miR-4705	CLIP-seq
MIRT1396043	hsa-miR-4723-5p	CLIP-seq
MIRT1396044	hsa-miR-4731-3p	CLIP-seq
MIRT1396045	hsa-miR-4736	CLIP-seq
MIRT1396046	hsa-miR-4747-5p	CLIP-seq
MIRT1396047	hsa-miR-4753-3p	CLIP-seq
MIRT1396048	hsa-miR-4797-5p	CLIP-seq
MIRT1396049	hsa-miR-4801	CLIP-seq
MIRT1396050	hsa-miR-484	CLIP-seq
MIRT1396051	hsa-miR-501-3p	CLIP-seq
MIRT1396052	hsa-miR-502-3p	CLIP-seq
MIRT1396053	hsa-miR-608	CLIP-seq
MIRT1396054	hsa-miR-611	CLIP-seq
MIRT1396055	hsa-miR-618	CLIP-seq
MIRT1396056	hsa-miR-625	CLIP-seq
MIRT1396057	hsa-miR-645	CLIP-seq
MIRT1396058	hsa-miR-758	CLIP-seq
MIRT1396059	hsa-miR-759	CLIP-seq
MIRT1396060	hsa-miR-764	CLIP-seq
MIRT1396061	hsa-miR-940	CLIP-seq
MIRT1396062	hsa-miR-943	CLIP-seq
MIRT2118735	hsa-miR-1262	CLIP-seq
MIRT2118736	hsa-miR-1285	CLIP-seq
MIRT2118737	hsa-miR-1343	CLIP-seq
MIRT1396011	hsa-miR-138	CLIP-seq
MIRT1396012	hsa-miR-1827	CLIP-seq
MIRT2118738	hsa-miR-185	CLIP-seq
MIRT2118739	hsa-miR-1976	CLIP-seq
MIRT1396013	hsa-miR-19a	CLIP-seq
MIRT1396014	hsa-miR-19b	CLIP-seq
MIRT2118740	hsa-miR-3123	CLIP-seq
MIRT1396023	hsa-miR-3175	CLIP-seq
MIRT2118741	hsa-miR-3183	CLIP-seq
MIRT2118742	hsa-miR-3185	CLIP-seq
MIRT2118743	hsa-miR-3187-5p	CLIP-seq
MIRT2118744	hsa-miR-3192	CLIP-seq
MIRT2118745	hsa-miR-342-5p	CLIP-seq
MIRT1396025	hsa-miR-3613-3p	CLIP-seq
MIRT1396029	hsa-miR-3665	CLIP-seq
MIRT2118746	hsa-miR-3929	CLIP-seq
MIRT2118747	hsa-miR-4270	CLIP-seq
MIRT1396033	hsa-miR-4299	CLIP-seq
MIRT2118748	hsa-miR-4306	CLIP-seq
MIRT2118749	hsa-miR-4311	CLIP-seq
MIRT2118750	hsa-miR-4419b	CLIP-seq
MIRT2118751	hsa-miR-4441	CLIP-seq
MIRT2118752	hsa-miR-4459	CLIP-seq
MIRT2118753	hsa-miR-4478	CLIP-seq
MIRT2118754	hsa-miR-4481	CLIP-seq
MIRT2118755	hsa-miR-4641	CLIP-seq
MIRT2118756	hsa-miR-4644	CLIP-seq
MIRT2118757	hsa-miR-4664-5p	CLIP-seq
MIRT2118758	hsa-miR-4699-5p	CLIP-seq
MIRT2118759	hsa-miR-4701-3p	CLIP-seq
MIRT2118760	hsa-miR-4722-5p	CLIP-seq
MIRT2118761	hsa-miR-4723-3p	CLIP-seq
MIRT1396045	hsa-miR-4736	CLIP-seq
MIRT2118762	hsa-miR-4745-5p	CLIP-seq
MIRT2118763	hsa-miR-4749-3p	CLIP-seq
MIRT2118764	hsa-miR-4767	CLIP-seq
MIRT2118765	hsa-miR-4779	CLIP-seq
MIRT2118766	hsa-miR-485-5p	CLIP-seq
MIRT2118767	hsa-miR-612	CLIP-seq
MIRT2118768	hsa-miR-615-5p	CLIP-seq
MIRT2118769	hsa-miR-637	CLIP-seq
MIRT1396060	hsa-miR-764	CLIP-seq
MIRT1396061	hsa-miR-940	CLIP-seq
MIRT1396008	hsa-miR-129-5p	CLIP-seq
MIRT1396010	hsa-miR-134	CLIP-seq
MIRT2340979	hsa-miR-141	CLIP-seq
MIRT1396013	hsa-miR-19a	CLIP-seq
MIRT1396014	hsa-miR-19b	CLIP-seq
MIRT2340980	hsa-miR-200a	CLIP-seq
MIRT2340981	hsa-miR-23a	CLIP-seq
MIRT2340982	hsa-miR-23b	CLIP-seq
MIRT2340983	hsa-miR-23c	CLIP-seq
MIRT2340984	hsa-miR-27a	CLIP-seq
MIRT2340985	hsa-miR-27b	CLIP-seq
MIRT2340986	hsa-miR-3117-5p	CLIP-seq
MIRT1396017	hsa-miR-3118	CLIP-seq
MIRT2340987	hsa-miR-3129-3p	CLIP-seq
MIRT1396021	hsa-miR-3164	CLIP-seq
MIRT2340988	hsa-miR-3176	CLIP-seq
MIRT2340989	hsa-miR-320e	CLIP-seq
MIRT2340990	hsa-miR-3922-3p	CLIP-seq
MIRT2340991	hsa-miR-3923	CLIP-seq
MIRT2340992	hsa-miR-3974	CLIP-seq
MIRT1396033	hsa-miR-4299	CLIP-seq
MIRT2340993	hsa-miR-4312	CLIP-seq
MIRT2340994	hsa-miR-4470	CLIP-seq
MIRT2340995	hsa-miR-4699-3p	CLIP-seq
MIRT2118758	hsa-miR-4699-5p	CLIP-seq
MIRT2340996	hsa-miR-4722-3p	CLIP-seq
MIRT2340997	hsa-miR-4755-3p	CLIP-seq
MIRT2340998	hsa-miR-496	CLIP-seq
MIRT2340999	hsa-miR-513a-5p	CLIP-seq
MIRT2341000	hsa-miR-514	CLIP-seq
MIRT2341001	hsa-miR-514b-3p	CLIP-seq
MIRT1396058	hsa-miR-758	CLIP-seq
MIRT2395297	hsa-miR-1271	CLIP-seq
MIRT1396013	hsa-miR-19a	CLIP-seq
MIRT1396014	hsa-miR-19b	CLIP-seq
MIRT2395298	hsa-miR-4264	CLIP-seq
MIRT2395299	hsa-miR-4797-3p	CLIP-seq
MIRT2395300	hsa-miR-935	CLIP-seq
MIRT2395301	hsa-miR-96	CLIP-seq
MIRT1396003	hsa-miR-1237	CLIP-seq
MIRT1396004	hsa-miR-1248	CLIP-seq
MIRT2634870	hsa-miR-1287	CLIP-seq
MIRT1396011	hsa-miR-138	CLIP-seq
MIRT1396012	hsa-miR-1827	CLIP-seq
MIRT2634871	hsa-miR-204	CLIP-seq
MIRT2634872	hsa-miR-211	CLIP-seq
MIRT2634873	hsa-miR-218	CLIP-seq
MIRT2634874	hsa-miR-2355-3p	CLIP-seq
MIRT2634875	hsa-miR-296-3p	CLIP-seq
MIRT2634876	hsa-miR-3135b	CLIP-seq
MIRT2634877	hsa-miR-3160-5p	CLIP-seq
MIRT1396029	hsa-miR-3665	CLIP-seq
MIRT2634878	hsa-miR-3680	CLIP-seq
MIRT2634879	hsa-miR-4257	CLIP-seq
MIRT2634880	hsa-miR-4272	CLIP-seq
MIRT2634881	hsa-miR-4279	CLIP-seq
MIRT2634882	hsa-miR-4287	CLIP-seq
MIRT1396033	hsa-miR-4299	CLIP-seq
MIRT2634883	hsa-miR-4330	CLIP-seq
MIRT2634884	hsa-miR-4432	CLIP-seq
MIRT2634885	hsa-miR-4646-3p	CLIP-seq
MIRT2634886	hsa-miR-4685-3p	CLIP-seq
MIRT2634887	hsa-miR-4691-3p	CLIP-seq
MIRT1396045	hsa-miR-4736	CLIP-seq
MIRT1396047	hsa-miR-4753-3p	CLIP-seq
MIRT2634888	hsa-miR-636	CLIP-seq
MIRT2634889	hsa-miR-676	CLIP-seq
MIRT1396060	hsa-miR-764	CLIP-seq
MIRT1396061	hsa-miR-940	CLIP-seq
MIRT2634890	hsa-miR-942	CLIP-seq
MIRT2634870	hsa-miR-1287	CLIP-seq
MIRT1396011	hsa-miR-138	CLIP-seq
MIRT1396012	hsa-miR-1827	CLIP-seq
MIRT2634873	hsa-miR-218	CLIP-seq
MIRT2634875	hsa-miR-296-3p	CLIP-seq
MIRT2634876	hsa-miR-3135b	CLIP-seq
MIRT2634877	hsa-miR-3160-5p	CLIP-seq
MIRT1396029	hsa-miR-3665	CLIP-seq
MIRT2634878	hsa-miR-3680	CLIP-seq
MIRT2634879	hsa-miR-4257	CLIP-seq
MIRT2634881	hsa-miR-4279	CLIP-seq
MIRT1396033	hsa-miR-4299	CLIP-seq
MIRT2634883	hsa-miR-4330	CLIP-seq
MIRT2634884	hsa-miR-4432	CLIP-seq
MIRT1396045	hsa-miR-4736	CLIP-seq
MIRT2634888	hsa-miR-636	CLIP-seq
MIRT1396060	hsa-miR-764	CLIP-seq
MIRT1396061	hsa-miR-940	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
ZNF382	Repression	20682794

107

Show/Hide all (107)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000278	Process	Mitotic cell cycle	IEA
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	29844444
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0001553	Process	Luteinization	IEA
GO:0001779	Process	Natural killer cell differentiation	IEA
GO:0001787	Process	Natural killer cell proliferation	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003682	Function	Chromatin binding	ISS
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003700	Function	DNA-binding transcription factor activity	TAS	8631883
GO:0005515	Function	Protein binding	IPI	9989503, 21106534, 31175292, 32296183, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	29844444
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	29844444
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	TAS	8631883
GO:0006366	Process	Transcription by RNA polymerase II	IEA
GO:0006952	Process	Defense response	IBA
GO:0007165	Process	Signal transduction	IEA
GO:0007259	Process	Cell surface receptor signaling pathway via JAK-STAT	IBA
GO:0007259	Process	Cell surface receptor signaling pathway via JAK-STAT	IEA
GO:0007259	Process	Cell surface receptor signaling pathway via JAK-STAT	NAS	24058793
GO:0007259	Process	Cell surface receptor signaling pathway via JAK-STAT	TAS	8631883
GO:0007548	Process	Sex differentiation	IEA
GO:0007565	Process	Female pregnancy	IEA
GO:0007595	Process	Lactation	IEA
GO:0008283	Process	Cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0019218	Process	Regulation of steroid metabolic process	IEA
GO:0019221	Process	Cytokine-mediated signaling pathway	IBA
GO:0019221	Process	Cytokine-mediated signaling pathway	IEA
GO:0019221	Process	Cytokine-mediated signaling pathway	IEA
GO:0019530	Process	Taurine metabolic process	IEA
GO:0019530	Process	Taurine metabolic process	ISS
GO:0019915	Process	Lipid storage	IEA
GO:0030098	Process	Lymphocyte differentiation	IEA
GO:0030155	Process	Regulation of cell adhesion	IEA
GO:0030183	Process	B cell differentiation	IEA
GO:0030218	Process	Erythrocyte differentiation	IEA
GO:0030856	Process	Regulation of epithelial cell differentiation	IEA
GO:0032355	Process	Response to estradiol	IDA	12552091
GO:0032743	Process	Positive regulation of interleukin-2 production	IEA
GO:0032819	Process	Positive regulation of natural killer cell proliferation	IEA
GO:0032825	Process	Positive regulation of natural killer cell differentiation	IEA
GO:0032870	Process	Cellular response to hormone stimulus	IDA	12552091
GO:0033028	Process	Myeloid cell apoptotic process	IEA
GO:0033033	Process	Negative regulation of myeloid cell apoptotic process	IEA
GO:0033077	Process	T cell differentiation in thymus	IEA
GO:0035259	Function	Nuclear glucocorticoid receptor binding	IPI	12552091
GO:0038162	Process	Erythropoietin-mediated signaling pathway	IDA	9657743
GO:0040014	Process	Regulation of multicellular organism growth	IEA
GO:0040014	Process	Regulation of multicellular organism growth	ISS
GO:0040018	Process	Positive regulation of multicellular organism growth	IEA
GO:0042104	Process	Positive regulation of activated T cell proliferation	IEA
GO:0042127	Process	Regulation of cell population proliferation	IBA
GO:0042267	Process	Natural killer cell mediated cytotoxicity	IEA
GO:0042448	Process	Progesterone metabolic process	IEA
GO:0042492	Process	Gamma-delta T cell differentiation	IEA
GO:0042802	Function	Identical protein binding	IPI	31175292
GO:0042803	Function	Protein homodimerization activity	IDA	29844444
GO:0043029	Process	T cell homeostasis	IEA
GO:0043434	Process	Response to peptide hormone	IBA
GO:0045579	Process	Positive regulation of B cell differentiation	IEA
GO:0045588	Process	Positive regulation of gamma-delta T cell differentiation	IEA
GO:0045621	Process	Positive regulation of lymphocyte differentiation	IEA
GO:0045647	Process	Negative regulation of erythrocyte differentiation	IEA
GO:0045648	Process	Positive regulation of erythrocyte differentiation	IDA	20702587
GO:0045931	Process	Positive regulation of mitotic cell cycle	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	NAS	24058793
GO:0045954	Process	Positive regulation of natural killer cell mediated cytotoxicity	IEA
GO:0046543	Process	Development of secondary female sexual characteristics	IEA
GO:0046544	Process	Development of secondary male sexual characteristics	IEA
GO:0046983	Function	Protein dimerization activity	IEA
GO:0046983	Function	Protein dimerization activity	ISS
GO:0048541	Process	Peyer's patch development	IEA
GO:0050729	Process	Positive regulation of inflammatory response	IEA
GO:0050798	Process	Activated T cell proliferation	IEA
GO:0060397	Process	Growth hormone receptor signaling pathway via JAK-STAT	IBA
GO:0060397	Process	Growth hormone receptor signaling pathway via JAK-STAT	IDA	12552091
GO:0060397	Process	Growth hormone receptor signaling pathway via JAK-STAT	IEA
GO:0070669	Process	Response to interleukin-2	IEA
GO:0070670	Process	Response to interleukin-4	IEA
GO:0070672	Process	Response to interleukin-15	IEA
GO:0071363	Process	Cellular response to growth factor stimulus	IEA
GO:0071363	Process	Cellular response to growth factor stimulus	ISS
GO:0071364	Process	Cellular response to epidermal growth factor stimulus	ISS
GO:0090575	Component	RNA polymerase II transcription regulator complex	IBA
GO:0090575	Component	RNA polymerase II transcription regulator complex	NAS	24058793
GO:0097531	Process	Mast cell migration	IEA
GO:1903706	Process	Regulation of hemopoiesis	IEA

MIM	HGNC	e!Ensembl
604260	11367	ENSG00000173757

P51692

Protein name

Signal transducer and activator of transcription 5B

Protein function

Carries out a dual function: signal transduction and activation of transcription (PubMed:29844444). Mediates cellular responses to the cytokine KITLG/SCF and other growth factors. Binds to the GAS element and activates PRL-induced transcription.

PDB

6MBW , 6MBZ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02865	STAT_int	2 → 124	STAT protein, protein interaction domain	Domain
PF01017	STAT_alpha	141 → 324	STAT protein, all-alpha domain	Family
PF02864	STAT_bind	336 → 469	STAT protein, DNA binding domain	Domain
PF00017	SH2	589 → 670	SH2 domain	Domain

Sequence

MAVWIQAQQLQGEALHQMQALYGQHFPIEVRHYLSQWIESQAWDSVDLDNPQENIKATQL
LEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQNTYDRCPMELVRCIRHILYNEQRLV
REANNGSSPAGSLADAMSQKHLQINQTFEELRLVTQDTENELKKLQQTQEYFIIQYQESL
RIQAQFGPLAQLSPQERLSRETALQQKQVSLEAWLQREAQTLQQYRVELAEKHQKTLQLL
RKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQIRRAEHLC
QQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAATVRLLVGGKL
NVHMNPPQVKATIISEQQAKSLLKNENTRNDYSGEILNNCCVMEYHQATGTLSAHFRNMS
LKRIKRSDRRGAESVTEEKFTILFESQFSVGGNELVFQVKTLSLPVVVIVHGSQDNNATA
TVLWDNAFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNN
SSSHLEDYSGLSVSWSQFNRENLPGRNYTFWQWFDGVMEVLKKHLKPHWNDGAILGFVNK
QQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSQERMFWNLMPFTTRDFSIRSLADRL
GDLNYLIYVFPDRPKDEVYSKYYTPVPCESATAKAVDGYVKPQIKQVVPEFVNASADAGG
GSATYMDQAPSPAVCPQAHYNMYPQNPDSVLDTDGDFDLEDTMDVARRVEELLGRPMDSQ
WIPHAQS

Sequence length

787

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (3)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Familial prostate cancer	Likely pathogenic	rs750399917	RCV005912596	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Growth hormone insensitivity syndrome with immune dysregulation 2, autosomal dominant	Likely pathogenic; Pathogenic	rs2508724440, rs1555548680, rs1555549674	RCV003158006 RCV001254780 RCV001254778	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Growth hormone insensitivity with immune dysregulation 1, autosomal recessive	Likely pathogenic; Pathogenic	rs750399917, rs767959957, rs778995803, rs2144267361, rs2080191165, rs2144219508, rs2508776887, rs2508803926, rs121908501, rs2508751004, rs121908502, rs2508731535, rs1202978138, rs2508803545, rs1000458475 View all (6 more)	RCV001377593 RCV001387244 RCV001898567 RCV001937990 RCV001960505 View all (17 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (17)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ECZEMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHILDHOOD ONSET ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DESBUQUOIS SYNDROME	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GROWTH HORMONE INSENSITIVITY SYNDROME	—	Disgenet, GenCC Disgenet, GenCC	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Growth hormone insensitivity syndrome with immune dysregulation	Uncertain significance	ClinVar Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
GROWTH HORMONE INSENSITIVITY SYNDROME WITH IMMUNE DYSREGULATION 1, AUTOSOMAL RECESSIVE	—	Disgenet, HPO Disgenet, HPO	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IRRITABLE BOWEL SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LYMPHOMA, EXTRANODAL NK-T-CELL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neoplasm	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Short stature	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SPLENOMEGALY	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STAT5B-related disorder	Uncertain significance; Likely benign; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STAT5B-related growth hormone insensitivity syndrome	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (316)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Achondroplasia	Achondroplasia	BEFREE	19802676		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acquired Hypogammaglobulinemia	Common Variable Immunodeficiency	BEFREE	30064289		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	25572535		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	BEFREE	20667821, 8861946		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	9498707		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	18193087, 20227268, 21606506, 22685175, 30784762, 8634413		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	28667329		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	11022230, 11929748, 16331271, 17988991, 18221386, 22749039, 31083206		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	LHGDN	11929748		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	ORPHANET_DG	18221386		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute promyelocytic leukemia	Promyelocytic Leukemia	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	CGI_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Undifferentiated Leukemia	Leukemia	BEFREE	19667399		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	20717961		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	21617857		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenocortical carcinoma	Adrenocortical carcinoma	BEFREE	12697691		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	18193087, 21606506, 30784762, 8634413		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	11781246		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	10348340, 21106989		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult type dermatomyositis	Dermatomyositis	BEFREE	27803134		★★★★★ ★☆☆☆☆ Found in Text Mining only
Agammaglobulinemia	Agammaglobulinemia	Pubtator	34670919	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	29389768		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia Aplastic	Aplastic anemia	Pubtator	25800665	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	27901054		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	27035235, 31395607		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anorexia	Anorexia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Anovulation	Anovulation	Pubtator	40287692	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	25993293		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	CLINVAR_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Astrocytoma	Astrocytoma	BEFREE	25907517		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia Telangiectasia	BEFREE	26536348		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	28802860		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	24512550, 31569642, 31600547		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	33090292, 34670919	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Lymphoproliferative Syndrome	Autoimmune Lymphoproliferative Disorder	BEFREE	29187589		★★★★★ ★☆☆☆☆ Found in Text Mining only
B Acute Lymphoblastic Leukemia with t(9;22)(q34.1;q11.2); BCR-ABL1	Lymphoblastic Leukemia	BEFREE	22895079, 29578162, 30154155		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	16532027, 16819511, 22231445, 25651400, 27436361, 29365089		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	30988120		★★★★★ ★☆☆☆☆ Found in Text Mining only
Basal cell carcinoma	Carcinoma	CGI_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	30038233		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	BEFREE	22234689		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	20336349		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	12374673, 12459712, 15592524, 15686596, 16139998, 16155412, 16772534, 17546596, 17639043, 18228120, 19262752, 19491198, 19630967, 20237142, 21205088 View all (19 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	11751923, 12759236, 17822672, 17997837, 18550772, 19630967, 21205088, 25104439, 25973100, 26735495, 28422733, 29326301, 9813040	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	36862902	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	17997837	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	23774526	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	31485610	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	25137041, 25586740, 29752311, 30621055		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	27533245	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	27035235	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	32640276	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	31323143		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	20585448		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Hemorrhage	Cerebral hemorrhage	Pubtator	40629603	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	30676545		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	15337523		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	15337523		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	18193087, 21606506, 30784762, 8634413		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	GWASCAT_DG	31036433		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholesteatoma	Cholesteatoma	BEFREE	24321752		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholesterol gallstones	Cholesterol gallstones	BEFREE	27816761		★★★★★ ★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	29377304		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chromosome 11p11.2 Deletion Syndrome	11p11.2 Deletion Syndrome	BEFREE	30150979		★★★★★ ★☆☆☆☆ Found in Text Mining only
CHROMOSOME 8p11 MYELOPROLIFERATIVE SYNDROME	8p11 Myeloproliferative Syndrome	BEFREE	22781593		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic eosinophilic leukemia	Eosinophilic Leukemia	BEFREE	22523564, 30573779		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	29619880, 29738538, 31526861		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	24155890, 27367207, 30988120		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphoproliferative Disorder of NK-Cells	Lymphoproliferative Disorder Of Natural Killer Cells	BEFREE	29417693		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	18479730, 19747364, 20028972, 22144185, 22234689, 22500049, 23386690, 23445613, 24681953, 26754830, 27418650, 28260027, 29202466		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	29454913		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic osteomyelitis	Osteomyelitis	BEFREE	31555698		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	17148664, 30615095		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	24097071		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	21826656, 22121102, 27769746, 29118272, 29763380, 30013992, 30670049		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	22121102	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Combined immunodeficiency	Severe combined immunodeficiency disease	GENOMICS_ENGLAND_DG	26703237		★★★★★ ★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common Variable Immunodeficiency	BEFREE	30064289		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital neutropenia	Congenital Neutropenia	BEFREE	11146160, 18513286, 28073911		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	28453725		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	31401673		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	27997991		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	17148664, 23929016		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cyclic neutropenia	Cyclic neutropenia	Pubtator	25800665	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia, Vascular	Dementia	BEFREE	28488208		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	24412367, 31556482		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	24412367		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	Pubtator	27803134	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	11781356, 17130555, 18927468, 27634616		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	11781356, 17130555, 18927468, 27634616		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	11781356, 29417186	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	24204704, 27560779, 30790510		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	22322482, 31332162		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Angiopathies	Diabetic angiopathies	Pubtator	11781356	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	15180953, 22322482		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse alveolar hemorrhage	Diffuse alveolar hemorrhage	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	18755494		★★★★★ ★☆☆☆☆ Found in Text Mining only
Disseminated Intravascular Coagulation	Disseminated Intravascular Coagulation	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	BEFREE	17389811, 20538865, 20962506, 28253502, 29844444		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Dwarfism Pituitary	Pituitary dwarfism	Pubtator	34589056	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	24412367		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	Pubtator	29844444, 33090292	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	35244291	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Enteritis	Enteritis	BEFREE	23929016		★★★★★ ★☆☆☆☆ Found in Text Mining only
Enteropathy-Associated T-Cell Lymphoma	Enteropathy-Associated T-Cell Lymphoma	CTD_human_DG	29200404		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	21819482, 30573779		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	Pubtator	30573779, 37981812, 38563187	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Erythrocytosis familial, 1	Erythrocytosis	BEFREE	10498627, 9923445		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	34616847	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial erythrocytosis	Erythrocytosis	BEFREE	10498627, 9923445		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	21330473		★★★★★ ★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP A (disorder)	Anemia	BEFREE	21330473		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrinogen Deficiency	Fibrinogen Deficiency	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	21622209, 29402841, 31819135		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gangrene	Gangrene	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	21214269, 22729867, 23250732, 24440911, 24821382, 24878107, 29724813, 29899381, 30621209		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	23250732, 33104022, 36069226	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	21214269, 22729867, 23250732, 24440911, 24821382, 24878107, 29724813, 29899381, 30621209		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	24821382, 24878107, 29724813		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	35148403	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	Pubtator	40629603	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	31490767		★★★★★ ★☆☆☆☆ Found in Text Mining only
Granulomatous Slack Skin	Granulomatous Slack Skin	CTD_human_DG	26192916		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hamartoma Syndrome, Multiple	Hamartoma	BEFREE	24469394		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	11973644, 15578920		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head And Neck Neoplasms	LHGDN	14583472		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	28453725		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	16459186, 17038539, 18336085, 24155890, 24435449, 25524945, 28202313, 30783189, 31490767		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematopoietic Neoplasms	Hematopoietic Neoplasms	BEFREE	11973644, 12459712, 22442148, 27566554, 29200404, 29417693, 30679796, 30783189, 31817042		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Leiomyomatosis and Renal Cell Cancer	Hereditary Leiomyomatosis and Renal Cancer	BEFREE	28011673		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	11781246, 28453725		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	29650799	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	28453725		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypereosinophilic syndrome	Hypereosinophilic Syndrome	BEFREE	30573779		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypereosinophilic Syndrome	Hypereosinophilic syndrome	Pubtator	30573779, 38563187	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypergammaglobulinemia	Hypergammaglobulinemia	BEFREE	25736842		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperprolactinemia	Hyperprolactinemia	BEFREE	20538865, 29778097		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperthyroidism	Hyperthyroidism	BEFREE	27919641		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypofibrinogenemia	Hypofibrinogenemia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	BEFREE	31366244		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Hypereosinophilic Syndrome	Hypereosinophilic Syndrome	BEFREE	30573779		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	25216946, 29673911, 30140283		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary hypertension	Pulmonary Hypertension	BEFREE	25470773		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	20538865, 26034074, 29249625		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	26034074, 33090292	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
IMMUNODEFICIENCY 13	Immunodeficiency	BEFREE	22454463		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	31600547		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	30124884		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	31732533	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	24412367, 31556482		★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin-Like Growth Factor I Deficiency	Insulin-Like Growth Factor I Deficiency	BEFREE	21396575, 22419735, 23392100, 26703237		★★★★★ ★☆☆☆☆ Found in Text Mining only
insulinoma	Insulinoma	BEFREE	11145745		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal Diseases	BEFREE	25349174		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intraepithelial Neoplasia	Intraepithelial Neoplasia	BEFREE	20699217, 23180448		★★★★★ ★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron Overload	BEFREE	31838956		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	30676545		★★★★★ ★☆☆☆☆ Found in Text Mining only
Isolated somatotropin deficiency	Isolated Somatotropin Deficiency	BEFREE	21470284		★★★★★ ★☆☆☆☆ Found in Text Mining only
Isolated somatotropin deficiency	Isolated Somatotropin Deficiency	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile Myelomonocytic Leukemia	Myelomonocytic Leukemia	BEFREE	26456833, 27418650, 27447965		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	26431836		★★★★★ ★☆☆☆☆ Found in Text Mining only
Laron Syndrome	Laron Syndrome	BEFREE	12072393, 26703237, 9207075		★★★★★ ★☆☆☆☆ Found in Text Mining only
Laron syndrome type 2	Laron Syndrome	UNIPROT_DG	13679528, 15827093, 22419735		★★★★★ ★☆☆☆☆ Found in Text Mining only
Laron syndrome type 2	Laron Syndrome	GENOMICS_ENGLAND_DG	13679528, 26703237		★★★★★ ★☆☆☆☆ Found in Text Mining only
Laron syndrome type 2	Laron Syndrome	CLINVAR_DG	16787985		★★★★★ ★☆☆☆☆ Found in Text Mining only
Laron syndrome type 2	Laron Syndrome	CTD_human_DG	17030597		★★★★★ ★☆☆☆☆ Found in Text Mining only
Laron syndrome type 2	Laron Syndrome	ORPHANET_DG	22419735		★★★★★ ★☆☆☆☆ Found in Text Mining only
Laron syndrome with immunodeficiency	Growth Hormone Insensitivity With Immune Dysregulation	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	10441338, 10729993, 15514005, 15578097, 15652752, 15677477, 16502315, 18536571, 19667399, 20227268, 20508164, 21091189, 21220747, 22126101, 22442148 View all (15 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	12145702		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	29740158, 34967577	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	34210682	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	32349161	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	11929748	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Large Granular Lymphocytic	Lymphoblastic Leukemia	BEFREE	23596048, 24512550, 26975038		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Large Granular Lymphocytic	Lymphoblastic Leukemia	CTD_human_DG	26192916, 29200404		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Mast-Cell	Leukemia	BEFREE	28011673		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	10698507, 11753614, 12351411, 15128421, 16464493, 16849538, 17630355, 19036083, 20066533, 22725130, 23509157, 23564444, 24282218, 24394665, 24668492 View all (18 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Natural Killer Cell Large Granular Lymphocytic	Lymphoblastic Leukemia	CTD_human_DG	26192916, 29200404		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	21106989		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell, Chronic	T-cell Lymphocytic Leukemia	CTD_human_DG	29200404		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	15677477		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	16172916		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lipoma	Lipoma	BEFREE	24681953		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lipomatosis, Multiple	Lipomatosis	BEFREE	24681953		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	17047057, 21793836, 22296499, 27585821, 29340101, 31409773, 31485610, 31564902, 9647240		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	9647240		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	21396575, 22419735, 26703237		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	29844444, 33090292	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	18461184		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	27216430, 28254841, 31263070		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoid leukemia	Lymphoid leukemia	BEFREE	30784762		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	15870688, 16502315, 19363496, 22442148, 24435449, 25586472, 30783189, 31601188, 31817042		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	25586472, 37329186	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Extranodal NK-T-Cell	Lymphoma	CTD_human_DG	29200404		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	12543077, 16502315, 23676217, 26244872, 27329723		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	LHGDN	16502315		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	CTD_human_DG	26192916		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphopenia	Lymphopenia	BEFREE	28387753		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	30038233		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	11973644, 15578920		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	BEFREE	30964854		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	12374673, 12459712, 15592524, 15686596, 16139998, 16155412, 16772534, 17546596, 17639043, 18228120, 19262752, 19491198, 19630967, 20237142, 21205088 View all (20 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	31401673		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	30377054		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	22348039, 25137041, 25586740, 29752311, 30621055		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	16172916		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	20585448		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	23097626, 27035235		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	12719422, 15256446, 20233708, 20699217, 20854925, 20966544, 21216933, 23668334, 29483142, 31292140, 31817042		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of salivary gland	Malignant neoplasm of salivary gland	BEFREE	26252941		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	22328012, 25532910		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11948098, 12865928, 15677477, 15686596, 16459186, 16772534, 16819511, 17651480, 18228120, 18492722, 18835035, 19014541, 20073576, 20233708, 21860432 View all (39 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	15337523		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	24097071		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	12642867, 16772534, 18550772		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	15976008, 16954437, 18228120, 18550772		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	28011673, 30964854		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mastocytosis	Mastocytosis	BEFREE	18579792, 19383925, 24598853, 30018080		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mastocytosis, Systemic	Mastocytosis	BEFREE	17662084, 19893034, 21457934, 24598853, 30018080		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	16169484		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	16741510, 32316408	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	29485532, 31569642		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental impairment	Mental Depression	BEFREE	23337768		★★★★★ ★☆☆☆☆ Found in Text Mining only
Merkel cell carcinoma	Merkel cell carcinoma	BEFREE	28476799		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	27858140		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	28974560		★★★★★ ★☆☆☆☆ Found in Text Mining only
Moyamoya Disease	Moyamoya disease	Pubtator	32617116	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	29857127		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	28213589		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	11027834		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelofibrosis	Myelofibrosis	BEFREE	16871275, 22234689, 23386690, 23445613, 24116232, 29650953		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	16459186, 17038539, 27418650, 28654259		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	10727459, 12483533, 15089759, 15128421, 16278304, 17503465, 18537972, 21091189, 21220747, 21356308, 22234689, 22285998, 23233089, 23370613, 23400594 View all (23 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	20028972, 21749449, 22234689, 22500049, 23445613, 27418650, 31490767		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	34462518	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	22959364		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Type Extranodal NK/T-Cell Lymphoma	Extranodal NK T Cell Lymphoma	CTD_human_DG	29200404		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	12865928		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10441338, 11222718, 14741732, 15256446, 15592524, 16532027, 16532038, 16954437, 17021139, 17047057, 19047094, 19851315, 19966185, 20717961, 21074499 View all (37 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural tube defect	Pubtator	38563187	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurilemmoma	Neurilemmoma	BEFREE	12444102		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	16407271, 17045782		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	BEFREE	15677477		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	31409773, 31491605		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	20073576, 21617857, 25137041, 29345289		★★★★★ ★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	20124477		★★★★★ ★☆☆☆☆ Found in Text Mining only
Noonan Syndrome	Noonan Syndrome	BEFREE	23182818, 26456833		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	29111497, 9207075, 9748302		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oculocutaneous albinism type 2	Oculocutaneous albinism	Pubtator	23250732	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	12459712, 16954437, 26084564		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	20585448		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	28536310	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	23097626, 27035235		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	27035235	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancytopenia	Pancytopenia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
PEELING SKIN SYNDROME	Peeling Skin Syndrome	BEFREE	30150979		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	26431836, 29615001, 29682185, 31123029, 31545408		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Diseases	Polycystic kidney disease	BEFREE	28202165		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	BEFREE	28104302		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	40287692	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycythemia	Polycythemia	BEFREE	26706855		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia Vera	BEFREE	17533047, 20013324, 21355091, 22144185, 22234689		★★★★★ ★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	19393990, 21508514		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	22234689, 28369050		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	20227268, 21606506, 22685175, 30784762		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	21261500, 30185437, 31687977		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	CTD_human_DG	29200404		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	29429758		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary Myelofibrosis	Myelofibrosis	BEFREE	17255768, 17376889, 20113333, 22234689, 23386690, 23445613, 24116232, 29650953, 31369569		★★★★★ ★☆☆☆☆ Found in Text Mining only
Progressive hearing loss stapes fixation	Hearing loss with stapes fixation	Pubtator	12197892	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prolactinoma	Prolactinoma	BEFREE	23180448		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	12719422, 15256446, 20233708, 20699217, 20854925, 21216933, 23668334, 29483142, 31292140, 31817042		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	16115927, 18172316		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	23668334	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	31269779		★★★★★ ★☆☆☆☆ Found in Text Mining only
Refractory anemias	Anemia	BEFREE	11022230		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	31401673		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	31401673		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	24821571, 30990758		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatic Heart Disease	Rheumatic Heart Disease	BEFREE	24797343, 30929974		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	11022230, 22342385, 31181818		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	19036083		★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency	Pubtator	12197892	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency disease	BEFREE	31799703		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary Syndrome	BEFREE	14695224, 27329723		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin carcinoma	Skin Carcinoma	BEFREE	31323143		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	30544712		★★★★★ ★☆☆☆☆ Found in Text Mining only
Somatotropin deficiency	Somatotropin Deficiency	BEFREE	21470284		★★★★★ ★☆☆☆☆ Found in Text Mining only
Somatotropin deficiency	Somatotropin Deficiency	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinal Muscular Atrophy	Spinal Muscular Atrophy	BEFREE	17220171		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	16172916		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	23915238		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	11973644, 19047094		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	31443474		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	22328012, 25532910		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomatitis	Stomatitis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	30150979		★★★★★ ★☆☆☆☆ Found in Text Mining only
T-Cell Large Granular Lymphocyte Leukemia	T-cell Lymphocytic Leukemia	BEFREE	23596048, 24512550, 29417693		★★★★★ ★☆☆☆☆ Found in Text Mining only
T-Cell Large Granular Lymphocyte Leukemia	T-cell Lymphocytic Leukemia	CTD_human_DG	26192916, 29200404		★★★★★ ★☆☆☆☆ Found in Text Mining only
T-Cell Large Granular Lymphocyte Leukemia	T-cell Lymphocytic Leukemia	CGI_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	25586472, 27732937		★★★★★ ★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	CTD_human_DG	26192917		★★★★★ ★☆☆☆☆ Found in Text Mining only
T-Cell Prolymphocytic Leukemia	T-Cell Prolymphocytic Leukemia	BEFREE	24825865, 31766351, 31817042		★★★★★ ★☆☆☆☆ Found in Text Mining only
T-Cell Prolymphocytic Leukemia	T-Cell Prolymphocytic Leukemia	CTD_human_DG	29200404		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombocythemia, Essential	Thrombocythemia	BEFREE	16923108, 17255768, 20113333, 21749449, 26754830		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombocytosis	Thrombocytosis	BEFREE	26754830		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thymoma	Thymoma	BEFREE	18482053		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uremia	Uremia	BEFREE	22322482		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	11781356, 30140283		★★★★★ ★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom`s Macroglobulinemia	BEFREE	24335105		★★★★★ ★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom macroglobulinemia	Pubtator	24335105	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

STAT5B (signal transducer and activator of transcription 5B)