Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID	6774
Gene name	Signal transducer and activator of transcription 3
Gene symbol	STAT3
Synonyms (NCBI Gene)	ADMIOADMIO1APRFHIES
Chromosome	17
Chromosome location	17q21.2
Summary	The protein encoded by this gene is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the ce

Show/Hide all (56)

SNP ID	Visualize variation	Clinical significance	Consequence
rs113994135	G>A	Pathogenic	Coding sequence variant, missense variant
rs113994136	C>A,T	Pathogenic	Coding sequence variant, missense variant
rs113994137	C>T	Pathogenic	Coding sequence variant, missense variant
rs113994138	CAC>-	Pathogenic	Coding sequence variant, inframe deletion
rs113994139	C>T	Pathogenic	Coding sequence variant, missense variant
rs193922716	G>A	Likely-pathogenic	Missense variant, coding sequence variant
rs193922717	C>T	Pathogenic, likely-pathogenic	Missense variant, coding sequence variant
rs193922719	T>A	Likely-pathogenic	Missense variant, coding sequence variant
rs193922720	C>T	Likely-pathogenic	Missense variant, coding sequence variant
rs193922721	T>C	Likely-pathogenic	Missense variant, coding sequence variant
rs193922722	A>G	Likely-pathogenic	Missense variant, coding sequence variant
rs397514766	G>A	Pathogenic	Coding sequence variant, missense variant
rs574370336	G>C	Conflicting-interpretations-of-pathogenicity	Coding sequence variant, missense variant
rs587777648	T>C	Pathogenic	Coding sequence variant, missense variant
rs587777649	G>A,C	Pathogenic	Coding sequence variant, missense variant, synonymous variant
rs587777650	C>G	Pathogenic	Coding sequence variant, missense variant
rs769031989	T>A	Conflicting-interpretations-of-pathogenicity	Missense variant, coding sequence variant
rs786205503	C>A	Likely-pathogenic	Missense variant, coding sequence variant
rs869312887	C>G	Pathogenic	Missense variant, coding sequence variant
rs869312888	C>T	Likely-pathogenic, pathogenic	Missense variant, coding sequence variant
rs869312889	G>A	Likely-pathogenic, pathogenic	Missense variant, coding sequence variant
rs869312890	G>A	Pathogenic	Missense variant, coding sequence variant
rs869312891	C>A	Pathogenic	Missense variant, coding sequence variant
rs869312892	G>A	Pathogenic	Missense variant, coding sequence variant, intron variant
rs869312893	A>C	Pathogenic	Missense variant, coding sequence variant
rs869312894	C>T	Pathogenic	Missense variant, coding sequence variant
rs886039434	A>G	Pathogenic, likely-pathogenic	Missense variant, coding sequence variant
rs886039546	T>C	Pathogenic	Missense variant, coding sequence variant
rs1057520377	T>C	Likely-pathogenic	Coding sequence variant, missense variant
rs1057521091	T>C,G	Likely-pathogenic, pathogenic	Coding sequence variant, missense variant
rs1064793452	CCGT>-	Pathogenic	Frameshift variant, coding sequence variant
rs1064794421	ATA>CTG	Likely-pathogenic	Coding sequence variant, missense variant
rs1064794899	C>G	Likely-pathogenic	Coding sequence variant, missense variant
rs1064794957	G>A,C	Likely-pathogenic, pathogenic	Coding sequence variant, missense variant
rs1064796762	C>T	Likely-pathogenic	Coding sequence variant, missense variant
rs1064796922	A>T	Likely-pathogenic	Coding sequence variant, missense variant
rs1085307931	A>C	Likely-pathogenic	Coding sequence variant, missense variant
rs1131691377	G>A	Likely-pathogenic	Coding sequence variant, missense variant
rs1131691476	A>G	Likely-pathogenic, pathogenic	Coding sequence variant, missense variant
rs1131691937	T>C	Likely-pathogenic	Coding sequence variant, missense variant
rs1555562364	T>C	Likely-pathogenic	Coding sequence variant, missense variant
rs1555563717	A>T	Likely-pathogenic	Coding sequence variant, missense variant
rs1555563854	G>C,T	Uncertain-significance, likely-pathogenic	Coding sequence variant, missense variant
rs1555563871	C>T	Pathogenic	Coding sequence variant, missense variant
rs1555565595	C>T	Likely-pathogenic	Coding sequence variant, missense variant
rs1555566820	A>C,T	Uncertain-significance, likely-pathogenic	Coding sequence variant, missense variant
rs1555568535	C>T	Likely-pathogenic	Coding sequence variant, missense variant
rs1567708034	G>A	Uncertain-significance, likely-pathogenic	Coding sequence variant, missense variant
rs1567713850	T>A	Pathogenic	Coding sequence variant, missense variant
rs1598381121	A>C	Likely-pathogenic	Missense variant, coding sequence variant
rs1598381169	T>C	Likely-pathogenic	Missense variant, coding sequence variant
rs1598393453	T>C	Likely-pathogenic	Missense variant, coding sequence variant
rs1598399795	G>T	Pathogenic	Missense variant, coding sequence variant
rs1598406623	C>A	Pathogenic	Splice donor variant
rs1598406651	C>T	Likely-pathogenic	Splice acceptor variant
rs1598423756	C>T	Likely-pathogenic	Splice acceptor variant

891

Show/Hide all (891)

miRTarBase ID	miRNA	Experiments	Reference
MIRT000497	hsa-miR-20b-5p	qRT-PCRELISAChIPWestern blot	20232316
MIRT005006	hsa-miR-125b-5p	Microarray	17891175
MIRT006959	hsa-miR-337-3p	Luciferase reporter assayqRT-PCRWestern blot	22723956
MIRT021003	hsa-miR-155-5p	Proteomics	18668040
MIRT028178	hsa-miR-93-5p	Sequencing	20371350
MIRT031079	hsa-miR-21-5p	Western blot;Other	20048743
MIRT031079	hsa-miR-21-5p	Microarray	18591254
MIRT051593	hsa-let-7e-5p	CLASH	23622248
MIRT050559	hsa-miR-20a-5p	CLASH	23622248
MIRT049359	hsa-miR-92a-3p	CLASH	23622248
MIRT052931	hsa-miR-124-3p	Luciferase reporter assayqRT-PCRWestern blot	24287565
MIRT052931	hsa-miR-124-3p	ImmunofluorescenceImmunohistochemistryLuciferase reporter assayWestern blot	24211205
MIRT053071	hsa-miR-130b-3p	Luciferase reporter assayqRT-PCRWestern blot	24040078
MIRT050559	hsa-miR-20a-5p	qRT-PCRWestern blot	23836497
MIRT053229	hsa-miR-106a-5p	qRT-PCRWestern blot	23836497
MIRT049359	hsa-miR-92a-3p	H358"	23820254
MIRT054144	hsa-miR-106b-5p	Luciferase reporter assayqRT-PCRWestern blot	25307786
MIRT054144	hsa-miR-106b-5p	Luciferase reporter assayqRT-PCRWestern blot	25307786
MIRT054273	hsa-miR-874-3p	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	25596740
MIRT054273	hsa-miR-874-3p	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	25596740
MIRT054631	hsa-miR-4516	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	24610393
MIRT054631	hsa-miR-4516	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	24610393
MIRT054903	hsa-miR-17-5p	ImmunoblotLuciferase reporter assay	25594054
MIRT053229	hsa-miR-106a-5p	Luciferase reporter assay	23399684
MIRT438928	hsa-miR-1181	FlowImmunoprecipitaionLuciferase reporter assayqRT-PCRWestern blot	25444909
MIRT438928	hsa-miR-1181	FlowImmunoprecipitaionLuciferase reporter assayqRT-PCRWestern blot	25444909
MIRT031079	hsa-miR-21-5p	ELISAqRT-PCRWestern blot	23998932
MIRT438669	hsa-miR-1234-3p	MicroarrayqRT-PCRWestern blot	23841503
MIRT052931	hsa-miR-124-3p	ELISAImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	23856509
MIRT052931	hsa-miR-124-3p	ELISAImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	23856509
MIRT054903	hsa-miR-17-5p	Luciferase reporter assayMicroarrayNorthern blotqRT-PCRWestern blot	23059786
MIRT050559	hsa-miR-20a-5p	Luciferase reporter assayMicroarrayNorthern blotqRT-PCRWestern blot	23059786
MIRT438217	hsa-miR-181a-5p	qRT-PCRWestern blot	24329418
MIRT052931	hsa-miR-124-3p	Luciferase reporter assay	24184980
MIRT052931	hsa-miR-124-3p	Luciferase reporter assay	24184980
MIRT052931	hsa-miR-124-3p	Luciferase reporter assayqRT-PCRimmunostainingWestern blotting	23940556
MIRT438928	hsa-miR-1181	FlowImmunoprecipitaionLuciferase reporter assayqRT-PCRWestern blot	25444909
MIRT438928	hsa-miR-1181	FlowImmunoprecipitaionLuciferase reporter assayqRT-PCRWestern blot	25444909
MIRT031079	hsa-miR-21-5p	ELISAqRT-PCRWestern blot	23998932
MIRT438669	hsa-miR-1234-3p	MicroarrayqRT-PCRWestern blot	23841503
MIRT052931	hsa-miR-124-3p	ELISAImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	23856509
MIRT052931	hsa-miR-124-3p	ELISAImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	23856509
MIRT054903	hsa-miR-17-5p	Luciferase reporter assayMicroarrayNorthern blotqRT-PCRWestern blot	23059786
MIRT050559	hsa-miR-20a-5p	Luciferase reporter assayMicroarrayNorthern blotqRT-PCRWestern blot	23059786
MIRT438217	hsa-miR-181a-5p	qRT-PCRWestern blot	24329418
MIRT052931	hsa-miR-124-3p	Luciferase reporter assay	24184980
MIRT052931	hsa-miR-124-3p	Luciferase reporter assay	24184980
MIRT052931	hsa-miR-124-3p	Luciferase reporter assayqRT-PCRimmunostainingWestern blotting	23940556
MIRT679681	hsa-miR-4438	HITS-CLIP	23824327
MIRT679680	hsa-miR-500b-3p	HITS-CLIP	23824327
MIRT679679	hsa-miR-6789-3p	HITS-CLIP	23824327
MIRT679678	hsa-miR-3199	HITS-CLIP	23824327
MIRT679677	hsa-miR-8052	HITS-CLIP	23824327
MIRT679676	hsa-miR-365a-5p	HITS-CLIP	23824327
MIRT679675	hsa-miR-365b-5p	HITS-CLIP	23824327
MIRT679674	hsa-miR-5095	HITS-CLIP	23824327
MIRT679673	hsa-miR-7151-3p	HITS-CLIP	23824327
MIRT666067	hsa-miR-6872-3p	HITS-CLIP	23824327
MIRT666066	hsa-miR-4804-3p	HITS-CLIP	23824327
MIRT666064	hsa-miR-4720-3p	HITS-CLIP	23824327
MIRT666065	hsa-miR-6762-3p	HITS-CLIP	23824327
MIRT666063	hsa-miR-6807-5p	HITS-CLIP	23824327
MIRT642430	hsa-miR-618	HITS-CLIP	23824327
MIRT642429	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT642428	hsa-miR-6845-3p	HITS-CLIP	23824327
MIRT642427	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT642426	hsa-miR-4778-3p	HITS-CLIP	23824327
MIRT642425	hsa-miR-5581-3p	HITS-CLIP	23824327
MIRT642424	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT492170	hsa-miR-548n	PAR-CLIP	23592263
MIRT492169	hsa-miR-371b-3p	PAR-CLIP	23592263
MIRT492168	hsa-miR-138-2-3p	PAR-CLIP	23592263
MIRT492166	hsa-miR-7158-5p	PAR-CLIP	23592263
MIRT492167	hsa-miR-4684-5p	PAR-CLIP	23592263
MIRT492165	hsa-miR-1178-3p	PAR-CLIP	23592263
MIRT492164	hsa-miR-4768-5p	PAR-CLIP	23592263
MIRT492163	hsa-miR-6833-3p	PAR-CLIP	23592263
MIRT492162	hsa-miR-6809-3p	PAR-CLIP	23592263
MIRT466961	hsa-miR-6871-3p	PAR-CLIP	23592263
MIRT466959	hsa-miR-6760-5p	PAR-CLIP	23592263
MIRT466960	hsa-miR-1288-5p	PAR-CLIP	23592263
MIRT466958	hsa-miR-922	PAR-CLIP	23592263
MIRT466956	hsa-miR-4270	PAR-CLIP	23592263
MIRT466957	hsa-miR-4441	PAR-CLIP	23592263
MIRT466955	hsa-miR-6754-5p	PAR-CLIP	23592263
MIRT466954	hsa-miR-7113-5p	PAR-CLIP	23592263
MIRT466953	hsa-miR-4685-5p	PAR-CLIP	23592263
MIRT466952	hsa-miR-6837-5p	PAR-CLIP	23592263
MIRT466951	hsa-miR-5681a	PAR-CLIP	23592263
MIRT466950	hsa-miR-6878-5p	PAR-CLIP	23592263
MIRT054144	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT050559	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT054144	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT054903	hsa-miR-17-5p	HITS-CLIP	22473208
MIRT000497	hsa-miR-20b-5p	HITS-CLIP	22473208
MIRT028178	hsa-miR-93-5p	HITS-CLIP	22473208
MIRT726433	hsa-miR-519d-3p	HITS-CLIP	22473208
MIRT050559	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT726433	hsa-miR-519d-3p	Luciferase reporter assayqRT-PCRWestern blot	26238950
MIRT731450	hsa-miR-520c-3p	Luciferase reporter assayqRT-PCRWestern blot	28112380
MIRT731450	hsa-miR-520c-3p	Luciferase reporter assayqRT-PCRWestern blot	28112380
MIRT005006	hsa-miR-125b-5p	Western blot	28108732
MIRT052931	hsa-miR-124-3p	Luciferase reporter assay	26993295
MIRT731625	hsa-miR-125a-5p	ImmunoblotLuciferase reporter assayqRT-PCR	26389681
MIRT731625	hsa-miR-125a-5p	ImmunoblotLuciferase reporter assayqRT-PCR	26389681
MIRT145857	hsa-miR-200a-3p	qRT-PCR	26535690
MIRT052931	hsa-miR-124-3p	FlowqRT-PCRWestern blot	26109806
MIRT052931	hsa-miR-124-3p	Luciferase reporter assay	26707908
MIRT052931	hsa-miR-124-3p	Luciferase reporter assay	26707908
MIRT731935	hsa-miR-21-3p	Luciferase reporter assayqRT-PCRWestern blot	27895788
MIRT731935	hsa-miR-21-3p	Luciferase reporter assayqRT-PCRWestern blot	27895788
MIRT054144	hsa-miR-106b-5p	FlowLuciferase reporter assayqRT-PCRWestern blot	26956882
MIRT054144	hsa-miR-106b-5p	FlowLuciferase reporter assayqRT-PCRWestern blot	26956882
MIRT054144	hsa-miR-106b-5p	FlowLuciferase reporter assayqRT-PCRWestern blot	26956882
MIRT054144	hsa-miR-106b-5p	FlowLuciferase reporter assayqRT-PCRWestern blot	26956882
MIRT054144	hsa-miR-106b-5p	FlowLuciferase reporter assayqRT-PCRWestern blot	26956882
MIRT054144	hsa-miR-106b-5p	FlowLuciferase reporter assayqRT-PCRWestern blot	26956882
MIRT732189	hsa-miR-519a-3p	Luciferase reporter assayqRT-PCRWestern blot	26970980
MIRT732189	hsa-miR-519a-3p	Luciferase reporter assayqRT-PCRWestern blot	26970980
MIRT053229	hsa-miR-106a-5p	Luciferase reporter assayqRT-PCRWestern blot	27325313
MIRT053229	hsa-miR-106a-5p	Luciferase reporter assayqRT-PCRWestern blot	27325313
MIRT054144	hsa-miR-106b-5p	Luciferase reporter assayqRT-PCRWestern blot	27325313
MIRT054144	hsa-miR-106b-5p	Luciferase reporter assayqRT-PCRWestern blot	27325313
MIRT732362	hsa-miR-148a-3p	Luciferase reporter assayqRT-PCRWestern blot	28280370
MIRT732362	hsa-miR-148a-3p	Luciferase reporter assayqRT-PCRWestern blot	28280370
MIRT386936	hsa-miR-544a	Luciferase reporter assayqRT-PCRWestern blot	27186677
MIRT386936	hsa-miR-544a	Luciferase reporter assayqRT-PCRWestern blot	27186677
MIRT053071	hsa-miR-130b-3p	qRT-PCRWestern blot	26475357
MIRT052931	hsa-miR-124-3p	ELISAFlowqRT-PCRWestern blot	27824145
MIRT052931	hsa-miR-124-3p	Luciferase reporter assayqRT-PCRWestern blot	25531908
MIRT052931	hsa-miR-124-3p	Luciferase reporter assayqRT-PCRWestern blot	25531908
MIRT052931	hsa-miR-124-3p	Luciferase reporter assayqRT-PCRWestern blot	25531908
MIRT052931	hsa-miR-124-3p	Luciferase reporter assayqRT-PCRWestern blot	25531908
MIRT052931	hsa-miR-124-3p	Luciferase reporter assayqRT-PCRWestern blot	25531908
MIRT052931	hsa-miR-124-3p	Luciferase reporter assayqRT-PCRWestern blot	25531908
MIRT052931	hsa-miR-124-3p	Luciferase reporter assayqRT-PCRWestern blot	25531908
MIRT052931	hsa-miR-124-3p	Luciferase reporter assayqRT-PCRWestern blot	25531908
MIRT052931	hsa-miR-124-3p	Luciferase reporter assayqRT-PCRWestern blot	25531908
MIRT052931	hsa-miR-124-3p	Luciferase reporter assayqRT-PCRWestern blot	25531908
MIRT052931	hsa-miR-124-3p	Luciferase reporter assayqRT-PCRWestern blot	25531908
MIRT052931	hsa-miR-124-3p	Luciferase reporter assayqRT-PCRWestern blot	25531908
MIRT052931	hsa-miR-124-3p	Luciferase reporter assayqRT-PCRWestern blot	25531908
MIRT052931	hsa-miR-124-3p	Luciferase reporter assayqRT-PCRWestern blot	25531908
MIRT052931	hsa-miR-124-3p	Luciferase reporter assayqRT-PCRWestern blot	25531908
MIRT052931	hsa-miR-124-3p	Luciferase reporter assayqRT-PCRWestern blot	25531908
MIRT031079	hsa-miR-21-5p	Western blot	26549725
MIRT031079	hsa-miR-21-5p	Western blot	26549725
MIRT755943	hsa-miR-323a-3p	qRT-PCR	27059796
MIRT731625	hsa-miR-125a-5p	ImmunohistochemistryLuciferase reporter assayqRT-PCR	26389681
MIRT735260	hsa-miR-29b-3p	Luciferase reporter assayqRT-PCRWestern blot	26175849
MIRT735260	hsa-miR-29b-3p	Luciferase reporter assayqRT-PCRWestern blot	26175849
MIRT005006	hsa-miR-125b-5p	5.0	27576314
MIRT005006	hsa-miR-125b-5p	5.0	27576314
MIRT052931	hsa-miR-124-3p	Luciferase reporter assayqRT-PCRWestern blot	25928665
MIRT735332	hsa-miR-340-5p	Luciferase reporter assayqRT-PCRWestern blot	28413603
MIRT735332	hsa-miR-340-5p	Luciferase reporter assayqRT-PCRWestern blot	28413603
MIRT735332	hsa-miR-340-5p	Luciferase reporter assayqRT-PCRWestern blot	28413603
MIRT735332	hsa-miR-340-5p	Luciferase reporter assayqRT-PCRWestern blot	28413603
MIRT732447	hsa-miR-1301-3p	Luciferase reporter assayWestern blotting	33984882
MIRT053229	hsa-miR-106a-3p	RNA-seq	33037409
MIRT053229	hsa-miR-106a-3p	RNA-seq	33037409
MIRT053229	hsa-miR-106a-3p	RNA-seq	33037409
MIRT732763	hsa-miR-19b-3p	Western blotting	33490119
MIRT732900	hsa-miR-140-3p	Luciferase reporter assayWestern blotting	33456538
MIRT733039	hsa-miR-30b-3p	Immunoprecipitaion (IP)qRT-PCRWestern blotting	33408780
MIRT733101	hsa-miR-135b-5p	ImmunofluorescenceImmunohistochemistry (IHC)In situ hybridizationLuciferase reporter assayqRT-PCRWestern blotting	33990540
MIRT733109	hsa-miR-532-5p	Luciferase reporter assayWestern blottingqRT-PCR	33209030
MIRT733220	hsa-miR-590-5p	Luciferase reporter assayWestern blottingImmunohistochemistry (IHC)qRT-PCR	31520555
MIRT733681	hsa-miR-301b-3p	Luciferase reporter assayqRT-PCRWestern blotting	32170715
MIRT006959	hsa-miR-337-3p	Luciferase reporter assayqRT-PCRWestern blotting	33896365
MIRT734531	hsa-miR-296-5p	qRT-PCRWestern blotting	33664565
MIRT052931	hsa-miR-124-3p	Luciferase reporter assayWestern blottingImmunoprecipitaion (IP)qRT-PCRFlow cytometry	32236565
MIRT734695	hsa-miR-298	qRT-PCR	31484947
MIRT734774	hsa-miR-130a-3p	Western blottingRNA-seqqRT-PCRFlow cytometryImmunocytochemistry (ICC)	33614244
MIRT005006	hsa-miR-125b-5p	Luciferase reporter assayWestern blottingImmunohistochemistry (IHC)ImmunofluorescenceqRT-PCR	32982449
MIRT054903	hsa-miR-17-5p	Luciferase reporter assayWestern blottingMicroarrayImmunohistochemistry (IHC)RNA-seqqRT-PCR	32683798
MIRT052931	hsa-miR-124-3p	Western blottingImmunohistochemistry (IHC)	32850781
MIRT735260	hsa-miR-29b-3p	Luciferase reporter assayWestern blottingqRT-PCR	32653922
MIRT735330	hsa-miR-199a-3p	Luciferase reporter assayWestern blottingImmunofluorescenceqRT-PCR	32354746
MIRT735332	hsa-miR-340-5p	Luciferase reporter assayWestern blottingqRT-PCR	32706318
MIRT054903	hsa-miR-17-5p	Luciferase reporter assayWestern blottingqRT-PCR	32095982
MIRT735654	hsa-miR-143-3p	Western blottingMicroarrayqRT-PCR	31441360
MIRT735753	hsa-miR-204-5p	Luciferase reporter assayWestern blottingImmunohistochemistry (IHC)ImmunofluorescenceqRT-PCR	31938073
MIRT735773	hsa-miR-4500	Luciferase reporter assayWestern blottingImmunoprecipitaion (IP)qRT-PCR	31788846
MIRT737197	hsa-miR-634	Luciferase reporter assayWestern blottingqRT-PCRFlow cytometry	32077744
MIRT737204	hsa-miR-551b-3p	Luciferase reporter assayWestern blottingNorthern blottingImmunoprecipitaion (IP)Immunohistochemistry (IHC)qRT-PCRIn situ hybridizationFlow cytometryELISA	31875548
MIRT737370	hsa-miR-296-3p	Western blottingMicroarrayRNA-seqqRT-PCR	32326395
MIRT735260	hsa-miR-29b-3p	Luciferase reporter assayWestern blottingqRT-PCR	32653922
MIRT735753	hsa-miR-204-5p	Western blottingImmunohistochemistry (IHC)qRT-PCRIn situ hybridizationELISA	32487559
MIRT737511	hsa-miR-29b-2-5p	Western blottingqRT-PCR	33929970
MIRT737511	hsa-miR-29b-2-5p	Western blottingRNA-seqqRT-PCR	31561125
MIRT679681	hsa-miR-4438	HITS-CLIP	23824327
MIRT679680	hsa-miR-500b-3p	HITS-CLIP	23824327
MIRT679679	hsa-miR-6789-3p	HITS-CLIP	23824327
MIRT679678	hsa-miR-3199	HITS-CLIP	23824327
MIRT679677	hsa-miR-8052	HITS-CLIP	23824327
MIRT679676	hsa-miR-365a-5p	HITS-CLIP	23824327
MIRT679675	hsa-miR-365b-5p	HITS-CLIP	23824327
MIRT679674	hsa-miR-5095	HITS-CLIP	23824327
MIRT679673	hsa-miR-7151-3p	HITS-CLIP	23824327
MIRT666067	hsa-miR-6872-3p	HITS-CLIP	23824327
MIRT666066	hsa-miR-4804-3p	HITS-CLIP	23824327
MIRT666064	hsa-miR-4720-3p	HITS-CLIP	23824327
MIRT666065	hsa-miR-6762-3p	HITS-CLIP	23824327
MIRT666063	hsa-miR-6807-5p	HITS-CLIP	23824327
MIRT642430	hsa-miR-618	HITS-CLIP	23824327
MIRT642429	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT642428	hsa-miR-6845-3p	HITS-CLIP	23824327
MIRT642427	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT642426	hsa-miR-4778-3p	HITS-CLIP	23824327
MIRT642425	hsa-miR-5581-3p	HITS-CLIP	23824327
MIRT642424	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT492170	hsa-miR-548n	PAR-CLIP	23592263
MIRT492169	hsa-miR-371b-3p	PAR-CLIP	23592263
MIRT492168	hsa-miR-138-2-3p	PAR-CLIP	23592263
MIRT492166	hsa-miR-7158-5p	PAR-CLIP	23592263
MIRT492167	hsa-miR-4684-5p	PAR-CLIP	23592263
MIRT492165	hsa-miR-1178-3p	PAR-CLIP	23592263
MIRT492164	hsa-miR-4768-5p	PAR-CLIP	23592263
MIRT492163	hsa-miR-6833-3p	PAR-CLIP	23592263
MIRT492162	hsa-miR-6809-3p	PAR-CLIP	23592263
MIRT466961	hsa-miR-6871-3p	PAR-CLIP	23592263
MIRT466959	hsa-miR-6760-5p	PAR-CLIP	23592263
MIRT466960	hsa-miR-1288-5p	PAR-CLIP	23592263
MIRT466958	hsa-miR-922	PAR-CLIP	23592263
MIRT466956	hsa-miR-4270	PAR-CLIP	23592263
MIRT466957	hsa-miR-4441	PAR-CLIP	23592263
MIRT466955	hsa-miR-6754-5p	PAR-CLIP	23592263
MIRT466954	hsa-miR-7113-5p	PAR-CLIP	23592263
MIRT466953	hsa-miR-4685-5p	PAR-CLIP	23592263
MIRT466952	hsa-miR-6837-5p	PAR-CLIP	23592263
MIRT466951	hsa-miR-5681a	PAR-CLIP	23592263
MIRT466950	hsa-miR-6878-5p	PAR-CLIP	23592263
MIRT755549	hsa-miR-21a-5p	Luciferase reporter assayWestern blottingqRT-PCR	35259844
MIRT755671	hsa-miR-200c-5p	Western blottingqRT-PCR	37807322
MIRT755683	hsa-miR-30a-5p	Luciferase reporter assayqRT-PCR	38891028
MIRT735260	hsa-miR-29b-3p	Luciferase reporter assayWestern blottingqRT-PCR	36303071
MIRT755943	hsa-miR-323a-3p	Luciferase reporter assayWestern blottingqRT-PCR	37033189
MIRT735773	hsa-miR-4500	Luciferase reporter assayWestern blottingqRT-PCR	36246567
MIRT053229	hsa-miR-106a-5p	Luciferase reporter assayWestern blottingqRT-PCR	36437465
MIRT756315	rno-miR-21-5p	Western blotting	37641874
MIRT006959	hsa-miR-337-3p	Luciferase reporter assay	33896365
MIRT1395828	hsa-miR-106a	CLIP-seq
MIRT1395829	hsa-miR-106b	CLIP-seq
MIRT1395830	hsa-miR-1299	CLIP-seq
MIRT1395831	hsa-miR-17	CLIP-seq
MIRT1395832	hsa-miR-181a	CLIP-seq
MIRT1395833	hsa-miR-181b	CLIP-seq
MIRT1395834	hsa-miR-181c	CLIP-seq
MIRT1395835	hsa-miR-181d	CLIP-seq
MIRT1395836	hsa-miR-20a	CLIP-seq
MIRT1395837	hsa-miR-20b	CLIP-seq
MIRT1395838	hsa-miR-4262	CLIP-seq
MIRT1395839	hsa-miR-519d	CLIP-seq
MIRT1395840	hsa-miR-548c-3p	CLIP-seq
MIRT1395841	hsa-miR-548t	CLIP-seq
MIRT1395842	hsa-miR-875-3p	CLIP-seq
MIRT1395843	hsa-miR-93	CLIP-seq
MIRT1395828	hsa-miR-106a	CLIP-seq
MIRT1395829	hsa-miR-106b	CLIP-seq
MIRT1395844	hsa-miR-10a	CLIP-seq
MIRT1395845	hsa-miR-10b	CLIP-seq
MIRT1395846	hsa-miR-1193	CLIP-seq
MIRT1395847	hsa-miR-1207-3p	CLIP-seq
MIRT1395848	hsa-miR-1207-5p	CLIP-seq
MIRT1395849	hsa-miR-1234	CLIP-seq
MIRT1395850	hsa-miR-1251	CLIP-seq
MIRT1395851	hsa-miR-1256	CLIP-seq
MIRT1395852	hsa-miR-1287	CLIP-seq
MIRT1395853	hsa-miR-130a	CLIP-seq
MIRT1395854	hsa-miR-130b	CLIP-seq
MIRT1395855	hsa-miR-150	CLIP-seq
MIRT1395856	hsa-miR-1587	CLIP-seq
MIRT1395831	hsa-miR-17	CLIP-seq
MIRT1395857	hsa-miR-1827	CLIP-seq
MIRT1395858	hsa-miR-1909	CLIP-seq
MIRT1395859	hsa-miR-196a	CLIP-seq
MIRT1395860	hsa-miR-196b	CLIP-seq
MIRT1395861	hsa-miR-1976	CLIP-seq
MIRT1395862	hsa-miR-2052	CLIP-seq
MIRT1395836	hsa-miR-20a	CLIP-seq
MIRT1395837	hsa-miR-20b	CLIP-seq
MIRT1395863	hsa-miR-21	CLIP-seq
MIRT1395864	hsa-miR-2392	CLIP-seq
MIRT1395865	hsa-miR-29a	CLIP-seq
MIRT1395866	hsa-miR-29b	CLIP-seq
MIRT1395867	hsa-miR-29c	CLIP-seq
MIRT1395868	hsa-miR-301a	CLIP-seq
MIRT1395869	hsa-miR-301b	CLIP-seq
MIRT1395870	hsa-miR-302a	CLIP-seq
MIRT1395871	hsa-miR-302b	CLIP-seq
MIRT1395872	hsa-miR-302c	CLIP-seq
MIRT1395873	hsa-miR-302d	CLIP-seq
MIRT1395874	hsa-miR-302e	CLIP-seq
MIRT1395875	hsa-miR-3135b	CLIP-seq
MIRT1395876	hsa-miR-3150a-3p	CLIP-seq
MIRT1395877	hsa-miR-3152-3p	CLIP-seq
MIRT1395878	hsa-miR-3169	CLIP-seq
MIRT1395879	hsa-miR-3173-3p	CLIP-seq
MIRT1395880	hsa-miR-3175	CLIP-seq
MIRT1395881	hsa-miR-3180	CLIP-seq
MIRT1395882	hsa-miR-3180-3p	CLIP-seq
MIRT1395883	hsa-miR-3194-3p	CLIP-seq
MIRT1395884	hsa-miR-3196	CLIP-seq
MIRT1395885	hsa-miR-320a	CLIP-seq
MIRT1395886	hsa-miR-320b	CLIP-seq
MIRT1395887	hsa-miR-320c	CLIP-seq
MIRT1395888	hsa-miR-320d	CLIP-seq
MIRT1395889	hsa-miR-340	CLIP-seq
MIRT1395890	hsa-miR-34a	CLIP-seq
MIRT1395891	hsa-miR-34c-5p	CLIP-seq
MIRT1395892	hsa-miR-361-5p	CLIP-seq
MIRT1395893	hsa-miR-3616-3p	CLIP-seq
MIRT1395894	hsa-miR-3659	CLIP-seq
MIRT1395895	hsa-miR-3666	CLIP-seq
MIRT1395896	hsa-miR-3668	CLIP-seq
MIRT1395897	hsa-miR-3677-5p	CLIP-seq
MIRT1395898	hsa-miR-3688-5p	CLIP-seq
MIRT1395899	hsa-miR-372	CLIP-seq
MIRT1395900	hsa-miR-373	CLIP-seq
MIRT1395901	hsa-miR-383	CLIP-seq
MIRT1395902	hsa-miR-3924	CLIP-seq
MIRT1395903	hsa-miR-3925-3p	CLIP-seq
MIRT1395904	hsa-miR-3927	CLIP-seq
MIRT1395905	hsa-miR-3938	CLIP-seq
MIRT1395906	hsa-miR-425	CLIP-seq
MIRT1395907	hsa-miR-4251	CLIP-seq
MIRT1395908	hsa-miR-4279	CLIP-seq
MIRT1395909	hsa-miR-4295	CLIP-seq
MIRT1395910	hsa-miR-4422	CLIP-seq
MIRT1395911	hsa-miR-4429	CLIP-seq
MIRT1395912	hsa-miR-4433	CLIP-seq
MIRT1395913	hsa-miR-4434	CLIP-seq
MIRT1395914	hsa-miR-4435	CLIP-seq
MIRT1395915	hsa-miR-4436a	CLIP-seq
MIRT1395916	hsa-miR-4436b-3p	CLIP-seq
MIRT1395917	hsa-miR-4450	CLIP-seq
MIRT1395918	hsa-miR-4454	CLIP-seq
MIRT1395919	hsa-miR-4459	CLIP-seq
MIRT1395920	hsa-miR-4492	CLIP-seq
MIRT1395921	hsa-miR-4498	CLIP-seq
MIRT1395922	hsa-miR-449a	CLIP-seq
MIRT1395923	hsa-miR-449b	CLIP-seq
MIRT1395924	hsa-miR-4505	CLIP-seq
MIRT1395925	hsa-miR-4511	CLIP-seq
MIRT1395926	hsa-miR-4514	CLIP-seq
MIRT1395927	hsa-miR-4515	CLIP-seq
MIRT1395928	hsa-miR-4531	CLIP-seq
MIRT1395929	hsa-miR-454	CLIP-seq
MIRT1395930	hsa-miR-4638-5p	CLIP-seq
MIRT1395931	hsa-miR-4645-5p	CLIP-seq
MIRT1395932	hsa-miR-4649-3p	CLIP-seq
MIRT1395933	hsa-miR-4652-3p	CLIP-seq
MIRT1395934	hsa-miR-4652-5p	CLIP-seq
MIRT1395935	hsa-miR-4655-3p	CLIP-seq
MIRT1395936	hsa-miR-4656	CLIP-seq
MIRT1395937	hsa-miR-4662a-5p	CLIP-seq
MIRT1395938	hsa-miR-4663	CLIP-seq
MIRT1395939	hsa-miR-4667-5p	CLIP-seq
MIRT1395940	hsa-miR-4673	CLIP-seq
MIRT1395941	hsa-miR-4675	CLIP-seq
MIRT1395942	hsa-miR-4676-5p	CLIP-seq
MIRT1395943	hsa-miR-4687-3p	CLIP-seq
MIRT1395944	hsa-miR-4690-5p	CLIP-seq
MIRT1395945	hsa-miR-4692	CLIP-seq
MIRT1395946	hsa-miR-4695-3p	CLIP-seq
MIRT1395947	hsa-miR-4695-5p	CLIP-seq
MIRT1395948	hsa-miR-4700-5p	CLIP-seq
MIRT1395949	hsa-miR-4709-3p	CLIP-seq
MIRT1395950	hsa-miR-4716-3p	CLIP-seq
MIRT1395951	hsa-miR-4722-3p	CLIP-seq
MIRT1395952	hsa-miR-4722-5p	CLIP-seq
MIRT1395953	hsa-miR-4724-5p	CLIP-seq
MIRT1395954	hsa-miR-4728-5p	CLIP-seq
MIRT1395955	hsa-miR-4731-5p	CLIP-seq
MIRT1395956	hsa-miR-4740-3p	CLIP-seq
MIRT1395957	hsa-miR-4741	CLIP-seq
MIRT1395958	hsa-miR-4755-3p	CLIP-seq
MIRT1395959	hsa-miR-4761-5p	CLIP-seq
MIRT1395960	hsa-miR-4763-3p	CLIP-seq
MIRT1395961	hsa-miR-4764-5p	CLIP-seq
MIRT1395962	hsa-miR-4772-5p	CLIP-seq
MIRT1395963	hsa-miR-4778-5p	CLIP-seq
MIRT1395964	hsa-miR-4779	CLIP-seq
MIRT1395965	hsa-miR-4795-3p	CLIP-seq
MIRT1395966	hsa-miR-4799-5p	CLIP-seq
MIRT1395967	hsa-miR-483-5p	CLIP-seq
MIRT1395968	hsa-miR-485-5p	CLIP-seq
MIRT1395969	hsa-miR-486-3p	CLIP-seq
MIRT1395970	hsa-miR-495	CLIP-seq
MIRT1395971	hsa-miR-498	CLIP-seq
MIRT1395972	hsa-miR-5096	CLIP-seq
MIRT1395973	hsa-miR-512-3p	CLIP-seq
MIRT1395974	hsa-miR-519a	CLIP-seq
MIRT1395975	hsa-miR-519b-3p	CLIP-seq
MIRT1395976	hsa-miR-519c-3p	CLIP-seq
MIRT1395839	hsa-miR-519d	CLIP-seq
MIRT1395977	hsa-miR-520a-3p	CLIP-seq
MIRT1395978	hsa-miR-520b	CLIP-seq
MIRT1395979	hsa-miR-520d-3p	CLIP-seq
MIRT1395980	hsa-miR-520e	CLIP-seq
MIRT1395981	hsa-miR-520g	CLIP-seq
MIRT1395982	hsa-miR-520h	CLIP-seq
MIRT1395983	hsa-miR-539	CLIP-seq
MIRT1395984	hsa-miR-545	CLIP-seq
MIRT1395985	hsa-miR-548b-3p	CLIP-seq
MIRT1395841	hsa-miR-548t	CLIP-seq
MIRT1395986	hsa-miR-575	CLIP-seq
MIRT1395987	hsa-miR-642a	CLIP-seq
MIRT1395988	hsa-miR-642b	CLIP-seq
MIRT1395989	hsa-miR-646	CLIP-seq
MIRT1395990	hsa-miR-665	CLIP-seq
MIRT1395991	hsa-miR-762	CLIP-seq
MIRT1395992	hsa-miR-766	CLIP-seq
MIRT1395993	hsa-miR-876-3p	CLIP-seq
MIRT1395843	hsa-miR-93	CLIP-seq
MIRT1395994	hsa-miR-935	CLIP-seq
MIRT1395995	hsa-miR-939	CLIP-seq
MIRT1395996	hsa-miR-940	CLIP-seq
MIRT1554212	hsa-miR-2861	CLIP-seq
MIRT1554213	hsa-miR-3918	CLIP-seq
MIRT1554214	hsa-miR-4512	CLIP-seq
MIRT1395939	hsa-miR-4667-5p	CLIP-seq
MIRT1395948	hsa-miR-4700-5p	CLIP-seq
MIRT1554215	hsa-miR-544b	CLIP-seq
MIRT1395846	hsa-miR-1193	CLIP-seq
MIRT1922413	hsa-miR-129-5p	CLIP-seq
MIRT1395861	hsa-miR-1976	CLIP-seq
MIRT1395864	hsa-miR-2392	CLIP-seq
MIRT1395877	hsa-miR-3152-3p	CLIP-seq
MIRT1922414	hsa-miR-411	CLIP-seq
MIRT1395918	hsa-miR-4454	CLIP-seq
MIRT1395937	hsa-miR-4662a-5p	CLIP-seq
MIRT1395942	hsa-miR-4676-5p	CLIP-seq
MIRT1395946	hsa-miR-4695-3p	CLIP-seq
MIRT1395967	hsa-miR-483-5p	CLIP-seq
MIRT1395972	hsa-miR-5096	CLIP-seq
MIRT1395986	hsa-miR-575	CLIP-seq
MIRT1395846	hsa-miR-1193	CLIP-seq
MIRT1395861	hsa-miR-1976	CLIP-seq
MIRT1395864	hsa-miR-2392	CLIP-seq
MIRT1395877	hsa-miR-3152-3p	CLIP-seq
MIRT1922414	hsa-miR-411	CLIP-seq
MIRT1395918	hsa-miR-4454	CLIP-seq
MIRT1395937	hsa-miR-4662a-5p	CLIP-seq
MIRT1395942	hsa-miR-4676-5p	CLIP-seq
MIRT1395946	hsa-miR-4695-3p	CLIP-seq
MIRT1395967	hsa-miR-483-5p	CLIP-seq
MIRT1395972	hsa-miR-5096	CLIP-seq
MIRT1395986	hsa-miR-575	CLIP-seq
MIRT1395844	hsa-miR-10a	CLIP-seq
MIRT1395845	hsa-miR-10b	CLIP-seq
MIRT2118698	hsa-miR-1206	CLIP-seq
MIRT2118699	hsa-miR-122	CLIP-seq
MIRT1395851	hsa-miR-1256	CLIP-seq
MIRT2118700	hsa-miR-1303	CLIP-seq
MIRT1395861	hsa-miR-1976	CLIP-seq
MIRT1395863	hsa-miR-21	CLIP-seq
MIRT1395864	hsa-miR-2392	CLIP-seq
MIRT2118701	hsa-miR-3123	CLIP-seq
MIRT1395878	hsa-miR-3169	CLIP-seq
MIRT1395879	hsa-miR-3173-3p	CLIP-seq
MIRT1395881	hsa-miR-3180	CLIP-seq
MIRT1395882	hsa-miR-3180-3p	CLIP-seq
MIRT1395884	hsa-miR-3196	CLIP-seq
MIRT2118702	hsa-miR-3612	CLIP-seq
MIRT2118703	hsa-miR-3919	CLIP-seq
MIRT1395903	hsa-miR-3925-3p	CLIP-seq
MIRT2118704	hsa-miR-3925-5p	CLIP-seq
MIRT2118705	hsa-miR-3944-5p	CLIP-seq
MIRT2118706	hsa-miR-4269	CLIP-seq
MIRT2118707	hsa-miR-4302	CLIP-seq
MIRT2118708	hsa-miR-4330	CLIP-seq
MIRT1395919	hsa-miR-4459	CLIP-seq
MIRT1395926	hsa-miR-4514	CLIP-seq
MIRT1395927	hsa-miR-4515	CLIP-seq
MIRT2118709	hsa-miR-4534	CLIP-seq
MIRT1395931	hsa-miR-4645-5p	CLIP-seq
MIRT2118710	hsa-miR-4670-3p	CLIP-seq
MIRT1395940	hsa-miR-4673	CLIP-seq
MIRT1395942	hsa-miR-4676-5p	CLIP-seq
MIRT1395945	hsa-miR-4692	CLIP-seq
MIRT1395947	hsa-miR-4695-5p	CLIP-seq
MIRT1395952	hsa-miR-4722-5p	CLIP-seq
MIRT2118711	hsa-miR-4733-3p	CLIP-seq
MIRT2118712	hsa-miR-4756-3p	CLIP-seq
MIRT2118713	hsa-miR-4760-3p	CLIP-seq
MIRT1395959	hsa-miR-4761-5p	CLIP-seq
MIRT2118714	hsa-miR-493	CLIP-seq
MIRT2118715	hsa-miR-513a-3p	CLIP-seq
MIRT1395986	hsa-miR-575	CLIP-seq
MIRT2118716	hsa-miR-600	CLIP-seq
MIRT2118717	hsa-miR-648	CLIP-seq
MIRT2118718	hsa-miR-650	CLIP-seq
MIRT1395990	hsa-miR-665	CLIP-seq
MIRT1395992	hsa-miR-766	CLIP-seq
MIRT1395993	hsa-miR-876-3p	CLIP-seq
MIRT1395996	hsa-miR-940	CLIP-seq
MIRT1395850	hsa-miR-1251	CLIP-seq
MIRT1395919	hsa-miR-4459	CLIP-seq
MIRT1395988	hsa-miR-642b	CLIP-seq
MIRT1395828	hsa-miR-106a	CLIP-seq
MIRT1395829	hsa-miR-106b	CLIP-seq
MIRT1395844	hsa-miR-10a	CLIP-seq
MIRT1395845	hsa-miR-10b	CLIP-seq
MIRT1395846	hsa-miR-1193	CLIP-seq
MIRT1395847	hsa-miR-1207-3p	CLIP-seq
MIRT1395848	hsa-miR-1207-5p	CLIP-seq
MIRT2118699	hsa-miR-122	CLIP-seq
MIRT2340934	hsa-miR-124	CLIP-seq
MIRT2340935	hsa-miR-1245b-3p	CLIP-seq
MIRT2340936	hsa-miR-1266	CLIP-seq
MIRT1395852	hsa-miR-1287	CLIP-seq
MIRT2340937	hsa-miR-1301	CLIP-seq
MIRT1395853	hsa-miR-130a	CLIP-seq
MIRT1395854	hsa-miR-130b	CLIP-seq
MIRT1395831	hsa-miR-17	CLIP-seq
MIRT1395857	hsa-miR-1827	CLIP-seq
MIRT2340938	hsa-miR-1913	CLIP-seq
MIRT1395859	hsa-miR-196a	CLIP-seq
MIRT1395860	hsa-miR-196b	CLIP-seq
MIRT1395861	hsa-miR-1976	CLIP-seq
MIRT1395862	hsa-miR-2052	CLIP-seq
MIRT1395836	hsa-miR-20a	CLIP-seq
MIRT1395837	hsa-miR-20b	CLIP-seq
MIRT1395863	hsa-miR-21	CLIP-seq
MIRT2340939	hsa-miR-2116	CLIP-seq
MIRT2340940	hsa-miR-219-1-3p	CLIP-seq
MIRT1395864	hsa-miR-2392	CLIP-seq
MIRT1395868	hsa-miR-301a	CLIP-seq
MIRT1395869	hsa-miR-301b	CLIP-seq
MIRT1395875	hsa-miR-3135b	CLIP-seq
MIRT1395877	hsa-miR-3152-3p	CLIP-seq
MIRT2340941	hsa-miR-3161	CLIP-seq
MIRT1395879	hsa-miR-3173-3p	CLIP-seq
MIRT2340942	hsa-miR-324-3p	CLIP-seq
MIRT1395889	hsa-miR-340	CLIP-seq
MIRT2118702	hsa-miR-3612	CLIP-seq
MIRT1395892	hsa-miR-361-5p	CLIP-seq
MIRT1395894	hsa-miR-3659	CLIP-seq
MIRT2340943	hsa-miR-3664-3p	CLIP-seq
MIRT1395895	hsa-miR-3666	CLIP-seq
MIRT1395896	hsa-miR-3668	CLIP-seq
MIRT2340944	hsa-miR-3673	CLIP-seq
MIRT2340945	hsa-miR-3680	CLIP-seq
MIRT2340946	hsa-miR-3692	CLIP-seq
MIRT2340947	hsa-miR-3714	CLIP-seq
MIRT1395901	hsa-miR-383	CLIP-seq
MIRT2340948	hsa-miR-3910	CLIP-seq
MIRT2118703	hsa-miR-3919	CLIP-seq
MIRT1395902	hsa-miR-3924	CLIP-seq
MIRT1395904	hsa-miR-3927	CLIP-seq
MIRT1395905	hsa-miR-3938	CLIP-seq
MIRT2340949	hsa-miR-3942-3p	CLIP-seq
MIRT1922414	hsa-miR-411	CLIP-seq
MIRT1395908	hsa-miR-4279	CLIP-seq
MIRT1395909	hsa-miR-4295	CLIP-seq
MIRT2118707	hsa-miR-4302	CLIP-seq
MIRT1395912	hsa-miR-4433	CLIP-seq
MIRT1395913	hsa-miR-4434	CLIP-seq
MIRT1395919	hsa-miR-4459	CLIP-seq
MIRT2340950	hsa-miR-4494	CLIP-seq
MIRT2340951	hsa-miR-4506	CLIP-seq
MIRT2340952	hsa-miR-4518	CLIP-seq
MIRT1395928	hsa-miR-4531	CLIP-seq
MIRT2118709	hsa-miR-4534	CLIP-seq
MIRT1395929	hsa-miR-454	CLIP-seq
MIRT2340953	hsa-miR-4640-5p	CLIP-seq
MIRT2340954	hsa-miR-4643	CLIP-seq
MIRT1395932	hsa-miR-4649-3p	CLIP-seq
MIRT1395933	hsa-miR-4652-3p	CLIP-seq
MIRT1395935	hsa-miR-4655-3p	CLIP-seq
MIRT2340955	hsa-miR-466	CLIP-seq
MIRT2340956	hsa-miR-4660	CLIP-seq
MIRT1395937	hsa-miR-4662a-5p	CLIP-seq
MIRT1395939	hsa-miR-4667-5p	CLIP-seq
MIRT1395942	hsa-miR-4676-5p	CLIP-seq
MIRT2340957	hsa-miR-4677-5p	CLIP-seq
MIRT1395943	hsa-miR-4687-3p	CLIP-seq
MIRT1395946	hsa-miR-4695-3p	CLIP-seq
MIRT1395947	hsa-miR-4695-5p	CLIP-seq
MIRT1395948	hsa-miR-4700-5p	CLIP-seq
MIRT2340958	hsa-miR-4704-5p	CLIP-seq
MIRT1395949	hsa-miR-4709-3p	CLIP-seq
MIRT2340959	hsa-miR-4714-5p	CLIP-seq
MIRT1395951	hsa-miR-4722-3p	CLIP-seq
MIRT1395953	hsa-miR-4724-5p	CLIP-seq
MIRT2340960	hsa-miR-4726-5p	CLIP-seq
MIRT1395955	hsa-miR-4731-5p	CLIP-seq
MIRT2118711	hsa-miR-4733-3p	CLIP-seq
MIRT2340961	hsa-miR-4735-5p	CLIP-seq
MIRT1395956	hsa-miR-4740-3p	CLIP-seq
MIRT2340962	hsa-miR-4753-5p	CLIP-seq
MIRT1395958	hsa-miR-4755-3p	CLIP-seq
MIRT1395959	hsa-miR-4761-5p	CLIP-seq
MIRT1395960	hsa-miR-4763-3p	CLIP-seq
MIRT1395961	hsa-miR-4764-5p	CLIP-seq
MIRT1395962	hsa-miR-4772-5p	CLIP-seq
MIRT2340963	hsa-miR-4775	CLIP-seq
MIRT1395963	hsa-miR-4778-5p	CLIP-seq
MIRT2340964	hsa-miR-4789-3p	CLIP-seq
MIRT1395965	hsa-miR-4795-3p	CLIP-seq
MIRT2340965	hsa-miR-4798-3p	CLIP-seq
MIRT1395966	hsa-miR-4799-5p	CLIP-seq
MIRT1395967	hsa-miR-483-5p	CLIP-seq
MIRT2340966	hsa-miR-494	CLIP-seq
MIRT1395971	hsa-miR-498	CLIP-seq
MIRT2340967	hsa-miR-5047	CLIP-seq
MIRT2340968	hsa-miR-506	CLIP-seq
MIRT1395972	hsa-miR-5096	CLIP-seq
MIRT1395974	hsa-miR-519a	CLIP-seq
MIRT1395975	hsa-miR-519b-3p	CLIP-seq
MIRT1395976	hsa-miR-519c-3p	CLIP-seq
MIRT1395839	hsa-miR-519d	CLIP-seq
MIRT2340969	hsa-miR-520a-5p	CLIP-seq
MIRT2340970	hsa-miR-525-5p	CLIP-seq
MIRT1554215	hsa-miR-544b	CLIP-seq
MIRT1395984	hsa-miR-545	CLIP-seq
MIRT1395841	hsa-miR-548t	CLIP-seq
MIRT2340971	hsa-miR-550b	CLIP-seq
MIRT2340972	hsa-miR-571	CLIP-seq
MIRT1395986	hsa-miR-575	CLIP-seq
MIRT2340973	hsa-miR-590-3p	CLIP-seq
MIRT1395987	hsa-miR-642a	CLIP-seq
MIRT2118718	hsa-miR-650	CLIP-seq
MIRT1395990	hsa-miR-665	CLIP-seq
MIRT2340974	hsa-miR-874	CLIP-seq
MIRT1395993	hsa-miR-876-3p	CLIP-seq
MIRT1395843	hsa-miR-93	CLIP-seq
MIRT1395994	hsa-miR-935	CLIP-seq
MIRT2118713	hsa-miR-4760-3p	CLIP-seq
MIRT1395863	hsa-miR-21	CLIP-seq
MIRT1395863	hsa-miR-21	CLIP-seq
MIRT1395919	hsa-miR-4459	CLIP-seq
MIRT2340963	hsa-miR-4775	CLIP-seq
MIRT2442714	hsa-miR-24	CLIP-seq
MIRT2118705	hsa-miR-3944-5p	CLIP-seq
MIRT2442715	hsa-miR-4284	CLIP-seq
MIRT1395959	hsa-miR-4761-5p	CLIP-seq
MIRT2442716	hsa-miR-4772-3p	CLIP-seq
MIRT2340963	hsa-miR-4775	CLIP-seq
MIRT1395965	hsa-miR-4795-3p	CLIP-seq
MIRT2340936	hsa-miR-1266	CLIP-seq
MIRT1395861	hsa-miR-1976	CLIP-seq
MIRT2340943	hsa-miR-3664-3p	CLIP-seq
MIRT1395908	hsa-miR-4279	CLIP-seq
MIRT2340952	hsa-miR-4518	CLIP-seq
MIRT1395951	hsa-miR-4722-3p	CLIP-seq
MIRT1395971	hsa-miR-498	CLIP-seq
MIRT2340963	hsa-miR-4775	CLIP-seq
MIRT1395828	hsa-miR-106a	CLIP-seq
MIRT1395829	hsa-miR-106b	CLIP-seq
MIRT1395844	hsa-miR-10a	CLIP-seq
MIRT1395845	hsa-miR-10b	CLIP-seq
MIRT2118698	hsa-miR-1206	CLIP-seq
MIRT1395847	hsa-miR-1207-3p	CLIP-seq
MIRT2118699	hsa-miR-122	CLIP-seq
MIRT2634838	hsa-miR-1249	CLIP-seq
MIRT2634839	hsa-miR-1264	CLIP-seq
MIRT2340936	hsa-miR-1266	CLIP-seq
MIRT1922413	hsa-miR-129-5p	CLIP-seq
MIRT2118700	hsa-miR-1303	CLIP-seq
MIRT1395853	hsa-miR-130a	CLIP-seq
MIRT1395854	hsa-miR-130b	CLIP-seq
MIRT1395831	hsa-miR-17	CLIP-seq
MIRT1395857	hsa-miR-1827	CLIP-seq
MIRT2340938	hsa-miR-1913	CLIP-seq
MIRT1395861	hsa-miR-1976	CLIP-seq
MIRT1395862	hsa-miR-2052	CLIP-seq
MIRT1395836	hsa-miR-20a	CLIP-seq
MIRT1395837	hsa-miR-20b	CLIP-seq
MIRT2340940	hsa-miR-219-1-3p	CLIP-seq
MIRT1395864	hsa-miR-2392	CLIP-seq
MIRT2442714	hsa-miR-24	CLIP-seq
MIRT1395868	hsa-miR-301a	CLIP-seq
MIRT1395869	hsa-miR-301b	CLIP-seq
MIRT2118701	hsa-miR-3123	CLIP-seq
MIRT2634840	hsa-miR-3157-3p	CLIP-seq
MIRT2634841	hsa-miR-3158-3p	CLIP-seq
MIRT2634842	hsa-miR-3163	CLIP-seq
MIRT1395878	hsa-miR-3169	CLIP-seq
MIRT1395881	hsa-miR-3180	CLIP-seq
MIRT1395882	hsa-miR-3180-3p	CLIP-seq
MIRT1395884	hsa-miR-3196	CLIP-seq
MIRT2634843	hsa-miR-323-3p	CLIP-seq
MIRT2634844	hsa-miR-323b-3p	CLIP-seq
MIRT2340942	hsa-miR-324-3p	CLIP-seq
MIRT2634845	hsa-miR-338-3p	CLIP-seq
MIRT2634846	hsa-miR-338-5p	CLIP-seq
MIRT1395889	hsa-miR-340	CLIP-seq
MIRT2634847	hsa-miR-3662	CLIP-seq
MIRT2340943	hsa-miR-3664-3p	CLIP-seq
MIRT1395895	hsa-miR-3666	CLIP-seq
MIRT2340945	hsa-miR-3680	CLIP-seq
MIRT2340946	hsa-miR-3692	CLIP-seq
MIRT1395901	hsa-miR-383	CLIP-seq
MIRT2118703	hsa-miR-3919	CLIP-seq
MIRT2634848	hsa-miR-3921	CLIP-seq
MIRT1395903	hsa-miR-3925-3p	CLIP-seq
MIRT2118704	hsa-miR-3925-5p	CLIP-seq
MIRT2118705	hsa-miR-3944-5p	CLIP-seq
MIRT2634849	hsa-miR-4257	CLIP-seq
MIRT1395908	hsa-miR-4279	CLIP-seq
MIRT2442715	hsa-miR-4284	CLIP-seq
MIRT1395909	hsa-miR-4295	CLIP-seq
MIRT2118707	hsa-miR-4302	CLIP-seq
MIRT2634850	hsa-miR-4446-3p	CLIP-seq
MIRT1395919	hsa-miR-4459	CLIP-seq
MIRT1395926	hsa-miR-4514	CLIP-seq
MIRT1395927	hsa-miR-4515	CLIP-seq
MIRT2340952	hsa-miR-4518	CLIP-seq
MIRT2634851	hsa-miR-4530	CLIP-seq
MIRT2118709	hsa-miR-4534	CLIP-seq
MIRT1395929	hsa-miR-454	CLIP-seq
MIRT2634852	hsa-miR-4540	CLIP-seq
MIRT1395931	hsa-miR-4645-5p	CLIP-seq
MIRT1395932	hsa-miR-4649-3p	CLIP-seq
MIRT2634853	hsa-miR-4653-5p	CLIP-seq
MIRT1395940	hsa-miR-4673	CLIP-seq
MIRT2634854	hsa-miR-4682	CLIP-seq
MIRT2634855	hsa-miR-4686	CLIP-seq
MIRT2634856	hsa-miR-4690-3p	CLIP-seq
MIRT1395945	hsa-miR-4692	CLIP-seq
MIRT2340959	hsa-miR-4714-5p	CLIP-seq
MIRT1395951	hsa-miR-4722-3p	CLIP-seq
MIRT1395952	hsa-miR-4722-5p	CLIP-seq
MIRT2340961	hsa-miR-4735-5p	CLIP-seq
MIRT1395956	hsa-miR-4740-3p	CLIP-seq
MIRT2340962	hsa-miR-4753-5p	CLIP-seq
MIRT2118712	hsa-miR-4756-3p	CLIP-seq
MIRT2118713	hsa-miR-4760-3p	CLIP-seq
MIRT1395959	hsa-miR-4761-5p	CLIP-seq
MIRT1395961	hsa-miR-4764-5p	CLIP-seq
MIRT2442716	hsa-miR-4772-3p	CLIP-seq
MIRT1395962	hsa-miR-4772-5p	CLIP-seq
MIRT2340963	hsa-miR-4775	CLIP-seq
MIRT2634857	hsa-miR-4786-5p	CLIP-seq
MIRT1395965	hsa-miR-4795-3p	CLIP-seq
MIRT2340965	hsa-miR-4798-3p	CLIP-seq
MIRT2118714	hsa-miR-493	CLIP-seq
MIRT2340966	hsa-miR-494	CLIP-seq
MIRT1395970	hsa-miR-495	CLIP-seq
MIRT1395971	hsa-miR-498	CLIP-seq
MIRT1395974	hsa-miR-519a	CLIP-seq
MIRT1395975	hsa-miR-519b-3p	CLIP-seq
MIRT1395976	hsa-miR-519c-3p	CLIP-seq
MIRT1395839	hsa-miR-519d	CLIP-seq
MIRT2340969	hsa-miR-520a-5p	CLIP-seq
MIRT2634858	hsa-miR-520d-5p	CLIP-seq
MIRT2634859	hsa-miR-521	CLIP-seq
MIRT2634860	hsa-miR-524-5p	CLIP-seq
MIRT2340970	hsa-miR-525-5p	CLIP-seq
MIRT1395984	hsa-miR-545	CLIP-seq
MIRT1395841	hsa-miR-548t	CLIP-seq
MIRT2340971	hsa-miR-550b	CLIP-seq
MIRT2340972	hsa-miR-571	CLIP-seq
MIRT2340973	hsa-miR-590-3p	CLIP-seq
MIRT1395988	hsa-miR-642b	CLIP-seq
MIRT2118717	hsa-miR-648	CLIP-seq
MIRT1395992	hsa-miR-766	CLIP-seq
MIRT2634861	hsa-miR-767-3p	CLIP-seq
MIRT2340974	hsa-miR-874	CLIP-seq
MIRT1395993	hsa-miR-876-3p	CLIP-seq
MIRT1395843	hsa-miR-93	CLIP-seq
MIRT2634862	hsa-miR-938	CLIP-seq
MIRT1395996	hsa-miR-940	CLIP-seq
MIRT1395828	hsa-miR-106a	CLIP-seq
MIRT1395829	hsa-miR-106b	CLIP-seq
MIRT1395844	hsa-miR-10a	CLIP-seq
MIRT1395845	hsa-miR-10b	CLIP-seq
MIRT2118698	hsa-miR-1206	CLIP-seq
MIRT1395847	hsa-miR-1207-3p	CLIP-seq
MIRT2118699	hsa-miR-122	CLIP-seq
MIRT2634838	hsa-miR-1249	CLIP-seq
MIRT2692200	hsa-miR-1255a	CLIP-seq
MIRT2692201	hsa-miR-1255b	CLIP-seq
MIRT2634839	hsa-miR-1264	CLIP-seq
MIRT2340936	hsa-miR-1266	CLIP-seq
MIRT1922413	hsa-miR-129-5p	CLIP-seq
MIRT2118700	hsa-miR-1303	CLIP-seq
MIRT1395853	hsa-miR-130a	CLIP-seq
MIRT1395854	hsa-miR-130b	CLIP-seq
MIRT1395831	hsa-miR-17	CLIP-seq
MIRT1395857	hsa-miR-1827	CLIP-seq
MIRT2340938	hsa-miR-1913	CLIP-seq
MIRT1395861	hsa-miR-1976	CLIP-seq
MIRT1395862	hsa-miR-2052	CLIP-seq
MIRT1395836	hsa-miR-20a	CLIP-seq
MIRT1395837	hsa-miR-20b	CLIP-seq
MIRT1395863	hsa-miR-21	CLIP-seq
MIRT2340940	hsa-miR-219-1-3p	CLIP-seq
MIRT1395864	hsa-miR-2392	CLIP-seq
MIRT2442714	hsa-miR-24	CLIP-seq
MIRT1395868	hsa-miR-301a	CLIP-seq
MIRT1395869	hsa-miR-301b	CLIP-seq
MIRT2118701	hsa-miR-3123	CLIP-seq
MIRT2634840	hsa-miR-3157-3p	CLIP-seq
MIRT2634841	hsa-miR-3158-3p	CLIP-seq
MIRT2634842	hsa-miR-3163	CLIP-seq
MIRT1395878	hsa-miR-3169	CLIP-seq
MIRT1395881	hsa-miR-3180	CLIP-seq
MIRT1395882	hsa-miR-3180-3p	CLIP-seq
MIRT1395884	hsa-miR-3196	CLIP-seq
MIRT2634843	hsa-miR-323-3p	CLIP-seq
MIRT2634844	hsa-miR-323b-3p	CLIP-seq
MIRT2340942	hsa-miR-324-3p	CLIP-seq
MIRT2634845	hsa-miR-338-3p	CLIP-seq
MIRT2634846	hsa-miR-338-5p	CLIP-seq
MIRT1395889	hsa-miR-340	CLIP-seq
MIRT2340943	hsa-miR-3664-3p	CLIP-seq
MIRT1395895	hsa-miR-3666	CLIP-seq
MIRT1395896	hsa-miR-3668	CLIP-seq
MIRT2340945	hsa-miR-3680	CLIP-seq
MIRT2340946	hsa-miR-3692	CLIP-seq
MIRT1395901	hsa-miR-383	CLIP-seq
MIRT2118703	hsa-miR-3919	CLIP-seq
MIRT2634848	hsa-miR-3921	CLIP-seq
MIRT1395903	hsa-miR-3925-3p	CLIP-seq
MIRT2118704	hsa-miR-3925-5p	CLIP-seq
MIRT2118705	hsa-miR-3944-5p	CLIP-seq
MIRT2634849	hsa-miR-4257	CLIP-seq
MIRT1395908	hsa-miR-4279	CLIP-seq
MIRT2442715	hsa-miR-4284	CLIP-seq
MIRT1395909	hsa-miR-4295	CLIP-seq
MIRT2118707	hsa-miR-4302	CLIP-seq
MIRT1395912	hsa-miR-4433	CLIP-seq
MIRT2634850	hsa-miR-4446-3p	CLIP-seq
MIRT1395919	hsa-miR-4459	CLIP-seq
MIRT1395926	hsa-miR-4514	CLIP-seq
MIRT1395927	hsa-miR-4515	CLIP-seq
MIRT2340952	hsa-miR-4518	CLIP-seq
MIRT2634851	hsa-miR-4530	CLIP-seq
MIRT2118709	hsa-miR-4534	CLIP-seq
MIRT1395929	hsa-miR-454	CLIP-seq
MIRT2634852	hsa-miR-4540	CLIP-seq
MIRT1395931	hsa-miR-4645-5p	CLIP-seq
MIRT1395932	hsa-miR-4649-3p	CLIP-seq
MIRT2634853	hsa-miR-4653-5p	CLIP-seq
MIRT1395940	hsa-miR-4673	CLIP-seq
MIRT2634854	hsa-miR-4682	CLIP-seq
MIRT2634855	hsa-miR-4686	CLIP-seq
MIRT2634856	hsa-miR-4690-3p	CLIP-seq
MIRT1395945	hsa-miR-4692	CLIP-seq
MIRT2340959	hsa-miR-4714-5p	CLIP-seq
MIRT1395951	hsa-miR-4722-3p	CLIP-seq
MIRT1395952	hsa-miR-4722-5p	CLIP-seq
MIRT2340961	hsa-miR-4735-5p	CLIP-seq
MIRT1395956	hsa-miR-4740-3p	CLIP-seq
MIRT2340962	hsa-miR-4753-5p	CLIP-seq
MIRT1395958	hsa-miR-4755-3p	CLIP-seq
MIRT2118712	hsa-miR-4756-3p	CLIP-seq
MIRT2118713	hsa-miR-4760-3p	CLIP-seq
MIRT1395959	hsa-miR-4761-5p	CLIP-seq
MIRT1395961	hsa-miR-4764-5p	CLIP-seq
MIRT2692202	hsa-miR-4768-3p	CLIP-seq
MIRT2442716	hsa-miR-4772-3p	CLIP-seq
MIRT1395962	hsa-miR-4772-5p	CLIP-seq
MIRT2340963	hsa-miR-4775	CLIP-seq
MIRT2634857	hsa-miR-4786-5p	CLIP-seq
MIRT1395965	hsa-miR-4795-3p	CLIP-seq
MIRT2340965	hsa-miR-4798-3p	CLIP-seq
MIRT2118714	hsa-miR-493	CLIP-seq
MIRT2340966	hsa-miR-494	CLIP-seq
MIRT1395970	hsa-miR-495	CLIP-seq
MIRT1395971	hsa-miR-498	CLIP-seq
MIRT1395974	hsa-miR-519a	CLIP-seq
MIRT1395975	hsa-miR-519b-3p	CLIP-seq
MIRT1395976	hsa-miR-519c-3p	CLIP-seq
MIRT1395839	hsa-miR-519d	CLIP-seq
MIRT2340969	hsa-miR-520a-5p	CLIP-seq
MIRT2634858	hsa-miR-520d-5p	CLIP-seq
MIRT2634859	hsa-miR-521	CLIP-seq
MIRT2634860	hsa-miR-524-5p	CLIP-seq
MIRT2340970	hsa-miR-525-5p	CLIP-seq
MIRT1395984	hsa-miR-545	CLIP-seq
MIRT1395841	hsa-miR-548t	CLIP-seq
MIRT2340971	hsa-miR-550b	CLIP-seq
MIRT2340972	hsa-miR-571	CLIP-seq
MIRT2340973	hsa-miR-590-3p	CLIP-seq
MIRT1395988	hsa-miR-642b	CLIP-seq
MIRT1395989	hsa-miR-646	CLIP-seq
MIRT2118717	hsa-miR-648	CLIP-seq
MIRT1395990	hsa-miR-665	CLIP-seq
MIRT1395992	hsa-miR-766	CLIP-seq
MIRT2634861	hsa-miR-767-3p	CLIP-seq
MIRT2692203	hsa-miR-769-5p	CLIP-seq
MIRT2340974	hsa-miR-874	CLIP-seq
MIRT1395993	hsa-miR-876-3p	CLIP-seq
MIRT1395843	hsa-miR-93	CLIP-seq
MIRT2634862	hsa-miR-938	CLIP-seq
MIRT1395996	hsa-miR-940	CLIP-seq

Show/Hide all (14)

Transcription factor	Regulation	Reference
BCL6	Unknown	17951530
BRCA1	Unknown	11163768
CEBPA	Unknown	24429361
HDAC1	Unknown	18611949
HIC1	Activation	24067369
HIF1A	Unknown	23991099
KAT5	Repression	12551922
PIAS3	Unknown	16098628
RELA	Unknown	25040843
SPI1	Unknown	24429361
STAT1	Unknown	22693070
TCF7L2	Unknown	18602747
TP53	Repression	11809683
ZNF382	Repression	20682794

237

Show/Hide all (237)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	TAS	8675499
GO:0000785	Component	Chromatin	IDA	16835372
GO:0000785	Component	Chromatin	ISA
GO:0000976	Function	Transcription cis-regulatory region binding	IDA	17324931
GO:0000976	Function	Transcription cis-regulatory region binding	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	19390056
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IDA	17344214, 32929201
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IMP	38404237
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	16835372
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IGI	31886314
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IMP	16946298
GO:0001659	Process	Temperature homeostasis	IEA
GO:0001659	Process	Temperature homeostasis	ISS
GO:0001666	Process	Response to hypoxia	IEA
GO:0001754	Process	Eye photoreceptor cell differentiation	ISS
GO:0001817	Process	Regulation of cytokine production	IEA
GO:0002931	Process	Response to ischemia	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	ISS
GO:0003700	Function	DNA-binding transcription factor activity	IC	7543512
GO:0003700	Function	DNA-binding transcription factor activity	IDA	7568001, 9535918, 15653507, 16285960, 17344214, 18782771, 28781374
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003700	Function	DNA-binding transcription factor activity	TAS	7512451, 8675499
GO:0003723	Function	RNA binding	IPI	31507089
GO:0004879	Function	Nuclear receptor activity	IDA	17324931
GO:0005102	Function	Signaling receptor binding	IPI	31145836
GO:0005515	Function	Protein binding	IPI	8662591, 9864141, 10688651, 11536047, 11585385, 11940572, 11970898, 12867595, 14966128, 15286705, 15657067, 15764709, 15821101, 15998644, 16273093, 16306601, 16331268, 16364321, 16531398, 16568091, 18200042, 18234692, 18330356, 19345327, 19372587, 20133729, 20826784, 20871632, 20876
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IC	7543512, 7568001, 8756628, 28781374
GO:0005634	Component	Nucleus	IDA	7528668, 12743296, 15653507, 16285960, 17344214
GO:0005634	Component	Nucleus	IDA	12444102, 17324931, 17360477, 18234692, 22783022, 24846175, 28065600, 31899195
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005667	Component	Transcription regulator complex	IDA	24429361
GO:0005667	Component	Transcription regulator complex	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	12743296
GO:0005737	Component	Cytoplasm	IDA	15653507, 16285960, 17360477, 18234692, 22783022, 31899195
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005737	Component	Cytoplasm	TAS	7512451
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0006355	Process	Regulation of DNA-templated transcription	IDA	15664994, 17344214
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	ISS
GO:0006357	Process	Regulation of transcription by RNA polymerase II	TAS	7512451
GO:0006366	Process	Transcription by RNA polymerase II	IEA
GO:0006606	Process	Protein import into nucleus	IDA	18234692
GO:0006952	Process	Defense response	IBA
GO:0006953	Process	Acute-phase response	IEA
GO:0006954	Process	Inflammatory response	IDA	10443688
GO:0006954	Process	Inflammatory response	IEA
GO:0006954	Process	Inflammatory response	ISS
GO:0006955	Process	Immune response	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007165	Process	Signal transduction	TAS	7512451, 10205054
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IGI	28467929
GO:0007249	Process	Canonical NF-kappaB signal transduction	IDA	34721373
GO:0007259	Process	Cell surface receptor signaling pathway via JAK-STAT	IBA
GO:0007259	Process	Cell surface receptor signaling pathway via JAK-STAT	IDA	8272873
GO:0007259	Process	Cell surface receptor signaling pathway via JAK-STAT	IDA	8272873
GO:0007259	Process	Cell surface receptor signaling pathway via JAK-STAT	NAS	15864272, 24058793
GO:0007259	Process	Cell surface receptor signaling pathway via JAK-STAT	TAS	9670957, 15664994
GO:0007399	Process	Nervous system development	TAS	10205054
GO:0008283	Process	Cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0010467	Process	Gene expression	IEA
GO:0010507	Process	Negative regulation of autophagy	IDA	26962683
GO:0010575	Process	Positive regulation of vascular endothelial growth factor production	IMP	25596740
GO:0010628	Process	Positive regulation of gene expression	IDA	23820254
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0010628	Process	Positive regulation of gene expression	IMP	24255059
GO:0010629	Process	Negative regulation of gene expression	IDA	23820254
GO:0010730	Process	Negative regulation of hydrogen peroxide biosynthetic process	IEA
GO:0014069	Component	Postsynaptic density	IEA
GO:0016310	Process	Phosphorylation	ISS
GO:0019221	Process	Cytokine-mediated signaling pathway	IEA
GO:0019221	Process	Cytokine-mediated signaling pathway	NAS	12743296, 15664994
GO:0019901	Function	Protein kinase binding	IEA
GO:0019901	Function	Protein kinase binding	ISS
GO:0019903	Function	Protein phosphatase binding	IPI	12359225, 17360477
GO:0019953	Process	Sexual reproduction	IEA
GO:0019953	Process	Sexual reproduction	ISS
GO:0023019	Process	Signal transduction involved in regulation of gene expression	IDA	34721373
GO:0030154	Process	Cell differentiation	IDA	28781374
GO:0030335	Process	Positive regulation of cell migration	IMP	24846175, 31638206
GO:0030522	Process	Intracellular receptor signaling pathway	IDA	17324931
GO:0031490	Function	Chromatin DNA binding	IDA	17344214
GO:0031730	Function	CCR5 chemokine receptor binding	IEA
GO:0032355	Process	Response to estradiol	IDA	12552091
GO:0032355	Process	Response to estradiol	IEA
GO:0032731	Process	Positive regulation of interleukin-1 beta production	IGI	31886314
GO:0032733	Process	Positive regulation of interleukin-10 production	IGI	31886314
GO:0032755	Process	Positive regulation of interleukin-6 production	IEA
GO:0032755	Process	Positive regulation of interleukin-6 production	ISS
GO:0032757	Process	Positive regulation of interleukin-8 production	IGI	31886314
GO:0032760	Process	Positive regulation of tumor necrosis factor production	IGI	31886314
GO:0032870	Process	Cellular response to hormone stimulus	IDA	12552091
GO:0032991	Component	Protein-containing complex	IEA
GO:0033210	Process	Leptin-mediated signaling pathway	IBA
GO:0033210	Process	Leptin-mediated signaling pathway	IDA	17344214
GO:0033210	Process	Leptin-mediated signaling pathway	IEA
GO:0034097	Process	Response to cytokine	IEA
GO:0035019	Process	Somatic stem cell population maintenance	IEA
GO:0035259	Function	Nuclear glucocorticoid receptor binding	IEA
GO:0035591	Function	Signaling adaptor activity	IPI	31145836
GO:0035723	Process	Interleukin-15-mediated signaling pathway	IDA	7568001
GO:0038110	Process	Interleukin-2-mediated signaling pathway	IDA	7568005
GO:0038113	Process	Interleukin-9-mediated signaling pathway	IDA	9535918
GO:0038154	Process	Interleukin-11-mediated signaling pathway	IDA	28781374
GO:0038155	Process	Interleukin-23-mediated signaling pathway	IDA	12023369
GO:0040014	Process	Regulation of multicellular organism growth	IEA
GO:0042127	Process	Regulation of cell population proliferation	IBA
GO:0042593	Process	Glucose homeostasis	IEA
GO:0042593	Process	Glucose homeostasis	ISS
GO:0042755	Process	Eating behavior	IEA
GO:0042755	Process	Eating behavior	ISS
GO:0042789	Process	MRNA transcription by RNA polymerase II	IEA
GO:0042802	Function	Identical protein binding	IEA
GO:0042802	Function	Identical protein binding	IPI	7510216, 17676033, 21988832, 25609649
GO:0042803	Function	Protein homodimerization activity	IDA	15653507
GO:0042803	Function	Protein homodimerization activity	IEA
GO:0042803	Function	Protein homodimerization activity	ISS
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IEA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	ISS
GO:0043124	Process	Negative regulation of canonical NF-kappaB signal transduction	IEA
GO:0043124	Process	Negative regulation of canonical NF-kappaB signal transduction	ISS
GO:0043434	Process	Response to peptide hormone	IBA
GO:0043434	Process	Response to peptide hormone	IEA
GO:0043491	Process	Phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	27830702
GO:0043491	Process	Phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0044320	Process	Cellular response to leptin stimulus	IDA	17344214
GO:0044321	Process	Response to leptin	IDA	17344214
GO:0044321	Process	Response to leptin	IEA
GO:0045471	Process	Response to ethanol	IEA
GO:0045648	Process	Positive regulation of erythrocyte differentiation	IMP	28283061
GO:0045747	Process	Positive regulation of Notch signaling pathway	IEA
GO:0045747	Process	Positive regulation of Notch signaling pathway	ISS
GO:0045766	Process	Positive regulation of angiogenesis	IEA
GO:0045820	Process	Negative regulation of glycolytic process	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	19390056
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	ISS
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	17324931, 27050391
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IGI	19754877, 24429361, 31886314
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	16835372, 16946298
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	NAS	15864272, 24058793
GO:0046902	Process	Regulation of mitochondrial membrane permeability	IEA
GO:0046983	Function	Protein dimerization activity	IEA
GO:0046983	Function	Protein dimerization activity	ISS
GO:0048708	Process	Astrocyte differentiation	IEA
GO:0048708	Process	Astrocyte differentiation	ISS
GO:0050728	Process	Negative regulation of inflammatory response	IEA
GO:0050728	Process	Negative regulation of inflammatory response	ISS
GO:0050729	Process	Positive regulation of inflammatory response	IDA	23125416
GO:0050766	Process	Positive regulation of phagocytosis	IDA	27994074
GO:0050804	Process	Modulation of chemical synaptic transmission	IEA
GO:0051240	Process	Positive regulation of multicellular organismal process	IEA
GO:0051726	Process	Regulation of cell cycle	IDA	17344214
GO:0051726	Process	Regulation of cell cycle	IEA
GO:0060019	Process	Radial glial cell differentiation	IEA
GO:0060019	Process	Radial glial cell differentiation	ISS
GO:0060221	Process	Retinal rod cell differentiation	IEA
GO:0060259	Process	Regulation of feeding behavior	IEA
GO:0060259	Process	Regulation of feeding behavior	ISS
GO:0060396	Process	Growth hormone receptor signaling pathway	IDA	10925297
GO:0060397	Process	Growth hormone receptor signaling pathway via JAK-STAT	IBA
GO:0060397	Process	Growth hormone receptor signaling pathway via JAK-STAT	IDA	12552091
GO:0060397	Process	Growth hormone receptor signaling pathway via JAK-STAT	IEA
GO:0060397	Process	Growth hormone receptor signaling pathway via JAK-STAT	ISS
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IPI	22783022, 24429361, 28467929
GO:0070102	Process	Interleukin-6-mediated signaling pathway	IDA	8272873
GO:0070102	Process	Interleukin-6-mediated signaling pathway	IDA	12359225, 12552091, 16285960, 17324931, 24429361
GO:0070102	Process	Interleukin-6-mediated signaling pathway	IMP	16835372, 16946298
GO:0070878	Function	Primary miRNA binding	IPI	31507089
GO:0071345	Process	Cellular response to cytokine stimulus	IEA
GO:0072538	Process	T-helper 17 type immune response	IDA	31899195
GO:0072540	Process	T-helper 17 cell lineage commitment	IEA
GO:0072540	Process	T-helper 17 cell lineage commitment	ISS
GO:0072540	Process	T-helper 17 cell lineage commitment	TAS	27893700
GO:0090091	Process	Positive regulation of extracellular matrix disassembly	IGI	23820254
GO:0090575	Component	RNA polymerase II transcription regulator complex	IBA
GO:0090575	Component	RNA polymerase II transcription regulator complex	IC	16835372
GO:0090575	Component	RNA polymerase II transcription regulator complex	IEA
GO:0090575	Component	RNA polymerase II transcription regulator complex	IMP	16946298
GO:0090575	Component	RNA polymerase II transcription regulator complex	IPI	8662591, 17676033
GO:0090575	Component	RNA polymerase II transcription regulator complex	NAS	24058793
GO:0090594	Process	Inflammatory response to wounding	IDA	27830702
GO:0097009	Process	Energy homeostasis	IEA
GO:0097009	Process	Energy homeostasis	ISS
GO:0097398	Process	Cellular response to interleukin-17	IEA
GO:0097696	Process	Cell surface receptor signaling pathway via STAT	IMP	25596740
GO:0098685	Component	Schaffer collateral - CA1 synapse	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0099527	Process	Postsynapse to nucleus signaling pathway	IEA
GO:0106015	Process	Negative regulation of inflammatory response to wounding	IDA	27830702
GO:0106015	Process	Negative regulation of inflammatory response to wounding	IDA	27830702
GO:0106015	Process	Negative regulation of inflammatory response to wounding	IEA
GO:0106222	Function	LncRNA binding	IDA	24744378
GO:0140105	Process	Interleukin-10-mediated signaling pathway	IDA	7543512
GO:0140297	Function	DNA-binding transcription factor binding	IEA
GO:0140297	Function	DNA-binding transcription factor binding	IPI	15664994
GO:0140311	Function	Protein sequestering activity	IEA
GO:0140311	Function	Protein sequestering activity	ISS
GO:0140610	Function	RNA sequestering activity	IDA	31507089
GO:1900016	Process	Negative regulation of cytokine production involved in inflammatory response	IDA	16968406, 21606497
GO:1900016	Process	Negative regulation of cytokine production involved in inflammatory response	IEA
GO:1900016	Process	Negative regulation of cytokine production involved in inflammatory response	ISS
GO:1900017	Process	Positive regulation of cytokine production involved in inflammatory response	IDA	8654373
GO:1900017	Process	Positive regulation of cytokine production involved in inflammatory response	IGI	31886314
GO:1900037	Process	Regulation of cellular response to hypoxia	IEA
GO:1902728	Process	Positive regulation of growth factor dependent skeletal muscle satellite cell proliferation	IEA
GO:1902895	Process	Positive regulation of miRNA transcription	IDA	19390056, 23820254
GO:1902895	Process	Positive regulation of miRNA transcription	IEA
GO:1905564	Process	Positive regulation of vascular endothelial cell proliferation	IEA
GO:1905869	Process	Negative regulation of 3'-UTR-mediated mRNA stabilization	IDA	21606497
GO:2000635	Process	Negative regulation of primary miRNA processing	IMP	31507089
GO:2000737	Process	Negative regulation of stem cell differentiation	IEA
GO:2001171	Process	Positive regulation of ATP biosynthetic process	IEA
GO:2001223	Process	Negative regulation of neuron migration	IEA

MIM	HGNC	e!Ensembl
102582	11364	ENSG00000168610

P40763

Protein name

Signal transducer and activator of transcription 3 (Acute-phase response factor)

Protein function

Signal transducer and transcription activator that mediates cellular responses to interleukins, KITLG/SCF, LEP and other growth factors (PubMed:10688651, PubMed:12359225, PubMed:12873986, PubMed:15194700, PubMed:15653507, PubMed:16285960, PubMed

PDB

5AX3 , 5U5S , 6NJS , 6NUQ , 6QHD , 6TLC

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02865	STAT_int	2 → 120	STAT protein, protein interaction domain	Domain
PF01017	STAT_alpha	141 → 313	STAT protein, all-alpha domain	Family
PF02864	STAT_bind	325 → 464	STAT protein, DNA binding domain	Domain
PF00017	SH2	584 → 674	SH2 domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. Expressed in naive CD4(+) T cells as well as T-helper Th17, Th1 and Th2 cells (PubMed:31899195). {ECO:0000269|PubMed:31899195}.

Sequence

MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNL
LGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAA
TAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLK
SQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEEL
ADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQ
HRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNY
QLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGN
GGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWY
NMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYS
GCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILST
KPPGTFLLRFSESSKEGGVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIM
DATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEADPGSAAPYLKTKFICVTPTTCSN
TIDLPMSPRTLDSLMQFGNNGEGAEPSAGGQFESLTFDMELTSECATSPM

Sequence length

770

Interactions

View interactions

102

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (6)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Hyper-IgE recurrent infection syndrome 1, autosomal dominant	Likely pathogenic; Pathogenic	rs2144697778, rs2081903545, rs2144683205, rs2144773624, rs1567708034, rs2144622906, rs2144832509, rs2144778323, rs2144622987, rs2144683531, rs2144827923, rs2144683683, rs2509391311, rs2144691401, rs2509118228 View all (38 more)	RCV001594427 RCV001343329 RCV001378695 RCV001378195 RCV001380075 View all (55 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Hyper-IgE syndrome	Likely pathogenic; Pathogenic	rs886039434, rs113994139	RCV000586892 RCV000587895	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Inherited Immunodeficiency Diseases	Pathogenic; Likely pathogenic	rs113994136, rs1064794957	RCV001027632 RCV001027630	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
STAT3 gain of function	Pathogenic; Likely pathogenic	rs2081903545, rs2144683205, rs2144773624, rs1567708034, rs2144832509, rs2144778323, rs2144622987, rs2144683531, rs2144827923, rs2509118228, rs113994139, rs2144683812, rs2144691170, rs2144691319, rs2144682791 View all (25 more)	RCV001343329 RCV001378695 RCV001378195 RCV001380075 RCV001995210 View all (40 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
STAT3-related disorder	Likely pathogenic; Pathogenic	rs869312888, rs2509390675, rs1064794957	RCV004545762 RCV003418921 RCV003401539	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
STAT3-related early-onset multisystem autoimmune disease	Pathogenic; Likely pathogenic	rs587777648, rs587777649, rs587777650, rs869312892, rs869312894, rs869312889, rs869312888, rs869312893, rs869312891, rs869312887, rs869312890, rs113994135, rs113994137, rs1064794957, rs193922717, rs2081520204, rs2081712040 View all (2 more)	RCV000133537 RCV000133538 RCV000133539 RCV000210415 RCV000210433 View all (13 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (96)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Adenoid cystic carcinoma	-	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ALZHEIMERS DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANKYLOSING SPONDYLITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANKYLOSING SPONDYLITIS AND OTHER INFLAMMATORY SPONDYLOPATHIES	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS, JUVENILE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS, PSORIATIC	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATHEROSCLEROSIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ECZEMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATROPHY	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE DISEASE, MULTISYSTEM, INFANTILE-ONSET, 1	—	CTD, Disgenet, HPO CTD, Disgenet, HPO CTD, Disgenet, HPO	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE DISEASES	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOSOMAL DOMINANT HYPER-IGE SYNDROME DUE TO STAT3 DEFICIENCY	—	Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BEHCET SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST IMPLANT-ASSOCIATED ANAPLASTIC LARGE CELL LYMPHOMA	—	Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, NON-SMALL-CELL LUNG	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, SQUAMOUS CELL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMEGALY	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHIES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Likely benign; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC LEFT-SIDED ULCERATIVE COLITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC LYMPHOPROLIFERATIVE DISORDER OF NATURAL KILLER CELLS	—	Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLITIS, ULCERATIVE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLONIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGESTIVE HEART FAILURE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COPPER-OVERLOAD CIRRHOSIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHNS DISEASE OF LARGE BOWEL	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DESBUQUOIS SYNDROME	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, INSULIN-DEPENDENT	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, PERMANENT NEONATAL	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, TYPE 1	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EBV-Positive Inflammatory Follicular Dendritic Cell Sarcoma	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EBV-positive nodal T- and NK-cell lymphoma	Conflicting classifications of pathogenicity; Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATITIS, CHRONIC	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPER-IGE RECURRENT INFECTION SYNDROME, AUTOSOMAL DOMINANT	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPER-IGE SYNDROME 1, AUTOSOMAL DOMINANT, WITH RECURRENT INFECTIONS	—	HPO	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPER-IMMUNOGLOBULIN E SYNDROME, AUTOSOMAL DOMINANT	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IDIOPATHIC PULMONARY FIBROSIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ISOLATED PERMANENT NEONATAL DIABETES MELLITUS	—	Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
JUVENILE CHRONIC POLYARTHRITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA, MYELOID, ACUTE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA, T-CELL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA-LYMPHOMA, ADULT T-CELL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER NEOPLASMS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LYMPHATIC METASTASIS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LYMPHOPROLIFERATIVE SYNDROME 1	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Conflicting classifications of pathogenicity; Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MEDULLOBLASTOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MEMORY DISORDERS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MONOARTICULAR JUVENILE RHEUMATOID ARTHRITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neoplasm	Uncertain significance; Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OROPHARYNX CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PAUCIARTICULAR JUVENILE RHEUMATOID ARTHRITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY CARDIOMYOPATHY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PULMONARY FIBROSIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCLEROSING CHOLANGITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL CARCINOMA OF HEAD AND NECK	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma of the head and neck	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STOMACH NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC SCLERODERMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URINARY BLADDER NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UTERINE CERVICAL NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (1130)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Actinic keratosis	Actinic keratosis	BEFREE	27457246		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	25572535		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	BEFREE	11843291, 16598306, 19482615, 20667821, 22581828, 27086927		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	LHGDN	11843291		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	25281507, 9498707		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	28861713		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Megakaryocytic Leukemias	Megakaryocytic Leukemia	BEFREE	28499590		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	29296780, 31406210		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Myeloid Leukemia (AML-M2)	Leukemia	CTD_human_DG	19796711		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Myeloid Leukemia, M1	Myeloid Leukemia	CTD_human_DG	19796711		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	21509626, 28810635, 29193197, 29328945, 31298391, 31606729, 31726046		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	11929748, 12506013, 16598306		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	ORPHANET_DG	29237593		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute promyelocytic leukemia	Promyelocytic Leukemia	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	12438264, 15923602, 17493236, 18614255, 20797623, 21390188, 21920464, 22208386, 22834702, 23613996, 23912451, 26432044, 26744530, 28880787, 28937296		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	16685378, 17203226, 18060032, 18695911		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	CTD_human_DG	19028472, 26432044		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	17875759, 24117650, 29890775, 31085800		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	BEFREE	18695911, 26663388		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	18060032, 18614255, 20032397, 21122157, 21684622, 22208386, 25734337, 27846317, 27893707, 27922075, 28115165, 28608828, 28739485, 28879441, 29119966 View all (11 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	22082308		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	25261365		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Basal Cell	Adenocarcinoma	CTD_human_DG	19028472, 26432044		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Endometrioid	Endometrial Cancer	BEFREE	28937296		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Oxyphilic	Adenocarcinoma	CTD_human_DG	19028472, 26432044		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Tubular	Adenocarcinoma	CTD_human_DG	19028472, 26432044		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoid Cystic Carcinoma	Adenocarcinoma	BEFREE	31273546		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Adenoma	Adenoma	BEFREE	18695911, 25774503, 26867566		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	10717531, 28130546		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	25762644		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenocortical carcinoma	Adrenocortical carcinoma	BEFREE	30125658		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	BEFREE	12547716, 16098628, 21284667		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	Pubtator	40004040	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	18160665, 18755494, 20859667, 21521803, 23841503, 23861822, 23872306, 25124685, 25984943, 26565811, 27268052, 29022919, 29295936, 30209121, 30458835, 30639963 View all (1 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	11781246, 15912144, 26811457		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	18592012, 18829483, 21161674, 21526200, 22206672, 25313399, 27775079, 28035977, 28159923, 29207075, 29280516, 30332965, 31683879		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	CTD_human_DG	19001435		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	16012947, 24090995, 28910419, 31237072		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	CTD_human_DG	24090995		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult type dermatomyositis	Dermatomyositis	BEFREE	27803134		★★★★★ ★☆☆☆☆ Found in Text Mining only
Agammaglobulinemia	Agammaglobulinemia	Pubtator	25349174, 31068927, 33519826, 34875609	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	17525280		★★★★★ ★☆☆☆☆ Found in Text Mining only
Age-Related Memory Disorders	Age-Related Memory Disorders	CTD_human_DG	17928813		★★★★★ ★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	26790448		★★★★★ ★☆☆☆☆ Found in Text Mining only
ALK positive large B-cell lymphoma	B-cell Lymphoma	BEFREE	23588372		★★★★★ ★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	28586019		★★★★★ ★☆☆☆☆ Found in Text Mining only
Allergic sensitization	Allergic Sensitization	BEFREE	26453584		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alport Syndrome	Alport Syndrome	BEFREE	28992339		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alveolar capillary dysplasia	Alveolar capillary dysplasia	BEFREE	31199666		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alveolitis, Fibrosing	Alveolitis	CTD_human_DG	30658076		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	28803389, 29848990, 30185668, 31346092, 32580970, 34804058	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	29907690	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	34837964	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	BEFREE	28699252		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amnesia	Amnesia	BEFREE	18813209, 25500624		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis cutis dyschromia	Amyloidosis Cutis Dyschromia	BEFREE	27236299, 31087583		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	19925559, 28715117, 30050118		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic astrocytoma	Anaplastic Astrocytoma	BEFREE	17146292		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic carcinoma	Anaplastic Carcinoma	CTD_human_DG	16316942		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic carcinoma	Anaplastic Carcinoma	BEFREE	18498667		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic Large Cell Lymphoma, ALK-Positive	Anaplastic Lymphoma	BEFREE	15184887, 19608866, 20971814, 23975180, 25921060		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	19825993, 22328572, 29251329, 29561707		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	24828862, 28370178		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia Aplastic	Aplastic anemia	Pubtator	23926297, 25359994, 33586472, 33785863	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia Hemolytic	Hemolytic anemia	Pubtator	33519826	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia Hemolytic Autoimmune	Autoimmune hemolytic anemia	Pubtator	33519826	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aneurysm	Aneurysm	Pubtator	21494893	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Angina Stable	Angina pectoris	Pubtator	19204206	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	20627814, 21068102, 21152001, 22213179, 27458846, 29044146, 29880011, 30075733, 30463609		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ankylosing spondylitis	Ankylosing Spondylitis	GWASCAT_DG	26974007		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anodontia	Anodontia	Pubtator	39778225	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	21481788, 24025152, 24164699, 26255562, 27089513, 27496707, 28214673, 28386018, 28611107, 28619758, 28677798, 30031610, 30046904, 30154150, 30311406, 31076405, 31395607 View all (2 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anophthalmia with pulmonary hypoplasia	Anophthalmia	Pubtator	23094050	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anorexia	Anorexia	BEFREE	19808018		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anorexia	Anorexia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Anorexia Nervosa	Anorexia nervosa	Pubtator	35703085	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	28336920, 30447911		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	28336920, 30447911		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic Aneurysm	BEFREE	22084479, 29152065		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	21764069, 31868202	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	26299839, 28982723, 29499360		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic valve calcification	Aortic valve calcification	BEFREE	29748157		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	23941877, 30470788, 31566578		★★★★★ ★☆☆☆☆ Found in Text Mining only
Apert syndrome	Apert Syndrome	BEFREE	23726368		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	26790448		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aplastic Anemia	Aplastic anemia	BEFREE	23926297, 25359994, 29330562, 31287345		★★★★★ ★☆☆☆☆ Found in Text Mining only
Apraxias	Apraxia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	17726017, 20727521, 21494893, 23564081, 26159489, 28258089, 28700834, 29136944, 29518604, 30475996, 31588227, 31612866, 31819365		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	19109195, 20188418, 21937456, 24223854, 27717524, 28583713, 28634854, 28887478, 29501867, 30496633, 30562763, 31355296		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	22802946, 28634854, 37771106	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Experimental	Experimental arthritis	Pubtator	37771106	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	29848367, 31641939	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	16622521, 28052368, 35087513	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	15535835, 22532634, 22736089, 22736176, 23308194, 23421940, 24082147, 24708416, 25164131, 25430993, 25436214, 25649145, 25880754, 26308397, 27629845 View all (26 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	35706043	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	23127549, 29148410		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Arthrogryposis	Arthrogryposis multiplex congenita	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	15935090, 18799889, 18841165, 21624746, 28295786, 28635548, 28980924, 29242170, 29268192, 30154893, 30848574, 31115390, 31565031, 31780948		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	LHGDN	15935090		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	15935090, 18310224, 20093796, 30864351, 32308108, 32512817, 40594490	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	GWASDB_DG	21150878		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	28295786, 39326916	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	13678425, 15064729, 20888416, 23619925, 24386409, 25246098, 27402815, 28035384		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	13678425, 19088040, 22231733, 24386409, 25246098, 33448156, 34169995	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	20052595	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia Telangiectasia	LHGDN	12562765		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	22859607, 31958078, 37126127, 40309770	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	17726017, 20727521, 21494893, 23564081, 26159489, 28258089, 28700834, 29136944, 29518604, 30475996, 31588227, 31612866, 31819365		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	CTD_human_DG	19330073		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	Pubtator	21494893, 32626987	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial Fibrillation	Atrial Fibrillation	LHGDN	18172037		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	28871329, 30953354, 31591913		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	35003319	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial myxoma familial	Atrial myxoma	Pubtator	37452081	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	31299319		★★★★★ ★☆☆☆☆ Found in Text Mining only
AUTOIMMUNE DISEASE, MULTISYSTEM, INFANTILE-ONSET, 1	Autoimmune Diseases	UNIPROT_DG	25038750, 28073828		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE DISEASE, MULTISYSTEM, INFANTILE-ONSET, 1	Autoimmune Diseases	GENOMICS_ENGLAND_DG	25038750, 25359994		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE DISEASE, MULTISYSTEM, INFANTILE-ONSET, 1	Autoimmune Diseases	ORPHANET_DG	25038750		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE DISEASE, MULTISYSTEM, INFANTILE-ONSET, 1	Autoimmune Diseases	CLINVAR_DG	25359994		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE DISEASE, MULTISYSTEM, INFANTILE-ONSET, 1	Autoimmune Diseases	CTD_human_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Diseases	Autoimmune disease	Pubtator	16331268, 20159113, 25038750, 25349174, 25359994, 26343524, 29378236, 30337298, 30886421, 30942636, 34654687, 34875609, 35188103, 35677041, 35810312, 36544766, 38184662, 40243893 View all (3 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Diseases	Autoimmune Diseases	BEFREE	20159113, 22205606, 23052245, 23127549, 23143594, 23611997, 24223854, 24460100, 24512550, 25038750, 25349174, 25359994, 26280891, 26574998, 27715403 View all (19 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Diseases	Autoimmune Diseases	CTD_human_DG	25038750		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune hemolytic anemia	Autoimmune hemolytic anemia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Lymphoproliferative Syndrome	Autoimmune Lymphoproliferative Disorder	BEFREE	25174872, 28579554		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Lymphoproliferative Syndrome	Autoimmune lymphoproliferative disorder	Pubtator	25174872, 34183838, 34721429, 34875609, 35058929	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autosomal dominant hyper-IgE syndrome	Hyper-IgE Syndrome	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
Avellino corneal dystrophy	Avellino Corneal Dystrophy	BEFREE	27236299, 31087583		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	10896772, 18024124, 21418178, 22728650, 22951829, 23599149, 23872306, 24888992, 26983850, 27282353, 27436361, 27484919, 27792904, 28599489, 28617558 View all (25 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	LHGDN	17951530, 18024124, 18160665, 18755494		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	15041721, 17875759, 24117650, 29991802		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	21127259, 21148399, 22744336, 29991802	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Basal cell carcinoma	Carcinoma	LHGDN	18547788		★★★★★ ★☆☆☆☆ Found in Text Mining only
Behavioral tic	Tourette syndrome	BEFREE	28504577		★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	22205606, 23127549, 24428981, 25410656, 29096751		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Behcet Syndrome	Behcet disease	Pubtator	25410656, 27922688	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Benign Neoplasm	Benign Neoplasm	BEFREE	26061266		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	28938626, 29156772, 31412319		★★★★★ ★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary Atresia	BEFREE	25450715		★★★★★ ★☆☆☆☆ Found in Text Mining only
Biliary cirrhosis	Biliary cirrhosis	LHGDN	12547716		★★★★★ ★☆☆☆☆ Found in Text Mining only
Biliary Tract Cancer	Biliary Tract Cancer	BEFREE	28282502		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	LHGDN	18448488, 18939995		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	20106947, 22825581, 23526079, 24519067, 25684140, 27322953, 28418913, 28849140, 29190807, 30132983, 30344738, 30365074, 30511377, 30808674, 30999937, 31176734, 31289569, 31438567 View all (3 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blister	Blister	Pubtator	23623265	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	16331882, 22802946	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone Disease	BEFREE	29158557		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Diseases Metabolic	Bone disease	Pubtator	26390436, 36605204	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Marrow Failure Disorders	Bone marrow failure syndromes	Pubtator	23926297, 30337298	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brachydactyly Type D	Brachydactyly	Pubtator	28504607	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	35461327, 36329890	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Edema	Brain edema	Pubtator	25337261	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Cerebral Ischemia	CTD_human_DG	17901229		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Ischemia	Brain ischemia	Pubtator	23666460	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Ischemia	Cerebral Ischemia	BEFREE	29401578		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Neoplasms	Brain Neoplasms	BEFREE	18258752, 18524891, 20589525, 23262510, 25246098, 25968456, 27110918, 28030813		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	25246098, 26283544, 35732500, 36780531	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast adenocarcinoma	Breast Adenocarcinoma	BEFREE	17920763, 29208488		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11006034, 11753675, 11809683, 14715258, 15064716, 15378007, 15466183, 15781862, 15923602, 15958548, 16288304, 16397018, 16510571, 16546976, 16696944 View all (183 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	14975756		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	11113455, 11859072, 15781862, 16288304, 16710719, 16877361, 17344214, 17531096, 17597020, 17922140, 19372587, 19491198, 20164027, 20830236, 20929863 View all (119 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	21325207, 23938089, 28099147, 38441231	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms Male	Male breast neoplasms	Pubtator	30850364	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brittle diabetes	Brittle diabetes mellitus	CTD_human_DG	25038750		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchiectasis	Bronchiectasis	BEFREE	18978467		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchiectasis	Bronchiectasis	Pubtator	31068927, 36605204	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchiolitis	Bronchiolitis	Pubtator	31780735	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchiolitis	Bronchiolitis	Pubtator	33804639	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	29581793		★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	20080768, 22967991, 28278714, 28483518, 30194286		★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	22967991, 25717101, 30194286	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Byzanthine arch palate	High palate	BEFREE	19036057		★★★★★ ★☆☆☆☆ Found in Text Mining only
Byzanthine arch palate	High palate	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Cakut	Congenital anomalies of the kidney and urinary tract	Pubtator	39734345	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Calcinosis	Calcinosis	Pubtator	31461977, 33173427	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Calcium Metabolism Disorders	Calcium metabolism disorders	Pubtator	30024306	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
CAMPOMELIC DYSPLASIA	Campomelic Dysplasia	BEFREE	28166224		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cancer of Digestive System	Gastric Cancer	BEFREE	26024373		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cancer of Nasopharynx	Nasopharyngeal Cancer	BEFREE	19588483, 28949390		★★★★★ ★☆☆☆☆ Found in Text Mining only
Capillary malformation (disorder)	Capillary malformation	BEFREE	25880788, 26154078, 26255980		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	11819729, 12015764, 15184909, 16049285, 16170336, 17360477, 17438134, 17438334, 20012909, 20068065, 20977777, 21174186, 21538419, 21575192, 21690253 View all (65 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	15781862, 19658181	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	15688010, 16648865, 17460772, 18614255, 18758380, 19724924, 22208386, 24573038, 29290793, 31198634		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma	Carcinoma	CTD_human_DG	16316942		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma	Carcinoma	Pubtator	36509291	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma Adenoid Cystic	Adenoid cystic carcinoma	Pubtator	26367487, 26790448	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	12445202, 15610530, 31342143, 31870221	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	35552660	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal Breast	Ductal carcinoma of breast	Pubtator	29137038	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	28937296	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	11257503, 15354212, 16901975, 18651980, 19140229, 20712901, 21198544, 22408571, 23391762, 23533997, 23620780, 23756865, 24376686, 24912675, 24980149 View all (93 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	28732507	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	29133756, 29556041	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma in Situ	Carcinoma in situ	Pubtator	32281236	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	26146825	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Large Cell	Large cell carcinoma	Pubtator	24382554	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Merkel Cell	Merkel cell carcinoma	Pubtator	27592799	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Mucoepidermoid	Mucoepidermoid carcinoma	Pubtator	26790448	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Mucoepidermoid	Mucoepidermoid carcinoma	Pubtator	29363716	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	20106947, 22825581, 23526079, 24448750, 24519067, 25684140, 27322953, 28418913, 28849140, 29190807, 29702481, 30132983, 30344738, 30365074, 30511377 View all (6 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	15715937, 18758380, 19148533, 25605256, 27289429, 28878571, 29913153, 31630150		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	16872715, 17348819, 17487394, 17683579, 17875688, 18043125, 18347147, 18614255, 18927282, 19569236, 19578748, 19903771, 21216930, 21333372, 21415216 View all (87 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	20860602, 26264211, 26657115, 26801672, 27825119, 28560454, 28859117, 32239647, 36814597	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	18254976, 24520077, 28121485, 31533831, 34771150, 36495330, 39684873	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	18787400, 19574718, 22899991, 24606948, 24615012, 25031744, 25388155, 26797799, 27089226, 27223432, 27712594, 28453463, 29286132, 31636361, 32640276 View all (11 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Small Cell	Small cell carcinoma	Pubtator	22938476	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	17110342, 28972958	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	19070595, 19616333, 19638983, 20228845, 20682796, 23959540, 24191246, 24382554, 25573684, 25854367, 27457246, 28423512, 32161621, 32281236, 32483193, 34195851, 36005200 View all (2 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	24833526	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Transitional Cell	Transitional cell carcinoma	Pubtator	26156799	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	12445202, 15610530, 16043897, 30291846, 30917918, 31323143, 31342143		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Cribriform	Carcinoma	CTD_human_DG	19028472, 26432044		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Granular Cell	Carcinoma	CTD_human_DG	19028472, 26432044		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	11006034, 16951221, 17063503, 18535750, 18587580, 22280969, 22801507, 23536726, 23604529, 23828376, 23962558, 23969971, 24590057, 24799285, 25319391 View all (27 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Pancreatic Ductal	Pancreatic Ductal Carcinoma	BEFREE	24164699, 31533831		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Spindle-Cell	Carcinoma	CTD_human_DG	16316942		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	CTD_human_DG	10618415, 24448315		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathies	Cardiomyopathy	LHGDN	17289576		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathies	Cardiomyopathy	BEFREE	28201733, 30899391, 31277074		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathies	Cardiomyopathy	Pubtator	39294340	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathies, Primary	Cardiomyopathy	CTD_human_DG	10618415, 24448315		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Hypertrophic	Hypertrophic cardiomyopathy	Pubtator	30338905, 33558530	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	BEFREE	23460527		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	21948258, 30662576, 31002169, 31277074		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	16807407, 29501586, 30283459, 31316179, 31550236		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	LHGDN	16807407		★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	22785229, 26859134	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Hemorrhage	Cerebral hemorrhage	Pubtator	37552127	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	28852395, 30632310, 30657573, 30906474, 30969244, 31218587		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	32960689	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Small Vessel Diseases	Cerebral Microangiopathy	BEFREE	29257241		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	28923114, 29867513, 29869055, 30585358, 31733648		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	17311011, 19421717, 19642906, 20977777, 21668356, 23874455, 25539644, 25921106, 26389681, 26432044, 27599897, 28122338, 28455960, 29655523, 30024597 View all (4 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
cervical cancer	Cervical Cancer	CTD_human_DG	25061499		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	21199798		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	19421717, 20977777, 21668356, 22252296, 23874455, 24806843, 25539644, 25921106, 26389681, 26432044, 26563366, 27599897, 28122338, 28455960, 28781654 View all (6 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cheilitis	Cheilitis	LHGDN	17640230		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	31054507		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Myeloid Leukemia	Acute Myeloid Leukemia	BEFREE	29296780		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	18592012, 18829483, 21161674, 21526200, 22206672, 25313399, 27775079, 28035977, 28159923, 29207075, 29280516, 30332965, 31683879		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	CTD_human_DG	19001435		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	16317687, 17241887, 22875246, 23007731, 25239565, 25344679, 26908056, 27107220, 27221911, 28566619, 29794468		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	16790433, 17241887, 23295441, 24998588, 26296968, 26743134, 27206490, 30880773, 32252311, 33038372, 34697068, 34758510, 34837926, 35683032, 35790790	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Cholangiocarcinoma	LHGDN	17241887		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	28032598	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangitis Sclerosing	Sclerosing cholangitis	Pubtator	37256725	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangitis, Sclerosing	Cholangitis	GWASCAT_DG	26974007		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholelithiasis	Cholecystolithiasis	Pubtator	40536380	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholelithiasis	Pubtator	34737337	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholesteatoma	Cholesteatoma	BEFREE	19672202, 24321752		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholesteatoma	Cholesteatoma	Pubtator	19672202, 24551293	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholesteatoma Middle Ear	Middle ear cholesteatoma	Pubtator	24551293	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	27576314, 28182000, 30790501, 31813289		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	Pubtator	30790501	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	BEFREE	17376509		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	Pubtator	39393273	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	14672334, 16125646, 16257052, 18752497, 29215740		★★★★★ ★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	LHGDN	14672334, 16125646		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chromosome 11p11.2 Deletion Syndrome	11p11.2 Deletion Syndrome	BEFREE	30150979		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	17376889, 24082147	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic eosinophilic leukemia	Eosinophilic Leukemia	BEFREE	22523564		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	31131063		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	18941194, 20154216, 20686606, 21364020, 21733558, 23725032, 23750211, 24836891, 24883303, 25299776, 26158860, 27074565, 27341356, 27890932, 27932296 View all (13 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic lymphoproliferative disorder of natural killer cells	Lymphoproliferative Disorder Of Natural Killer Cells	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Lymphoproliferative Disorder of NK-Cells	Lymphoproliferative Disorder Of Natural Killer Cells	BEFREE	25281507, 29417693, 30859397		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphoproliferative Disorder of NK-Cells	Lymphoproliferative Disorder Of Natural Killer Cells	ORPHANET_DG	29385279		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	23386690, 25150294, 25572172		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	18614255, 22088970, 22268122, 23877858, 27197187, 29233151, 29326759, 29454913, 30575930		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic otitis media	Otitis media	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Pain	Chronic pain	Pubtator	32717400	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic rhinosinusitis with nasal polyps	Rhinosinusitis With Nasal Polyps	BEFREE	24157808		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	16098628, 28401002, 28533225, 29133756, 31547152		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	CTD_human_DG	24448315		★★★★★ ★☆☆☆☆ Found in Text Mining only
Clear cell adenocarcinoma of ovary	Ovarian adenocarcinoma	BEFREE	21343371		★★★★★ ★☆☆☆☆ Found in Text Mining only
Clear-cell metastatic renal cell carcinoma	Renal Carcinoma	BEFREE	26833481, 30863721, 31295461		★★★★★ ★☆☆☆☆ Found in Text Mining only
Clumsiness - motor delay	Motor delay	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	29257241		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	16012947, 19185844, 19701202, 20956091, 21519361, 22962574, 24637240, 24651526, 25593461, 26848037, 27524110, 27548324, 27709266, 28160571, 28504577 View all (13 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	Pubtator	22021169	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	21530736, 22467146, 24781989, 27852544, 30369485, 31918598, 35946880	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	36857861	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	16012947, 16036105, 16192633, 17297444, 18200666, 19476491, 19492417, 20830487, 21423208, 21486470, 21741923, 21900397, 21994466, 22121102, 22412142 View all (35 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Diseases	Colonic disease	Pubtator	35655107	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	10570189, 16049285, 16192633, 17438334, 19476491, 21486470, 22423663, 25110240, 27573444, 30679726	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colonic Neoplasms	Colonic Neoplasms	LHGDN	18200666, 19020709		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colonic Neoplasms	Colonic Neoplasms	CTD_human_DG	19028472		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colonic Neoplasms	Colonic Neoplasms	BEFREE	21741923, 27175800, 29432737, 30655751		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Carcinoma	Colorectal Cancer	BEFREE	16036105, 17264243, 17460772, 19341726, 20830487, 21410405, 21472135, 21900397, 22030865, 22050790, 22121102, 22205702, 22754353, 23291612, 23416975 View all (96 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	15162527, 15665295, 16036105, 17460772, 18320073		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	15162527, 16192633, 16455651, 17264243, 17360477, 17922140, 18200666, 18320073, 20065946, 20196786, 20534983, 20712901, 20970032, 21486470, 21994466 View all (98 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	16036105, 28780076, 31534132		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	21310826, 24116229	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	32486001	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common Variable Immunodeficiency	BEFREE	27919819, 29180260, 30145329		★★★★★ ★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common variable immunodeficiency	Pubtator	32047491, 34875609, 35990641	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Complement Component 6 Deficiency	Complement component deficiency	Pubtator	23907460	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Complete atrioventricular block	Complete Atrioventricular Block	BEFREE	26163643, 26745093, 31132315		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cone-Rod Dystrophy 2	Cone-rod dystrophy	BEFREE	31773669		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Abnormalities	Congenital abnormalities	Pubtator	29378236	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital arteriovenous malformation	Congenital Arteriovenous Malformation	BEFREE	20127226		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital atresia of extrahepatic bile duct	Extrahepatic Biliary Atresia	BEFREE	25450715		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	25296734, 25744243, 26455324, 26743134, 29794468		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital diaphragmatic hernia	Congenital diaphragmatic hernia	BEFREE	20727521, 29310117		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital diaphragmatic hernia	Congenital diaphragmatic hernia	CTD_human_DG	25812446		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital disorder of glycosylation type 1L	Congenital disorder of glycosylation	Pubtator	32207811	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Heart Defects	Congenital heart defects	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital heart disease	Congenital Heart Disease	BEFREE	21354254		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital hernia of foramen of Bochdalek	Posterolateral diaphragmatic hernia	CTD_human_DG	25812446		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital hernia of foramen of Morgagni	Morgagni diaphragmatic hernia	CTD_human_DG	25812446		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Hyperinsulinism	Congenital hyperinsulinism	Pubtator	29955086	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital hypoplasia of lung	Pulmonary hypoplasia	BEFREE	29310117		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital hypoplasia of pancreas	Pancreatic hypoplasia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital neurologic anomalies	Drachtman Weinblatt Sitarz syndrome	BEFREE	19190525		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Thrombotic Thrombocytopenic Purpura	Congenital Thrombotic Thrombocytopenic Purpura	BEFREE	29738371		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	11343970, 21056972, 25217633, 28201733, 28743805, 30378117, 30905241		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Connective Tissue Diseases	Connective tissue disease	Pubtator	21494893	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Connective Tissue Diseases	Connective Tissue Disease	BEFREE	27107963		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	12131365, 19244102, 20461084, 22736024, 22899991, 24390735, 24530290, 24593195, 24606948, 24615012, 24797723, 25388155, 26300443, 26797799, 27710896 View all (17 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Copper-Overload Cirrhosis	Copper-Overload Cirrhosis	CTD_human_DG	22879914		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Aneurysm	Coronary aneurysm	Pubtator	21494893	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	27596284, 28001439, 29398326		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	24736319, 26936111, 27596284, 33632325	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	26936111, 26966275, 27596284, 28985621, 29067980, 29398326		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	40184077	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	27596284, 29398326		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cortical cataract	Cortical cataract	BEFREE	28285690		★★★★★ ★☆☆☆☆ Found in Text Mining only
Craniocerebral Trauma	Craniocerebral trauma	Pubtator	27173233	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	31379870		★★★★★ ★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	18500230, 19592695, 19647622, 20109474, 20159113, 20200543, 20222910, 20615550, 20848455, 21152001, 21548950, 21631466, 22065112, 22197944, 22269120 View all (13 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	GWASDB_DG	18587394, 23266558		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	GWASCAT_DG	18587394, 23266558, 26192919, 26974007, 28067908		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	20159113, 21152001, 21548950, 22197944, 22467146, 23950992, 24885273, 26278503, 27852544, 29556615, 31191543, 31321245, 34749666, 37175705	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	21228771, 28729389	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	GENOMICS_ENGLAND_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Cushing Syndrome	Cushing syndrome	Pubtator	36316863	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cutaneous Mastocytosis	Cutaneous mastocytosis	BEFREE	30678730		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	20228845, 21876460, 29348670		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	21731057, 22069317, 36048831, 36480571	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	22069317, 27799352		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic kidney	Cystic Kidney Disease	BEFREE	28486600, 31773180		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystitis Interstitial	Interstitial cystitis	Pubtator	39399486	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Deafness Autosomal Recessive 53	Deafness	Pubtator	33925065	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Deep Vein Thrombosis	Thrombosis	BEFREE	29266445, 30300911		★★★★★ ★☆☆☆☆ Found in Text Mining only
deficiency of adenosine deaminase 2	Adenosine deaminase 2 deficiency	Pubtator	34721429	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	11748261, 12444174, 27789465, 28128866, 28975975, 29148410, 29736207, 30551507, 30583016, 30619261		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dejerine-Sottas Disease (disorder)	Charcot-Marie-Tooth disease	BEFREE	28400195		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	PSYGENET_DG	20410598		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	BEFREE	25760924, 28069387, 28480882, 31396300		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder	Major depressive disorder	Pubtator	32998701, 37745719	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis	Dermatitis	BEFREE	28081250, 29775616, 29949348, 30030006, 31167146, 31549795		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	27498343, 35651609, 37540585, 40713851	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic 1	Atopic dermatitis	Pubtator	27498343	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Allergic Contact	Dermatitis	BEFREE	27236299		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	20816194, 24184145, 26115905, 26453584, 27498343, 28081250, 30230040, 31269238		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	GWASCAT_DG	26482879		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatofibrosarcoma Protuberans	Dermatofibrosarcoma Protuberans	BEFREE	29792909		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	Pubtator	27803134	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Desmoplastic Medulloblastoma	Medulloblastoma	CTD_human_DG	19001435		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	23747931, 28114390, 28242305, 28683285, 28775125, 29115516, 29484371, 30266298, 31286987, 31583053, 31616516, 31848914		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	33890634	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	23747931, 26743134, 28114390, 28242305, 28683285, 28775125, 29115516, 29484371, 30266298, 31286987, 31583053, 31616516, 31848914		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	26743134	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	28402852, 29417186, 30478982, 33731004, 35504843, 36496541	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Transient Neonatal 1	Diabetes mellitus transient neonatal	Pubtator	28402852	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	25038750, 27629486, 31949260	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	23110196, 32041280, 33833859, 36037214, 37680885, 40080435	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	CTD_human_DG	25038750		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	27629486, 30006377, 30665954, 31277074, 31286987		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Ketosis-Prone	Diabetes Mellitus	CTD_human_DG	25038750		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	22522613, 23043161, 28842216, 29228585, 29398326, 30555566, 31524257, 31848914		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, PERMANENT NEONATAL	Diabetes Mellitus	ORPHANET_DG	28073828		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Sudden-Onset	Diabetes Mellitus	CTD_human_DG	25038750		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes, Autoimmune	Autoimmune Diabetes	CTD_human_DG	25038750		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Cardiomyopathies	Diabetic cardiomyopathy	BEFREE	31277074		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Cardiomyopathies	Diabetic cardiomyopathy	Pubtator	34418601, 34926700	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Foot	Diabetic foot	Pubtator	35394091	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	33279869	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	24608443, 28554737, 29291386, 30386303, 31665127, 31699972		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Neuralgia	Diabetic Neuralgia	BEFREE	30830585		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	27580405, 28395025, 30205382		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	33563844	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diarrhea	Diarrhea	Pubtator	28623282	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Differentiated Thyroid Gland Carcinoma	Thyroid Carcinoma	BEFREE	30711567		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse alveolar hemorrhage	Diffuse alveolar hemorrhage	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Intrinsic Pontine Glioma	Diffuse Intrinsic Pontine Glioma	BEFREE	30833574		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	17951530, 18160665, 18755494, 20534395, 20859667, 21521803, 22035756, 22116549, 22967991, 23364893, 23841503, 23861822, 23872306, 24220563, 24581222 View all (19 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dissection of aorta	Aortic dissection	BEFREE	28827891		★★★★★ ★☆☆☆☆ Found in Text Mining only
Disseminated Intravascular Coagulation	Disseminated Intravascular Coagulation	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	22050548		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry Eye Syndromes	BEFREE	31503282		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	BEFREE	28166224, 28253502		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Dysbiosis	Dysbiosis	Pubtator	30185668	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyskinesias	Dyskinesia	Pubtator	12454768	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	28316372	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dysplastic Nevus	Dysplastic Nevus	BEFREE	10072444, 18305569		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ectodermal Dysplasia	Ectodermal dysplasia	Pubtator	35341013	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ECTRODACTYLY, ECTODERMAL DYSPLASIA, AND CLEFT LIP/PALATE SYNDROME 1	Ectrodactyly	BEFREE	26374646		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	18978467, 19036057, 19190525, 20816194, 23584561, 24184145, 26115905, 26453584, 27498343, 27803128, 28081250, 30230040, 31069200, 31269238		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	Pubtator	33717144	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Elejalde Disease	Hereditary elliptocytosis	Pubtator	30403186	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	BEFREE	23971732, 31243136		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endocrine System Diseases	Endocrine system disease	Pubtator	36266450	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial adenocarcinoma	Endometrial Adenocarcinoma	BEFREE	25750101		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	17311011, 20668024, 23262208, 24287565, 25954856, 26130650, 28114390, 29608257, 30214592, 30257404, 30452972, 30922625		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial Hyperplasia	BEFREE	28925396		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	19154413, 28112250, 31298317, 34153644	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	23184927, 25516558, 25750101, 27226311, 29608257, 29871794, 30259980, 30940310		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	25950905, 33893391, 35279667	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	37095705	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	30315710		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Eosinophilia, Tropical	Eosinophilia	BEFREE	31565031		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eosinophilic Esophagitis	Eosinophilia	Pubtator	35126392, 37652141, 40243893	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ependymoma	Ependymoma	BEFREE	25968456		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epidermolysis bullosa with pyloric atresia	Epidermolysis bullosa	Pubtator	28709401	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	29247482, 31455240, 31571517		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	32016989, 36825472	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Episodic Kinesigenic Dyskinesia 1	Episodic Kinesigenic Dyskinesia	BEFREE	29513074, 31589480, 31773180		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	23828376, 23969971, 26264211, 26801672, 27172798, 27825119, 28859117, 29576612, 31778258		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	18602747, 22108192, 22847808, 24676538, 25928665, 27189061, 27896845, 29636641, 29880087, 29976575, 30774375, 31102664		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	18602747, 22108192, 22847808, 24676538, 25928665, 27189061, 29636641, 29976575, 30774375, 31102664		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	26553224, 34036398, 35264069, 35780460, 35856449, 36226375, 37500660	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	25355139, 25550842, 26370982, 26553224, 28459198, 29767234, 30468470, 31081089, 31298412, 32071920, 32374927, 33330321, 34218518, 34520294, 35428295, 37752569 View all (1 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	25295465		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	16463269, 23800680, 26902422		★★★★★ ★☆☆☆☆ Found in Text Mining only
Facial Dysmorphism with Multiple Malformations	Facial dysmorphism syndrome	Pubtator	33717144	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	CTD_human_DG	30481203		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial lichen amyloidosis	Lichen amyloidosis	BEFREE	15647107		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial medullary thyroid carcinoma	Medullary thyroid carcinoma	BEFREE	17209045		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial multiple trichoepitheliomata	Multiple Trichoepithelioma	BEFREE	31085800		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial Primary Pulmonary Hypertension	Pulmonary hypertension	Pubtator	17526595	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	23816536, 26976243, 29615085, 30206377, 31321478		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	29615085	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	28533225, 29735799, 30454647, 30523261, 30625307, 30935688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrinogen Deficiency	Fibrinogen Deficiency	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	16474852, 21622209, 23295202, 28154170, 28401002, 28754776, 29250925, 29887949, 30206312, 30346985, 30568253, 31547152, 31730896, 31776330		★★★★★ ★☆☆☆☆ Found in Text Mining only
Focal Cortical Dysplasia	Focal cortical dysplasia	Pubtator	29162878	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Frontal bossing	Frontal bossing	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Fuchs' Endothelial Dystrophy	Fuchs endothelial dystrophy	Pubtator	32636303	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	30086773, 30610554		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	28061445, 30086773	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	40536380	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gangrene	Gangrene	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	15682485, 22581828		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	BEFREE	17724739, 18431520, 24127267		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastritis Atrophic	Gastritis	Pubtator	27173233	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastritis, Atrophic	Gastritis	BEFREE	27173233, 30520693		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal disease	Pubtator	28803389	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	16461335		★★★★★ ★☆☆☆☆ Found in Text Mining only
GATA2 Deficiency	Gata2 deficiency	Pubtator	24350896, 25612622, 26727971, 28284718, 30054295, 31311407, 32321919	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Generalized myoclonic seizures	Myoclonic Seizures	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Gestational trophoblastic disease	Hydatidiform mole	BEFREE	18752497		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gestational Trophoblastic Neoplasms	Gestational Trophoblastic Neoplasms	BEFREE	18752497		★★★★★ ★☆☆☆☆ Found in Text Mining only
Giant Cell Fibroblastoma	Giant Cell Fibroblastoma	BEFREE	29792909		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gilles de la Tourette syndrome	Tourette Syndrome	BEFREE	31231976		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gingivitis	Gingivitis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	28416649		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	LHGDN	12466961, 18524891, 18676737		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	13678425, 15688401, 16007122, 17146292, 18258752, 18487947, 18524891, 18829483, 18839277, 19121577, 19601808, 19658181, 20072652, 20145033, 20199106 View all (83 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	13678425, 18487947, 18524891, 19658181, 20371721, 20488164, 20667896, 20712901, 21073634, 21385897, 21526200, 21906308, 22532597, 22709411, 23096132 View all (56 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	39487455	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	13678425, 15688401, 15805299, 16007122, 17146292, 18258752, 18487947, 18524891, 18829483, 18839277, 19121577, 19601808, 19658181, 20072652, 20145033 View all (93 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	15184909, 18415045, 18487947, 18829483, 19409983, 19414409, 20069389, 21590492, 21906308, 21953450, 22260960, 22349830, 22555804, 22630347, 22753228 View all (51 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	15184909, 16319070, 18487947, 19088040, 19658181, 21655185, 21900396, 21906308, 22843679, 22957741, 23907460, 23936533, 24048798, 24913705, 24945373 View all (36 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	18829483		★★★★★ ★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	LHGDN	18556750		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	Pubtator	33043579	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	33462083, 33874912, 34861820	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis Membranous	Membranous glomerulonephritis	Pubtator	35172688	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis Focal Segmental	Focal segmental glomerulosclerosis	Pubtator	36374911	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glucose Metabolism Disorders	Glucose Metabolism Disorders	BEFREE	31234024		★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	26327693	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	26555814, 30280423	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	22921119, 28694183, 29152660, 31195136		★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	24081513, 26204395		★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	24081513, 35008579	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	24081513, 35008579	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Growth Disorders	Growth disorder	Pubtator	16884491	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Growth Disorders	Growth disorder	Pubtator	25359994, 29378236, 33519826	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Growth Hormone-Secreting Pituitary Adenoma	Somatotroph Adenoma	BEFREE	25774503		★★★★★ ★☆☆☆☆ Found in Text Mining only
Guillain-Barre Syndrome	Guillain-Barre Syndrome	BEFREE	30196825		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hamartoma Syndrome, Multiple	Hamartoma	BEFREE	28285690		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hamman-Rich Disease	Diffuse interstitial pulmonary fibrosis	CTD_human_DG	30481203		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	20558345, 24081513, 32662826	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	24081513, 24460100, 26204395		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	10760290, 11927016, 12640143, 16503733, 16505101, 17401459, 19424608, 21177768, 22110204, 22194600, 22886660, 24395800, 25982282, 26267899, 27855189 View all (5 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	12454768, 12640143, 18316548, 24019973, 24395800, 26209830, 27181202, 27855189, 34850540	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head And Neck Neoplasms	LHGDN	12640143		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head And Neck Neoplasms	BEFREE	21976712		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	20022263, 25720718, 37018396	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	30619368		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	11343970, 21056972, 25217633, 28201733, 28743805, 30378117, 30905241		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Failure	Heart failure	Pubtator	25720718	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Failure	Heart failure	Pubtator	35645616, 37018396	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hemangioma	Hemangioma	BEFREE	29845747		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Diseases	Hematologic disease	Pubtator	24618699, 25359994, 33519826, 36544766	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	22319590, 23872306, 24388873, 26927669, 28208828, 28807562, 30217007, 31781335		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	22319590, 25912076, 28208828, 34874980	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematopoietic Neoplasms	Hematopoietic Neoplasms	BEFREE	19074878, 29417693, 29728695, 29914167, 31817042		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemoglobinopathies	Hemoglobinopathy	BEFREE	29389946		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatic Encephalopathy	Hepatic encephalopathy	Pubtator	26757951	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	23483208, 29207087, 29609539, 32228643	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B Chronic	Hepatitis b	Pubtator	26163643, 26745093, 29609539	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	15650183, 28159835, 33785040	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	22951829	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	32507013	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	31572006		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatocellular Adenoma	Hepatocellular adenoma	BEFREE	19020503, 21690253, 28506364		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	18587580, 21788134, 28159925, 30206415, 33331925, 33367520, 33660353	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Diffuse Gastric Cancer	Gastric Cancer	CTD_human_DG	23382965		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	11222718, 11781246, 15912144, 18275936, 26811457, 30371509		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	11222718, 11468177, 11781246, 12393683, 18684866, 21418178, 24633193, 29650799, 36751942	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	LHGDN	15912144, 18684866		★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	25430993, 29328442	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	25673868, 29328442, 31813126		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hydatidiform Mole	Hydatidiform Mole	BEFREE	18752497		★★★★★ ★☆☆☆☆ Found in Text Mining only
HYDATIDIFORM MOLE, RECURRENT, 1	Hydatidiform Mole	BEFREE	18752497		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyper-Immunoglobulin E Syndrome, Autosomal Dominant	STAT3 Deficiency	ORPHANET_DG	17676033, 17881745		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyper-Immunoglobulin E Syndrome, Autosomal Dominant	STAT3 Deficiency	BEFREE	18602572, 18835223, 18978467, 19109129, 19185844, 19190525, 20093388, 20149460, 20674321, 21178271, 21288777, 21792878, 21937456, 21970826, 22118528 View all (35 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyper-Immunoglobulin E Syndrome, Autosomal Dominant	STAT3 Deficiency	CTD_human_DG	25038750		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyper-Immunoglobulin E Syndrome, Autosomal Recessive	Hyper-Immunoglobulin E Syndrome	BEFREE	21970826, 27350570, 30279075, 30732127, 31596517		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyper-Immunoglobulin E Syndrome, Autosomal Recessive	Hyper-Immunoglobulin E Syndrome	CTD_human_DG	25038750		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	20727521		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypergammaglobulinemia	Hypergammaglobulinemia	BEFREE	21426892		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	28577871, 28713982, 29109360, 29115516, 29174036, 29615440, 30144531, 30899391, 30913399, 31097787, 31234024		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	33038372	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	19390493, 30664851		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	29630659, 37309689	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	30864351, 36473131	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	35676631	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	23114789, 28974499, 29800237, 30619368, 30958891, 31329047		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertriglyceridemia	Hypertriglyceridemia	Pubtator	25014397	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	30338905		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophy	Hypertrophy	Pubtator	16920889, 35406794	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperuricemia	Hyperuricemia	Pubtator	34716863	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypofibrinogenemia	Hypofibrinogenemia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypogammaglobulinemia	Hypogammaglobulinemia	BEFREE	30671054, 31068927		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypospadias	Hypospadias	BEFREE	30380353		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	BEFREE	30027933		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	19265129, 20153296, 21731766, 21911602, 23756865, 26078356, 32945388, 33029691	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	24002598, 27163161, 28257048, 29459227, 29518129, 29693186, 32345623, 33484391, 36082356, 36814597, 37752569	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	27558590, 33123602	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ichthyosis linearis circumflexa	Netherton syndrome	BEFREE	31785228		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ichthyosis, X-Linked	Ichthyosis	BEFREE	26909593		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic generalized epilepsy	Epilepsy	BEFREE	29907690, 30094507		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	21761156, 23525442, 28467929, 29358461		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	27317687, 29409529, 29696986, 29869625, 30481203, 30608861		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	CTD_human_DG	30481203		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	30481203	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Immune System Diseases	Immune System Diseases	BEFREE	22271514, 24223854, 26072408, 29378236, 30213685		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	22271514, 23704931, 29378236, 31707214, 34653276, 35058929, 35587532, 35655107, 37090709, 37325673, 40309770	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	BEFREE	29846275, 30224899		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	18841165, 24892807, 26280891, 28562253, 30188342, 30793327		★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	23399684, 24686449, 29257241		★★★★★ ★☆☆☆☆ Found in Text Mining only
Incontinentia Pigmenti Achromians	Incontinentia Pigmenti Achromians	BEFREE	30214252		★★★★★ ★☆☆☆☆ Found in Text Mining only
Infarction, Middle Cerebral Artery	Cerebral Infraction	CTD_human_DG	21940958		★★★★★ ★☆☆☆☆ Found in Text Mining only
Infertility Male	Male infertility	Pubtator	35810312	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	16474436, 18069684, 19068216, 19535621, 19817673, 20200543, 20627814, 21088407, 21530736, 21631466, 22197944, 24662057, 25132422, 26026060, 26232455 View all (17 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	18069684, 19068216, 21088407, 21530736, 22197944, 25132422, 26278503, 27852544, 28770550, 29182760, 29228965, 31732533, 36437465, 37600767	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	LHGDN	19068216		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	GWASCAT_DG	23128233, 26192919, 27569725, 28067908		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	GWASDB_DG	23128233		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Breast Carcinoma	Breast Cancer	BEFREE	28270211, 31043378		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	29775616, 29949348, 31167146, 31549795		★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	17636079, 17993646, 25747354, 29955086, 31396538	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Interleukin 2 Receptor Alpha Deficiency of	Interleukin 2 receptor deficiency	Pubtator	25359994	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	26587789, 36081453, 38041088, 40426248	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	27879577, 31652254		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal Diseases	BEFREE	25349174, 30942636		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial Aneurysm	BEFREE	29552131		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial aneurysm	Pubtator	32804311, 35833148	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	23295441, 28032598, 29805522, 31759251		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholestasis	Intrahepatic Cholestasis	BEFREE	27222070		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholestasis of Pregnancy	Intrahepatic cholestasis of pregnancy	Pubtator	35643225	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	29137038		★★★★★ ★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron Overload	BEFREE	28793778, 31628297, 31786468		★★★★★ ★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron overload	Pubtator	31628297	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	26254060, 28923114, 29130998, 29462606, 29867513, 29869055, 29890157, 29946982, 30593877, 31202798, 31517390, 31565154, 31793209		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	CTD_human_DG	19565504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile Myelomonocytic Leukemia	Myelomonocytic Leukemia	BEFREE	19509418		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile psoriatic arthritis	Juvenile arthritis	CTD_human_DG	19565504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile-Onset Still Disease	Still Disease	CTD_human_DG	19565504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kabuki syndrome	Kabuki syndrome	Pubtator	35058929	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	16364321, 17151100, 25681443, 26339061, 31801855		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ketonuria	Ketonuria	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	15117990, 15161657, 15184887, 15858125, 15920698, 18509351, 23975180, 24404580, 25873174, 28414323, 29346274, 30692217, 30715174, 31383967		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	LHGDN	15161657, 16825495		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	CTD_human_DG	22155737		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	LHGDN	18556750		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	23343908, 28992339, 30559339, 30943069, 30958891, 31699972		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	23573315, 34884542, 36640055, 39734345	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases Cystic	Kidney disease	Pubtator	23573315	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	29181415, 29846833, 31084615, 31131063, 31250048, 31719896, 31722339, 31787899		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	11849447, 29272308, 36246395, 39480959	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal neoplasm	Laryngeal neoplasm	BEFREE	24029664, 24607970		★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	25605256, 26318305, 27181202, 30893785, 31189744	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	17401459, 18758380, 19148533, 23437123, 26318305, 28693195, 31171714		★★★★★ ★☆☆☆☆ Found in Text Mining only
LATERAL MENINGOCELE SYNDROME	Lateral Meningocele Syndrome	BEFREE	22644781		★★★★★ ★☆☆☆☆ Found in Text Mining only
LAURIN-SANDROW SYNDROME	Laurin-Sandrow syndrome	BEFREE	27889106		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	35598777, 36771423	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leiomyosarcoma	Leiomyosarcoma	BEFREE	22644781		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	BEFREE	28327412		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lesion of Sciatic Nerve	Lesion Of Sciatic Nerve	BEFREE	30927067		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	11369651, 21756540, 21887305, 23515927, 25359994, 25383546, 27576506, 28596283, 31409670, 32252439, 32409689, 34967577, 9657745	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	15514005, 15580314, 19074878, 19796711, 21756540, 21840932, 22126101, 22376160, 23741012, 24705981, 26255115, 26297434, 26728704, 26796361, 27064362 View all (10 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	15837065, 19074878		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	GENOMICS_ENGLAND_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	18483256, 21677772, 31546234	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	23717691	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	10845908, 11756179, 17404111, 20035426, 21456022, 21756540, 23628554, 24283803, 24903009, 26466521, 31117333, 31406210, 31538427, 31842997, 32021103 View all (13 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	11027834	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	10622210	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Large Granular Lymphocytic	Lymphoblastic Leukemia	BEFREE	11160159, 22591296, 23596048, 24350896, 24512550, 24705981, 25281507, 27064362, 28633612, 29217783, 29228628, 31467122, 31585620, 31740810		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	10845908, 16598306, 18192010, 20881478, 21447830, 21756540, 22376160, 22493659, 23509157, 23628554, 24283803, 25139404, 25150294, 25374305, 26547689 View all (14 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	LHGDN	16828865		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	CTD_human_DG	19796711		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	14630083, 24090995, 31817042		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leukemia, T-Cell	T-cell leukemia	CTD_human_DG	19796711		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leukopenia	Leukopenia	BEFREE	22591296, 24283217, 31467122, 31585621		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
LIMB-MAMMARY SYNDROME	Limb-Mammary Syndrome	BEFREE	22644781		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	29251334, 29564744		★★★★★ ★☆☆☆☆ Found in Text Mining only
liposarcoma	Liposarcoma	BEFREE	29061812		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liposarcoma	Liposarcoma	Pubtator	30654529, 32998376, 35740967	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	14690454, 16285960, 16474852, 17145839, 17956865, 18059167, 18248786, 18263735, 18651980, 18843197, 19137011, 19140229, 19496189, 20227042, 20332458 View all (182 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	12547716, 16098628, 28401002, 28533225, 29133756, 29551899, 31547152		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	12547716, 17318196, 29133756, 37978263	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	LHGDN	17318196		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Alcoholic	Liver cirrhosis	Pubtator	12547716	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	25627620, 34737337	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis, Alcoholic	Alcoholic Liver Cirrhosis	LHGDN	12547716, 16098628		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	28159835, 29609539, 34737337	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Diseases Alcoholic	Liver disease	Pubtator	12547716	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	31534132, 33155205, 34235224, 40536380	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure, Acute	Liver failure	BEFREE	30694753		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	CTD_human_DG	12957465		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver neoplasms	Liver neoplasms	BEFREE	14690454, 21835143, 25063062, 25476160, 25892518, 26542749, 27553854, 27834930, 28334808, 29115974, 30158673, 30709346, 31831556, 7519723, 9647240		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Neoplasms	Liver neoplasm	Pubtator	24912675	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Localized scleroderma	Scleroderma	BEFREE	28393380		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	LHGDN	17078813		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	17526595, 29620631, 34875609, 36480571, 40462219	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	27799352, 30793327		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	GENOMICS_ENGLAND_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	31969166, 34875609, 35016744, 35677041, 37390899	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases, Interstitial	Lung Diseases	BEFREE	27803128		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	12833138, 16278387, 16959370		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung neoplasms	Pubtator	14617776, 16648865, 19578748, 19903771, 21122157, 21497567, 21546410, 22723956, 22904633, 23244248, 23704931, 23820254, 24280348, 24382554, 24657910 View all (27 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	BEFREE	17683579, 18461184, 25242236, 27197187, 29126425, 29233790, 29733528, 30849743, 31595832		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung neoplasms	Pubtator	31196220	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus	Lupus Erythematosus	BEFREE	25187566, 31177018, 31551033		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Cutaneous	Cutaneous lupus erythematosus	Pubtator	35258358	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	17364491	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	21635228, 25187566, 25339666, 26968426, 27351906, 28177455, 28940360, 30280423, 32768442, 35188103, 35592687, 38184662, 40594490	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	25187566, 31177018, 31551033		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	12123550, 17364491, 20976278, 21635228, 23305626, 25101889, 25187566, 27216430, 27351906, 30674728, 30767092, 31177018, 31551033		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	21635228	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	25339666, 26546590, 27825337, 28626343, 29885836, 30767092, 31551033		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	25339666	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	25187566, 31177018, 31551033		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphangioleiomyomatosis	Lymphangiomyomatosis	BEFREE	19596836		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	16049285, 19638983, 21072904, 23382965, 23824569, 23824571, 25337233, 25405202, 26323925, 28448787, 29970682, 32187953, 33663040, 34165442	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphatic Metastasis	Lymphatic Metastasis	CTD_human_DG	21549414		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	21577321, 27292026, 28032598, 29137038, 36225196	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	26323925, 28901486, 31375715		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphocytosis	Lymphocytosis	BEFREE	24828862		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoid leukemia	Lymphoid leukemia	BEFREE	28861713		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	11751994, 15161657, 17951530, 18024124, 19088198, 19421230, 20176801, 20859667, 21324546, 22116549, 23338972, 23588372, 24705981, 24891320, 25070240 View all (16 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	LHGDN	11751994, 15161657, 15895073, 18024124, 18483262, 19074878		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	18024124, 19088198, 21418178, 22116549, 23716548, 24581222, 25070240, 25586472, 26430964, 27564404, 28415725, 28496056, 29133756, 29228427, 29295936 View all (5 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	23297127	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Extranodal NK-T-Cell	Lymphoma	BEFREE	31822801		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	15561778		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	11781246, 20976278, 25070240, 29433938, 30446007		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	29433938, 30446007		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	11159537, 11807001, 12543077, 15618960, 18496567, 20393484, 22048239, 25485578, 26244872, 26789110, 29681389, 31213131		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphopenia	Lymphopenia	BEFREE	22084479		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative Disorder	BEFREE	22859607, 29228628, 29417693, 30715174, 31773249		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative syndrome	Pubtator	22859607, 25281507, 31558678, 33512451, 34875609, 36441748	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	25543336	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Macular dystrophy, corneal type 1	Macular corneal dystrophy	BEFREE	22490805		★★★★★ ★☆☆☆☆ Found in Text Mining only
Macular Edema, Cystoid	Cystoid macular edema	BEFREE	30942636		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	28802862		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Childhood Neoplasm	Malignant Neoplasm	BEFREE	16192633		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Fibrous Histiocytoma	Malignant Histiocytoma	BEFREE	27652596		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	17617738, 18829483, 22753228, 23619925, 24048798, 26297434, 27660268		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	10760290, 11927016, 12640143, 16503733, 16505101, 17401459, 21177768, 22110204, 22194600, 22886660, 24395800, 25982282, 26267899, 27855189, 29082496 View all (4 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	BEFREE	16048411, 24086494, 26116769, 30530749		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	17824789, 25124686, 30259640		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of brain	Brain Neoplasms	BEFREE	18258752, 29423040		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	11006034, 11753675, 11809683, 15378007, 15466183, 15781862, 15923602, 15958548, 16288304, 16397018, 16510571, 16546976, 16696944, 17121912, 17531096 View all (190 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	14975756		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	17311011, 23262208, 25954856, 26130650, 28114390, 29608257, 30214592, 30922625		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	18602747, 22108192, 22847808, 23912451, 24676538, 24953013, 25928665, 27189061, 27896845, 29636641, 29976575, 30774375, 31102664		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	30086773, 30610554		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	22350508, 23321674, 23948300, 28098855		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	23052245, 24158981		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of larynx	Larynx cancer	BEFREE	15715937, 25605256, 28878571, 29913153, 31630150		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	CTD_human_DG	12957465		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	19137011, 19321929, 20018552, 20227042, 24912675, 25063062, 25661370, 28187727, 28369327, 28430601, 28714512, 28810927, 29151958, 29495104, 29630108 View all (7 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	12833138, 16872715, 17348819, 17487394, 17683579, 17875688, 18043125, 18347147, 18614255, 18927282, 19569236, 19578748, 19903771, 20959490, 21216930 View all (90 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	29251334, 29564744		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of nasopharynx	Nasopharyngeal carcinoma	BEFREE	19588483, 28949390		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	11006034, 12061840, 16061651, 16951221, 17063503, 18535750, 18587580, 22280969, 22801507, 23536726, 23604529, 23828376, 23962558, 24590057, 24799285 View all (24 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	CTD_human_DG	21909139		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	12545153, 12949733, 14580692, 16546976, 17054436, 17459060, 18566225, 19176463, 19288493, 20067773, 20100905, 20197401, 20482858, 21174186, 21479358 View all (45 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	CTD_human_DG	22348037, 23845849		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	10639189, 10728680, 10786674, 11912448, 12082540, 12438264, 12606952, 14749471, 15264241, 15647107, 15688010, 16140113, 16144938, 16546976, 17438134 View all (73 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	14975756, 16427044, 25970160		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	20876801, 24460316, 26261078, 27819148, 28322331, 28639178		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	15746037, 17724739, 18431520, 20939893, 21072904, 21633597, 22104727, 22328012, 22469989, 22581828, 22834702, 23178499, 23322197, 23333463, 23382965 View all (53 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	CTD_human_DG	23382965		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	22328572, 22891351, 23941877, 24899100, 29687367, 30690057, 31171714		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	20106947, 22825581, 23526079, 24519067, 25684140, 27322953, 28418913, 28849140, 29190807, 30132983, 30344738, 30365074, 30511377, 30808674, 30864733 View all (4 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10760290, 11753675, 11867083, 11948098, 11960372, 12061840, 12082540, 12393476, 12438264, 12789269, 15064729, 15374974, 15378007, 15466183, 15469392 View all (488 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	25833823		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Squamous Cell Neoplasm	Neoplasm	BEFREE	27220595		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	19421717, 20977777, 21668356, 23874455, 25539644, 25921106, 26389681, 26432044, 27599897, 28122338, 28455960, 29655523, 30024597, 30246459, 31210293, 31226168, 31616177 View all (2 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	16036105, 16192633, 17297444, 18200666, 19492417, 21423208, 21741923, 21900397, 21994466, 22121102, 22412142, 22750444, 23911788, 25132422, 25166914 View all (29 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	CTD_human_DG	19028472		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	14975756		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	11809683, 12576423, 15064716, 16081048, 16377083, 16425286, 17344214, 17531096, 17888401, 17911267, 17920763, 18242580, 18768494		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	14975756		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	15374974, 15923602, 16288304, 16397018, 16505101, 16510571, 17463090, 17920763, 19491198, 19690134, 21895408, 22054049, 22140473, 22689141, 24297508 View all (12 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	14975756		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	16048411, 20606045, 22728650, 23432547, 24086494, 26116769, 27894215, 30530749		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mastocytosis	Mastocytosis	BEFREE	19383925		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meckel syndrome type 1	Meckel-gruber syndrome	Pubtator	32406563	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	15485908, 27620278		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	18592012, 18829483, 21161674, 21526200, 22206672, 25313399, 27775079, 28035977, 28159923, 29207075, 29280516, 30332965, 31683879		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Medulloblastoma	Medulloblastoma	LHGDN	18592012		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Medulloblastoma	Medulloblastoma	Pubtator	18592012, 21526200, 25313399, 28035977, 29207075, 33279931, 34254873, 35159191	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Medulloblastoma	Medulloblastoma	CTD_human_DG	19001435		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Medulloblastoma	Medulloblastoma	Pubtator	21193839	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Medulloblastoma	Medulloblastoma	Pubtator	29280516	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Medullomyoblastoma	Medullomyoblastoma	CTD_human_DG	19001435		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	10072444, 12370822, 12589944, 12789291, 15564140, 15778348, 18222423, 18305569, 19047140, 19823036, 19995546, 21876460, 21910007, 21912348, 22046235 View all (44 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	10072444, 11442760, 15564140, 16801397, 17384650, 18171991, 18305569, 18386001, 18596671, 19758315, 20576164, 21268068, 21853302, 21953023, 22046235 View all (33 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	12777975		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	37481560	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	18596671	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanotic medulloblastoma	Medulloblastoma	CTD_human_DG	19001435		★★★★★ ★☆☆☆☆ Found in Text Mining only
MELAS Syndrome	Melas syndrome	Pubtator	35715869	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Meleda Disease	Meleda Disease	BEFREE	21637744		★★★★★ ★☆☆☆☆ Found in Text Mining only
Memory Disorders	Memory Disorders	CTD_human_DG	17928813		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Memory dysfunction	Memory Disorders	BEFREE	30574980, 30781690		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	10470819, 19698046, 20052595, 21529178, 24188277, 28454415, 30710729		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	20052595	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	25760924, 28069387, 28480882, 31396300		★★★★★ ★☆☆☆☆ Found in Text Mining only
Merkel cell carcinoma	Merkel cell carcinoma	BEFREE	27592799		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	17824789, 25124686, 25868979, 29229551		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	LHGDN	17824789		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	17824789, 27987139, 30259640, 35794237	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	24223854, 25014397, 30555566		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	25014397, 38387703	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	19776189, 24358323	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	19776189, 26339633, 29067980, 29115033		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	28108732, 30131384		★★★★★ ★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	BEFREE	30578761		★★★★★ ★☆☆☆☆ Found in Text Mining only
Middle Cerebral Artery Thrombosis	Cerebral Thrombosis	CTD_human_DG	21940958		★★★★★ ★☆☆☆☆ Found in Text Mining only
Miller Dieker syndrome	Miller Dieker Syndrome	BEFREE	31406210		★★★★★ ★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	20059466, 23065274, 23193966, 30605433		★★★★★ ★☆☆☆☆ Found in Text Mining only
Monoclonal Gammopathy of Undetermined Significance	Monoclonal Gammapathies	BEFREE	15580314		★★★★★ ★☆☆☆☆ Found in Text Mining only
Morphea	Morphea	BEFREE	28393380		★★★★★ ★☆☆☆☆ Found in Text Mining only
Motor Neuron Disease	Motor Neuron Disease	BEFREE	19925559		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	20977777, 37309689	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	27742160, 28155253, 29516928, 29564744, 31251469, 32641093, 32961483, 33551310, 34318593, 34500779, 36231010, 39237001	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Moyamoya Disease	Moyamoya Disease	BEFREE	30157848		★★★★★ ★☆☆☆☆ Found in Text Mining only
Moyamoya disease 1	Moyamoya disease	BEFREE	30157848		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucoepidermoid Carcinoma	Mucoepidermoid Carcinoma	BEFREE	26790448		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple congenital anomalies	Multiple Congenital Anomalies	CLINVAR_DG	17881745, 18602572, 20159255, 22520845, 22751495, 25038750, 25359994, 26343524, 26394394, 28073828, 29180260		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Endocrine Neoplasia Type 2b	Multiple Endocrine Neoplasia	BEFREE	15485908		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	10023775, 10329429, 11751528, 12707028, 15580314, 15655377, 15827128, 15860671, 17164350, 17855663, 19147543, 19458357, 19937797, 19996089, 20228272 View all (42 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	11429412, 11986233, 12384432, 12707028, 12969979, 14726660, 14975242, 15354212, 15827128, 15860671, 15970928, 16123214, 17003370, 17164350, 17496199 View all (48 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	LHGDN	12743296, 12969979, 15070700, 17855663		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	24340030, 24407159	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	14760959, 17898009, 19539560, 20159113, 20200543, 24226263, 27630207, 30463275, 30917537, 31326963, 31713760		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple sclerosis	Pubtator	18200504, 20159113, 30463275, 31004050, 31484947, 32241259, 33375941, 34874980, 36282535, 36441748, 37572949	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	GWASCAT_DG	20159113, 21833088, 22190364, 24076602		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	GWASDB_DG	20159113, 21833088, 22190364		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Muscular Dystrophy Duchenne	Duchenne muscular dystrophy	Pubtator	36814107	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia Gravis	BEFREE	29807388		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mycosis Fungoides	Mycosis fungoides	Pubtator	24621498, 31049933, 9192639	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
MYD88 Deficiency	MYD88 Deficiency	BEFREE	31065023		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	11027834, 22258937, 22753872, 23926297, 24705981, 25981636, 28159737, 30252677, 31406210		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	22753872, 23926297, 25359994, 31406210	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelofibrosis	Myelofibrosis	BEFREE	16871275		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	21677772, 9753648		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	LHGDN	12821944		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	16846476, 20065083, 20497005, 23729004, 24374144, 25134459, 25417721, 26942564, 28596283, 30054832, 30622586		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	21749449, 25150294		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Diseases, Secondary	Myocardial Diseases	CTD_human_DG	10618415, 24448315		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	20585009, 21324546, 27367417, 28392989, 29029396, 29223542, 29311992, 29643704, 29913449, 29967195, 29992755, 30439699, 30460984, 31738412		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial infarction	Pubtator	31269974, 37798364, 39261934	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial Ischemia	BEFREE	28001439		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocarditis	Myocarditis	BEFREE	23460527, 28469272, 28963014, 30619368		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopathy	Myopathy	BEFREE	28860475		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	BEFREE	29771404		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	22761857	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	22959364, 24157808		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	34653793	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Type Extranodal NK/T-Cell Lymphoma	Extranodal NK T Cell Lymphoma	BEFREE	28284718, 30935402, 31002364		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	11222718, 12634372, 12865928, 22504904, 23382914, 24499623, 24966947, 25607111, 29685955, 29738439, 29914005, 30720169, 30849642, 31545261, 32083569 View all (10 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	12865928, 15498875, 18307254, 19588483, 23220625, 23382914, 23658720, 23708661, 24499623, 24966947, 25365510, 25915430, 26314966, 26707908, 26779625 View all (10 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Neoplasms	Nasopharyngeal Neoplasms	BEFREE	24966947		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Neoplasms	Nasopharyngeal carcinoma	Pubtator	24966947, 29290793	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neck Neoplasms	Neck Neoplasms	BEFREE	10760290, 10851047, 22719020, 22886660		★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	27769057	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrotizing enterocolitis in fetus OR newborn	Necrotizing Enterocolitis	BEFREE	26690704		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neonatal diabetes mellitus	Diabetes Mellitus	GENOMICS_ENGLAND_DG	25359994		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neonatal diabetes mellitus	Diabetes Mellitus	BEFREE	28073828, 28402852		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10458605, 10760290, 10896772, 11222718, 11753675, 11807001, 12015764, 12067972, 12193474, 12370822, 12438264, 12865943, 12949733, 12963127, 14715258 View all (624 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	16912181, 23333300, 23665320, 27129294, 29721059, 9531608		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrosis	Nephrosis	BEFREE	30054017		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrosis Lipoid	Nephrotic syndrome	Pubtator	21426892	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic Syndrome	BEFREE	30054017		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome, Minimal Change	Nephrotic Syndrome	BEFREE	21426892		★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	31455240		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neural crest tumor	Neural Crest Tumor	BEFREE	27428599		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurilemmoma	Neurilemmoma	BEFREE	12444102		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurilemmoma	Neurilemmoma	LHGDN	12444102		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	10500198, 11474132, 14511121, 15342394, 16971535, 18055217, 22406995, 23399684, 23889739, 27797972, 28687621, 29207662, 30425511, 31354352, 31803140		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	15606754, 19946221, 20490331, 22192458, 23633489, 39356934	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	24945434, 35810312	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	17519506, 23971732, 25673868, 29427792, 30323145		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	31144189		★★★★★ ★☆☆☆☆ Found in Text Mining only
neurofibroma	Neurofibroma	BEFREE	26904939, 30542122		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibromatoses	Neurofibromatosis	BEFREE	26904939		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 1	Neurofibromatosis	BEFREE	16461335, 25833823		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 2	Neurofibromatosis	BEFREE	27927008		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibrosarcoma	Neurofibrosarcoma	Pubtator	25833823	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuropathy, Painful	Neuropathy	BEFREE	29339053		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	BEFREE	22591296, 24283217, 31467122, 31585621		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	Pubtator	24283217, 31467122, 35676278, 37497725	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Neutropenia and hyperlymphocytosis with large granular lymphocytes	Chediak-Steinbrinck-Higashi syndrome	ORPHANET_DG	26980727, 29385279		★★★★★ ★☆☆☆☆ Found in Text Mining only
Niemann-Pick Disease, Type C	Niemann-Pick Disease	BEFREE	30668347		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nodular Lymphocyte Predominant Hodgkin Lymphoma	Classical Hodgkin lymphoma	BEFREE	30371509		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	18789715, 28497593, 30206377, 30411754, 30553055		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	12833138, 15217536, 16540667, 17266440, 17824789, 19569236, 19578748, 20073576, 20605584, 20631637, 21306997, 21333372, 21549414, 21948749, 22319590 View all (95 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	CTD_human_DG	21549414		★★★★★ ★☆☆☆☆ Found in Text Mining only
Noonan Syndrome	Noonan Syndrome	BEFREE	19509418		★★★★★ ★☆☆☆☆ Found in Text Mining only
Norrie disease	Norrie Disease	BEFREE	26228595		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nuclear non-senile cataract	Cataract	BEFREE	31785228		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	17636079, 18451776, 18988190, 19776189, 23217260, 23270367, 24932998, 25014397, 25840984, 26035386, 27812198, 28683285, 29635003, 30454647, 30541116, 30576248, 30848861 View all (2 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	17636079, 19717488, 19776189, 21147860, 23110196, 23900445, 24558408, 25014397, 27768648, 37671970, 37878496, 38387703	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	25747354	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	29737494	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity Abdominal	Obesity	Pubtator	19776189	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity, Morbid	Obesity	BEFREE	19390493		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oculocutaneous albinism type 2	Oculocutaneous albinism	Pubtator	23250732	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	28468300, 29207087, 30867218, 31042586		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	30551507, 30583016, 31875669, 33297736, 34669172, 37309689, 37788787, 39879889	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis Knee	Osteoarthritis	Pubtator	21538317	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteofibrous Dysplasia	Osteofibrous Dysplasia	BEFREE	28486600		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteomyelitis	Osteomyelitis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	29587202		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	22802946, 35758378, 36316863, 37335694	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	31411118		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	16331882, 19284568, 20546860, 21443800, 22743617, 23192273, 24455684, 25146150, 25760445, 26271643, 26573608, 26783521, 27624867, 28054649, 28386742 View all (31 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	17598902, 20063378, 20459702, 24455684, 25146150, 27735939, 28837148, 29048621, 30381753, 31081055, 31539114, 32775413, 33277868, 33828027, 34922636 View all (6 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	37774081	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	11006034, 17063503		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian clear cell carcinoma	Ovarian Carcinoma	BEFREE	28646535		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	15150111, 16061651, 16951221, 18535750		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	16951221, 18535750, 18587580, 22280969, 22801507, 23536726, 23604529, 23828376, 23962558, 24590057, 24799285, 25319391, 25420630, 26983899, 27160903 View all (18 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	CTD_human_DG	21909139		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	18587580, 19088723, 20606733, 21643014, 22801507, 24662131, 24799285, 24842412, 25896424, 25923701, 26894601, 27456942, 27590741, 28448787, 28536310 View all (28 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PACHYONYCHIA CONGENITA 3	Pachyonychia Congenita	BEFREE	23226098		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	12545153, 12949733, 14580692, 16546976, 17054436, 17459060, 18566225, 19176463, 19288493, 20067773, 20100905, 20197401, 20482858, 21174186, 21479358 View all (45 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	21481787, 21481788, 24164699, 28619758, 30031610		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	12545153, 17459060, 17975158, 19010822, 19176463		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	CTD_human_DG	22348037, 23845849		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	22975375, 24520096, 26646273, 27003603, 27089513, 31312365, 31796877		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	15851011, 17054436, 17459060, 18566225, 19010822, 19673016, 20197401, 20482858, 21174186, 21573184, 21737619, 22348037, 23094050, 23206899, 23514705 View all (28 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatitis	Pancreatitis	BEFREE	21481787, 29370858		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	26215634, 27333990	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancytopenia	Pancytopenia	BEFREE	23926297		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancytopenia	Pancytopenia	Pubtator	33731004	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancytopenia	Pancytopenia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary craniopharyngioma	Papillary Craniopharyngioma	BEFREE	28222105		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	17761947, 21897114, 22891351, 28901486, 30657221		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papilledema	Papilledema	BEFREE	30942636		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	BEFREE	12075083, 23031678		★★★★★ ★☆☆☆☆ Found in Text Mining only
Paracoccidioidomycosis	Paracoccidioidomycosis	Pubtator	31572394	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	30341316, 31408661, 31547989, 31669235, 31707035		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	34536521, 36306116	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Paronychia Inflammation	Paronychia Inflammation	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	21481787		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pediatric Obesity	Childhood obesity	BEFREE	29895283		★★★★★ ★☆☆☆☆ Found in Text Mining only
PEELING SKIN SYNDROME	Peeling Skin Syndrome	BEFREE	30150979		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pemphigus Vulgaris	Pemphigus Vulgaris	BEFREE	28469076		★★★★★ ★☆☆☆☆ Found in Text Mining only
Penile hypospadias	Penile Hypospadias	BEFREE	30380353		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	28578028		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal disease	Pubtator	39337647	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	37697911	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	37697911	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Diseases	Vascular Diseases	BEFREE	27974423, 30236983		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral axonal neuropathy	Peripheral axonal neuropathy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	28134252, 30054295, 30420593		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Vascular Diseases	Vascular Diseases	BEFREE	27974423		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peritoneal Fibrosis	Peritoneal Fibrosis	BEFREE	29137389, 30943519		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	23382965, 31690341, 36632455	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Permanent neonatal diabetes mellitus	Diabetes Mellitus	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
Persistent Fetal Circulation Syndrome	Persistent Fetal Circulation	BEFREE	31199666		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peutz-Jeghers Syndrome	Peutz-Jeghers Syndrome	BEFREE	29202476		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary Adenoma	Pituitary adenoma	BEFREE	28521414, 28709401		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary Diseases	Pituitary Diseases	BEFREE	25774503		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary Neoplasms	BEFREE	25774503		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	28709401, 30609812	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pleurisy	Pleuritis	BEFREE	27450010		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyarthritis, Juvenile, Rheumatoid Factor Negative	Seronegative polyarthritis	CTD_human_DG	19565504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyarthritis, Juvenile, Rheumatoid Factor Positive	Polyarthritis, Rheumatoid Factor Positive	CTD_human_DG	19565504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Autosomal Recessive	Polycystic kidney disease	Pubtator	33112055	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Diseases	Polycystic kidney disease	BEFREE	21821671, 31773180		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Diseases	Polycystic kidney disease	Pubtator	27491076	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	BEFREE	21518865, 21821671, 30872773, 31773180		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	17895321, 29617629, 31554782		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	31115532, 35758378	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia vera	Pubtator	26491227	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia Vera	BEFREE	30571852		★★★★★ ★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	28850112		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor B-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	CTD_human_DG	19796711		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	28861713		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	27941168, 30837035		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	12547716		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary central nervous system lymphoma	Central Nervous System Lymphoma	BEFREE	27959415, 28415725, 30639963, 31778838		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary Graft Dysfunction	Primary graft dysfunction	Pubtator	30024306	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary immune deficiency disorder	immunodeficiency	BEFREE	21910722, 30315710		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary Myelofibrosis	Myelofibrosis	BEFREE	16871275, 17376889, 20113333, 30213875, 31369569		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary Myelofibrosis	Myelofibrosis	LHGDN	16871275		★★★★★ ★☆☆☆☆ Found in Text Mining only
Proliferative vitreoretinopathy	Proliferative Vitreoretinopathy	BEFREE	31608440		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	10639189, 10786674, 11141475, 11912448, 12082540, 12438264, 12606952, 14749471, 15264241, 15647107, 15688010, 16140113, 16144938, 16546976, 16804520 View all (73 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	11733366, 11751884, 16804520, 17148681, 17438134, 17543278, 18566225, 18831788, 19147545, 19275204, 19342366, 19437484, 20228845, 20979115, 21258401 View all (43 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	11987152, 15688010, 15958548, 17875724, 18483213, 19147545		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	12438264, 15958548, 16144938, 18223232, 21390188, 21480310, 27732936, 27820701, 28467474, 31530281		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	14975756, 16427044, 25970160		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	20929579, 32592689	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pruritus	Pruritus	Pubtator	32270320	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	15592573, 16417229, 22048239, 22482804, 23614738, 23870655, 24610393, 26134945, 27984001, 28063039, 28272440, 28420002, 28494466, 28901004, 29182760 View all (14 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	Pubtator	16417229, 29859926, 36497125	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	CTD_human_DG	23143594		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	GWASCAT_DG	26974007		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	23877858, 33015805, 34206428, 34815425, 40594490	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	22268122, 30291890		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	25704671, 29409529, 29678906, 30257954, 30658076, 31049028, 31379980		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Fibrosis	Pulmonary fibrosis	Pubtator	26308397, 33760151	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Fibrosis	Pulmonary Fibrosis	CTD_human_DG	30658076		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Stenosis	Pulmonary Stenosis	BEFREE	19509418		★★★★★ ★☆☆☆☆ Found in Text Mining only
Purpura, Thrombotic Thrombocytopenic	Thrombotic thrombocytopenic purpura	BEFREE	29738371		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pustulosis of Palms and Soles	Palmoplantar Pustules	CTD_human_DG	23143594		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	23934972, 31025789		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	23052245, 24158981, 29961871		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	12131365, 19244102, 20461084, 22736024, 22899991, 24530290, 24593195, 24606948, 24615012, 24797723, 27841868, 28453463, 29312589, 29633072, 29717134 View all (8 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	LHGDN	17602083		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	28240316, 28848189, 29669350, 29723529, 30177595, 30251698, 30958891, 31699972		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	28992339		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal tubular disorder	Renal Tubular Disorder	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Resistance to Insulin-Like Growth Factor I	IGF-I RESISTANCE	BEFREE	29774124		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	24551274, 27638904, 31566109		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Tract Infections	Respiratory system infectious disease	Pubtator	29200949, 33734873	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Reticulosarcoma	Reticulosarcoma	BEFREE	29327713		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	30944099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal detachment	Pubtator	32945388	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	15917293, 27498908, 29251322, 30114638		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	32369777, 35369571, 35980647, 36005200	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
RETINOSCHISIS 1, X-LINKED, JUVENILE	Retinoschisis, X-Linked	BEFREE	28827130		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	17598902, 26373715	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	28672024, 28750090		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatic Heart Disease	Rheumatic Heart Disease	BEFREE	24797343, 30929974		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	11748261, 12444174, 15535835, 16802343, 21937456, 22342385, 22532634, 22591296, 22736176, 22753649, 23308194, 24082147, 24525913, 24708416, 25436214 View all (30 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rufous oculocutaneous albinism	Rufous oculocutaneous albinism	Pubtator	23590999	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Salivary Gland Adenoma Pleomorphic	Salivary gland disease	Pubtator	27286739	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasms	Pubtator	19272817	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasm	BEFREE	26790448		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	24283217, 24768588	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	31185230		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	17598902, 35069780, 39778225	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Sarcoma	BEFREE	26909593, 28179300, 28750090, 29620166		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma Alveolar Soft Part	Sarcoma	Pubtator	32127467	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	23800680, 25092916, 30131449	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	12531804, 23740979, 26339061, 37883374	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Scleroderma	Scleroderma	BEFREE	30207074		★★★★★ ★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	30641535	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Scoliosis, unspecified	Scoliosis	BEFREE	19190525, 28222105		★★★★★ ★☆☆☆☆ Found in Text Mining only
Scoliosis, unspecified	Scoliosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Seborrheic keratosis	Seborrheic keratosis	BEFREE	16043897		★★★★★ ★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	23083634, 26839145, 31360301		★★★★★ ★☆☆☆☆ Found in Text Mining only
Seizures	Seizures	Pubtator	36825472	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Selective immunoglobulin A deficiency	Selective Immunoglobulin A Deficiency	BEFREE	30936864		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	30921508, 31566109, 35222683	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	24732911, 25348624, 26216424, 26535690, 27430527, 27730511, 28006751, 28625915, 28679957, 29285858, 29900929, 29962507, 30021364, 30365067, 30576248, 30921508, 31078118, 31566109 View all (3 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe Aplastic Anemia	Anemia	BEFREE	30842658		★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency disease	BEFREE	21763205, 30267241		★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency	Pubtator	36544766	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe intellectual disability	Mental retardation	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary syndrome	Pubtator	18200050, 21085192, 21938013, 24621498, 24756111, 26376612, 30910759	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary Syndrome	BEFREE	21818116, 21938013, 24621498		★★★★★ ★☆☆☆☆ Found in Text Mining only
Short Stature, Idiopathic, Autosomal	Short Stature, Idiopathic, Autosomal	BEFREE	29378236		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sicca Syndrome	Sjogren`s Syndrome	BEFREE	24255059, 30910759		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sick Sinus Syndrome	Sick sinus syndrome	Pubtator	29137038	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	24827536, 29604049, 30150979, 35795677, 36072585	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin carcinoma	Skin Carcinoma	BEFREE	31323143		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	35258358, 36842846	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Erosion	Skin Erosion	BEFREE	28562338, 28887478		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	23768573, 24621498, 26453584, 27783096, 30544712, 30894513		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	BEFREE	20876801, 22992748, 28322331, 31264291		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin neoplasm	Pubtator	24460316	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	19284568, 21443800		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Deprivation	Sleep deprivation	Pubtator	23440187	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	19455144, 22662257, 22938476, 27101199, 28285690, 29299146, 29568932		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	12509453, 22938476, 29020964, 33535997, 35583004	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Soft Tissue Neoplasms	Soft Tissue Neoplasms	BEFREE	21575192, 27440725		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spherocytosis Hereditary	Spherocytosis	Pubtator	33519826	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinocerebellar Ataxia 17	Spinocerebellar ataxia	Pubtator	19577286, 25880788	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinocerebellar Ataxias	Spinocerebellar ataxia	Pubtator	33519826	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Splenic Neoplasms	Splenic neoplasms	Pubtator	22488042	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Spondylarthritis	Spondyloarthritis	BEFREE	30630513		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	21152001, 35065610	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	11861373, 16432158, 16603078, 18614255, 18813829, 19616333, 20228845, 21497567, 21595927, 22090359, 22208386, 22302289, 23018838, 23266472, 23472872 View all (19 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	12067972, 12782602, 15254691, 16503733, 16512876, 18547788		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	CTD_human_DG	17566705, 26432044		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	18602747, 19684620, 22108192, 22847808, 23172665, 23676499, 24577086, 25405520, 25407307, 25843419, 26405196, 26806810, 27801498, 28085101, 28574599 View all (14 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	11927016, 12015764, 12454768, 12640143, 12771142, 15316561, 16984731, 17013800, 17498291, 19318490, 19484147, 19638453, 20371693, 20622897, 20682796 View all (43 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	23028842, 36361568	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	24191246, 25573684		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	16043897, 16512876, 25854367, 27457246, 29476880		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	10851047, 11927016, 12015764, 12067972, 12193474, 12640143, 12789269, 12873986, 15592503, 16503733, 17169602, 19424608, 19453393, 19484147, 19638453 View all (31 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	CTD_human_DG	27064016		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma of the hypopharynx	Hypopharyngeal Carcinoma	BEFREE	30816544		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	31270251		★★★★★ ★☆☆☆☆ Found in Text Mining only
STAT3-related early-onset multisystem autoimmune disease	Multisystem Autoimmune Disease	Orphanet			★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Status Epilepticus	Status Epilepticus	BEFREE	28716963		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	23816536, 24708244, 26750868, 26976243, 29550470, 29615085, 30206377, 30664851, 31321478		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steroid Sulfatase Deficiency Disease	Steroid Sulfatase Deficiency Disease	BEFREE	26909593		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	15746037, 17724739, 18431520, 19339266, 20939893, 21072904, 21633597, 22104727, 22328012, 22469989, 22581828, 22834702, 23178499, 23322197, 23333463 View all (53 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	23322197	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	12555068, 15077160, 15882975, 16948814, 18024479, 18184402, 18573283, 19147578		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach neoplasms	Pubtator	15682485, 20939893, 21072904, 21633597, 21730976, 22159814, 22351606, 23382965, 23402362, 23704922, 23824569, 23824571, 24116074, 24696730, 24864251 View all (67 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach Neoplasms	CTD_human_DG	23382965		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach Neoplasms	BEFREE	24398427, 28507278		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomatitis	Stomatitis	BEFREE	28381801		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomatitis	Stomatitis	Pubtator	28381801	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomatitis	Stomatitis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	29102603, 29434719, 30481554		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sweet Syndrome	Sweet Syndrome	BEFREE	24255059, 30910759		★★★★★ ★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	17376509, 24255059, 30910759		★★★★★ ★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	BEFREE	22532634, 22736176, 7500028		★★★★★ ★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	Pubtator	22736176, 7500028	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic onset juvenile chronic arthritis	Arthritis	BEFREE	31641939		★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	28342234, 29066712, 29147913, 30150979, 30207074		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
T-Cell Large Granular Lymphocyte Leukemia	T-cell Lymphocytic Leukemia	BEFREE	22591296, 22859607, 23872306, 24283217, 24350896, 24512550, 24689848, 24705981, 24797340, 24828862, 25096606, 25281507, 26199174, 27064362, 27542218 View all (5 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
T-Cell Large Granular Lymphocyte Leukemia	T-cell Lymphocytic Leukemia	ORPHANET_DG	26980727, 29385279		★★★★★ ★☆☆☆☆ Found in Text Mining only
T-cell large granular lymphocyte leukemia	T-cell Lymphocytic Leukemia	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
T-Cell Large Granular Lymphocyte Leukemia	T-cell Lymphocytic Leukemia	CGI_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	16861352, 19421230, 21102525, 23689514, 24892807, 25586472, 25612622, 26727971, 27275540, 29258893, 31684088		★★★★★ ★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	CTD_human_DG	26192917		★★★★★ ★☆☆☆☆ Found in Text Mining only
T-Cell Prolymphocytic Leukemia	T-Cell Prolymphocytic Leukemia	BEFREE	29928415, 31817042		★★★★★ ★☆☆☆☆ Found in Text Mining only
Takayasu Arteritis	Takayasu Arteritis	BEFREE	28770707		★★★★★ ★☆☆☆☆ Found in Text Mining only
Teratozoospermia	Teratozoospermia	BEFREE	26209830		★★★★★ ★☆☆☆☆ Found in Text Mining only
Teratozoospermia	Teratozoospermia	Pubtator	26209830	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular germ cell tumor	Pubtator	35341013	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombocythemia, Essential	Thrombocythemia	BEFREE	19118011, 20113333, 23639951		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombocythemia, Essential	Thrombocythemia	LHGDN	19118011		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombocytopenia	Thrombocytopenia	Pubtator	31866622	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thymoma	Thymoma	BEFREE	27041560		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer medullary	Medullary thyroid cancer	Pubtator	27620278	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	21577321, 30964171, 31936675, 32182833, 32285621, 32851683, 32960462, 35090515, 35543351, 37671970	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	22328572, 22891351, 23941877, 24899100, 29687367, 30690057, 31171714		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	19825993, 29561707, 31958078, 35491899, 35769818, 36430869	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid Diseases	BEFREE	24044365, 24081513		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	LHGDN	17145757		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	22328572, 22891351, 23941877, 24899100, 29687367, 30690057, 31171714		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	31135274, 31936675, 33247999, 35769818, 35813296, 37897947, 40198658	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	Pubtator	22527947	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	BEFREE	30093941		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroiditis Autoimmune	Thyroiditis	Pubtator	24081513	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tic disorder	Tic Disorder	BEFREE	28504577		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tongue Neoplasms	Tongue cancer	Pubtator	32281236	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tonic - clonic seizures	Seizure	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Tooth Diseases	Tooth disease	Pubtator	36370067	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Transient Cerebral Ischemia	Cerebral Ischemia	BEFREE	27337676		★★★★★ ★☆☆☆☆ Found in Text Mining only
Transient Ischemic Attack	Transient Ischemic Attack	BEFREE	27337676		★★★★★ ★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	26156799, 27435393		★★★★★ ★☆☆☆☆ Found in Text Mining only
Trigeminal Neuralgia	Trigeminal neuralgia	BEFREE	22189713		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	21289371, 22189713, 24431073, 26028030, 27186677, 27545642, 27861147, 28030809, 28084011, 28088463, 28255357, 28440514, 28705432, 28729467, 28798401 View all (27 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	28030809, 28729467, 29621649, 30826569, 31427441, 31850822, 32032581, 32406563, 32724453, 32816914, 33725911, 34067421, 34638797, 35053370, 35429924 View all (12 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	36922898	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous Sclerosis	BEFREE	26296882		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis 1	Tuberous sclerosis complex	Pubtator	36231025	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	18438405, 18500230, 18800073, 19592695, 19647622, 19926618, 20200543, 21574661, 21631466, 22065112, 22269120, 22962574, 23438478, 23856509, 24781989 View all (9 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ulcerative Colitis	Ulcerative colitis	LHGDN	18438405		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ulcerative Colitis	Ulcerative colitis	CTD_human_DG	18438405, 20228799		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ulcerative Colitis	Ulcerative colitis	GWASCAT_DG	26192919, 26974007, 28067908		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Undifferentiated carcinoma	Carcinoma	CTD_human_DG	16316942		★★★★★ ★☆☆☆☆ Found in Text Mining only
Undifferentiated carcinoma	Carcinoma	BEFREE	18498667		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uranostaphyloschisis	Uranostaphyloschisis	BEFREE	31171577		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	18939995, 21408190, 23392170, 23526079, 25849286, 27322953, 27556503, 29190807, 29517678, 29665744, 30864733, 31529191, 31661119, 32102537, 35783012 View all (7 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urologic Neoplasms	Urologic neoplasm	Pubtator	30091994	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	19951849, 24448750, 29200949, 30091994		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Carcinosarcoma	Endometrial Cancer	BEFREE	27121792		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine Cervical Dysplasia	Uterine disease	Pubtator	17110342, 39684873	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasm	Uterine cervix neoplasm	CTD_human_DG	25061499		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasm	Uterine cervix neoplasm	BEFREE	25351437		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	17311011, 19638983, 20977777, 23874455, 25539644, 27690342, 28455960, 29610452, 29716674, 30024597, 30333561, 30720156, 31210293, 31487312, 31638249 View all (7 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine Diseases	Uterine polyp	Pubtator	35279667	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	BEFREE	29899166		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	29899166, 33682883	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveitis, Posterior	Uveitis	BEFREE	22238646		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveomeningoencephalitic Syndrome	Uveomeningoencephalitic Syndrome	BEFREE	23611997		★★★★★ ★☆☆☆☆ Found in Text Mining only
Van der Woude syndrome	Van Der Woude Syndrome	BEFREE	29350876, 30365067		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Calcification	Vascular calcification	Pubtator	31461977	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	28342234, 30006123		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Remodeling	Vascular remodeling	Pubtator	21494893	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular Remodeling	Ventricular remodeling	Pubtator	34939316	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	Pubtator	33200798	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitreoretinopathy Proliferative	Vitreoretinopathy	Pubtator	31608440	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom macroglobulinemia	Pubtator	22976953	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Wilms Tumor	Wilms tumor	Pubtator	23333300	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Xeroderma Pigmentosum	Xeroderma Pigmentosum	BEFREE	20456494		★★★★★ ★☆☆☆☆ Found in Text Mining only

STAT3 (signal transducer and activator of transcription 3)