Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID	6776
Gene name	Signal transducer and activator of transcription 5A
Gene symbol	STAT5A
Synonyms (NCBI Gene)	MGFSTAT5
Chromosome	17
Chromosome location	17q21.2
Summary	The protein encoded by this gene is a member of the STAT family of transcription factors. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that tran

367

Show/Hide all (367)

miRTarBase ID	miRNA	Experiments	Reference
MIRT000018	hsa-miR-222-3p	qRT-PCRLuciferase reporter assayWestern blot	20489169
MIRT023082	hsa-miR-124-3p	Microarray	18668037
MIRT438254	hsa-miR-221-3p	Luciferase reporter assay	24736554
MIRT000018	hsa-miR-222-3p	Luciferase reporter assay	24736554
MIRT000018	hsa-miR-222-3p	Luciferase reporter assay	24736554
MIRT438254	hsa-miR-221-3p	Luciferase reporter assay	24736554
MIRT437995	hsa-miR-223-3p	Luciferase reporter assayqRT-PCR	24400121
MIRT437995	hsa-miR-223-3p	Luciferase reporter assayqRT-PCR	24400121
MIRT438254	hsa-miR-221-3p	Luciferase reporter assay	24736554
MIRT000018	hsa-miR-222-3p	Luciferase reporter assay	24736554
MIRT000018	hsa-miR-222-3p	Luciferase reporter assay	24736554
MIRT438254	hsa-miR-221-3p	Luciferase reporter assay	24736554
MIRT437995	hsa-miR-223-3p	Luciferase reporter assayqRT-PCR	24400121
MIRT437995	hsa-miR-223-3p	Luciferase reporter assayqRT-PCR	24400121
MIRT610929	hsa-miR-8080	HITS-CLIP	23313552
MIRT610928	hsa-miR-4731-3p	HITS-CLIP	23313552
MIRT610927	hsa-miR-4801	HITS-CLIP	23313552
MIRT610926	hsa-miR-8485	HITS-CLIP	23313552
MIRT610925	hsa-miR-1197	HITS-CLIP	23313552
MIRT693837	hsa-miR-4457	HITS-CLIP	23313552
MIRT610924	hsa-miR-5589-3p	HITS-CLIP	23313552
MIRT610926	hsa-miR-8485	HITS-CLIP	23313552
MIRT610924	hsa-miR-5589-3p	HITS-CLIP	23313552
MIRT610929	hsa-miR-8080	HITS-CLIP	23824327
MIRT610928	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT610927	hsa-miR-4801	HITS-CLIP	23824327
MIRT610926	hsa-miR-8485	HITS-CLIP	23824327
MIRT610925	hsa-miR-1197	HITS-CLIP	23824327
MIRT610924	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT610928	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT610927	hsa-miR-4801	HITS-CLIP	23824327
MIRT610926	hsa-miR-8485	HITS-CLIP	23824327
MIRT610924	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT610929	hsa-miR-8080	HITS-CLIP	23824327
MIRT610928	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT610927	hsa-miR-4801	HITS-CLIP	23824327
MIRT610926	hsa-miR-8485	HITS-CLIP	23824327
MIRT610925	hsa-miR-1197	HITS-CLIP	23824327
MIRT610924	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT610929	hsa-miR-8080	HITS-CLIP	23824327
MIRT610928	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT610927	hsa-miR-4801	HITS-CLIP	23824327
MIRT610926	hsa-miR-8485	HITS-CLIP	23824327
MIRT610925	hsa-miR-1197	HITS-CLIP	23824327
MIRT610924	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT610929	hsa-miR-8080	HITS-CLIP	23824327
MIRT610928	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT610927	hsa-miR-4801	HITS-CLIP	23824327
MIRT610926	hsa-miR-8485	HITS-CLIP	23824327
MIRT610925	hsa-miR-1197	HITS-CLIP	23824327
MIRT610924	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT610929	hsa-miR-8080	HITS-CLIP	23824327
MIRT610928	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT610927	hsa-miR-4801	HITS-CLIP	23824327
MIRT610926	hsa-miR-8485	HITS-CLIP	23824327
MIRT610925	hsa-miR-1197	HITS-CLIP	23824327
MIRT610924	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT610928	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT610927	hsa-miR-4801	HITS-CLIP	23824327
MIRT610926	hsa-miR-8485	HITS-CLIP	23824327
MIRT610924	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT610929	hsa-miR-8080	HITS-CLIP	23824327
MIRT610928	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT610927	hsa-miR-4801	HITS-CLIP	23824327
MIRT610926	hsa-miR-8485	HITS-CLIP	23824327
MIRT610925	hsa-miR-1197	HITS-CLIP	23824327
MIRT610924	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT610929	hsa-miR-8080	HITS-CLIP	23824327
MIRT610928	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT610927	hsa-miR-4801	HITS-CLIP	23824327
MIRT610926	hsa-miR-8485	HITS-CLIP	23824327
MIRT610925	hsa-miR-1197	HITS-CLIP	23824327
MIRT610924	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT610929	hsa-miR-8080	HITS-CLIP	23824327
MIRT610928	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT610927	hsa-miR-4801	HITS-CLIP	23824327
MIRT610926	hsa-miR-8485	HITS-CLIP	23824327
MIRT610925	hsa-miR-1197	HITS-CLIP	23824327
MIRT610924	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT610929	hsa-miR-8080	HITS-CLIP	23824327
MIRT610928	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT610927	hsa-miR-4801	HITS-CLIP	23824327
MIRT610926	hsa-miR-8485	HITS-CLIP	23824327
MIRT610925	hsa-miR-1197	HITS-CLIP	23824327
MIRT610924	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT610929	hsa-miR-8080	HITS-CLIP	23824327
MIRT610928	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT610927	hsa-miR-4801	HITS-CLIP	23824327
MIRT610926	hsa-miR-8485	HITS-CLIP	23824327
MIRT610925	hsa-miR-1197	HITS-CLIP	23824327
MIRT610924	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT610929	hsa-miR-8080	HITS-CLIP	23824327
MIRT610928	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT610927	hsa-miR-4801	HITS-CLIP	23824327
MIRT610926	hsa-miR-8485	HITS-CLIP	23824327
MIRT610925	hsa-miR-1197	HITS-CLIP	23824327
MIRT610924	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT610929	hsa-miR-8080	HITS-CLIP	23824327
MIRT610928	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT610927	hsa-miR-4801	HITS-CLIP	23824327
MIRT610926	hsa-miR-8485	HITS-CLIP	23824327
MIRT610925	hsa-miR-1197	HITS-CLIP	23824327
MIRT610924	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT614735	hsa-miR-4763-5p	HITS-CLIP	23824327
MIRT614734	hsa-miR-518a-5p	HITS-CLIP	23824327
MIRT614733	hsa-miR-527	HITS-CLIP	23824327
MIRT614732	hsa-miR-6894-3p	HITS-CLIP	23824327
MIRT610928	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT610927	hsa-miR-4801	HITS-CLIP	23824327
MIRT610926	hsa-miR-8485	HITS-CLIP	23824327
MIRT610924	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT610928	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT610927	hsa-miR-4801	HITS-CLIP	23824327
MIRT610926	hsa-miR-8485	HITS-CLIP	23824327
MIRT610924	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT610929	hsa-miR-8080	HITS-CLIP	23824327
MIRT610928	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT610927	hsa-miR-4801	HITS-CLIP	23824327
MIRT610926	hsa-miR-8485	HITS-CLIP	23824327
MIRT610925	hsa-miR-1197	HITS-CLIP	23824327
MIRT610924	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT610929	hsa-miR-8080	HITS-CLIP	23824327
MIRT610928	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT610927	hsa-miR-4801	HITS-CLIP	23824327
MIRT610926	hsa-miR-8485	HITS-CLIP	23824327
MIRT610925	hsa-miR-1197	HITS-CLIP	23824327
MIRT610924	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT610929	hsa-miR-8080	HITS-CLIP	23824327
MIRT610928	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT610927	hsa-miR-4801	HITS-CLIP	23824327
MIRT610926	hsa-miR-8485	HITS-CLIP	23824327
MIRT610925	hsa-miR-1197	HITS-CLIP	23824327
MIRT610924	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT622038	hsa-miR-603	HITS-CLIP	23824327
MIRT622037	hsa-miR-4639-3p	HITS-CLIP	23824327
MIRT622036	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT622035	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT622034	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT622033	hsa-miR-3120-5p	HITS-CLIP	23824327
MIRT622032	hsa-miR-1180-5p	HITS-CLIP	23824327
MIRT622031	hsa-miR-7114-3p	HITS-CLIP	23824327
MIRT622030	hsa-miR-6895-3p	HITS-CLIP	23824327
MIRT622029	hsa-miR-593-3p	HITS-CLIP	23824327
MIRT622028	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT622027	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT622026	hsa-miR-6888-3p	HITS-CLIP	23824327
MIRT622025	hsa-miR-6818-3p	HITS-CLIP	23824327
MIRT622024	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT622023	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT622022	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT610929	hsa-miR-8080	HITS-CLIP	23824327
MIRT610928	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT610927	hsa-miR-4801	HITS-CLIP	23824327
MIRT610926	hsa-miR-8485	HITS-CLIP	23824327
MIRT610925	hsa-miR-1197	HITS-CLIP	23824327
MIRT610924	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT614735	hsa-miR-4763-5p	HITS-CLIP	23824327
MIRT614734	hsa-miR-518a-5p	HITS-CLIP	23824327
MIRT614733	hsa-miR-527	HITS-CLIP	23824327
MIRT614732	hsa-miR-6894-3p	HITS-CLIP	23824327
MIRT610929	hsa-miR-8080	HITS-CLIP	23824327
MIRT610928	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT610927	hsa-miR-4801	HITS-CLIP	23824327
MIRT610926	hsa-miR-8485	HITS-CLIP	23824327
MIRT610925	hsa-miR-1197	HITS-CLIP	23824327
MIRT610924	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT731071	hsa-miR-141-3p	5.0	25241899
MIRT731071	hsa-miR-141-3p	5.0	25241899
MIRT731071	hsa-miR-141-3p	5.0	25241899
MIRT731071	hsa-miR-141-3p	5.0	25241899
MIRT610925	hsa-miR-1197	HITS-CLIP	27418678
MIRT693837	hsa-miR-4457	HITS-CLIP	27418678
MIRT610928	hsa-miR-4731-3p	HITS-CLIP	27418678
MIRT610928	hsa-miR-4731-3p	HITS-CLIP	27418678
MIRT614735	hsa-miR-4763-5p	HITS-CLIP	27418678
MIRT610927	hsa-miR-4801	HITS-CLIP	27418678
MIRT610927	hsa-miR-4801	HITS-CLIP	27418678
MIRT610924	hsa-miR-5589-3p	HITS-CLIP	27418678
MIRT610924	hsa-miR-5589-3p	HITS-CLIP	27418678
MIRT614732	hsa-miR-6894-3p	HITS-CLIP	27418678
MIRT610929	hsa-miR-8080	HITS-CLIP	27418678
MIRT610926	hsa-miR-8485	HITS-CLIP	27418678
MIRT610926	hsa-miR-8485	HITS-CLIP	27418678
MIRT734445	hsa-let-7b-5p	ELISALuciferase reporter assayqRT-PCR	33005103
MIRT736280	hsa-miR-143-3p	Microarray	32093694
MIRT610929	hsa-miR-8080	HITS-CLIP	23313552
MIRT610928	hsa-miR-4731-3p	HITS-CLIP	23313552
MIRT610927	hsa-miR-4801	HITS-CLIP	23313552
MIRT610926	hsa-miR-8485	HITS-CLIP	23313552
MIRT610925	hsa-miR-1197	HITS-CLIP	23313552
MIRT693837	hsa-miR-4457	HITS-CLIP	23313552
MIRT610924	hsa-miR-5589-3p	HITS-CLIP	23313552
MIRT610926	hsa-miR-8485	HITS-CLIP	23313552
MIRT610924	hsa-miR-5589-3p	HITS-CLIP	23313552
MIRT610929	hsa-miR-8080	HITS-CLIP	23824327
MIRT610928	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT610927	hsa-miR-4801	HITS-CLIP	23824327
MIRT610926	hsa-miR-8485	HITS-CLIP	23824327
MIRT610925	hsa-miR-1197	HITS-CLIP	23824327
MIRT610924	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT610928	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT610927	hsa-miR-4801	HITS-CLIP	23824327
MIRT610926	hsa-miR-8485	HITS-CLIP	23824327
MIRT610924	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT610929	hsa-miR-8080	HITS-CLIP	23824327
MIRT610928	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT610927	hsa-miR-4801	HITS-CLIP	23824327
MIRT610926	hsa-miR-8485	HITS-CLIP	23824327
MIRT610925	hsa-miR-1197	HITS-CLIP	23824327
MIRT610924	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT610929	hsa-miR-8080	HITS-CLIP	23824327
MIRT610928	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT610927	hsa-miR-4801	HITS-CLIP	23824327
MIRT610926	hsa-miR-8485	HITS-CLIP	23824327
MIRT610925	hsa-miR-1197	HITS-CLIP	23824327
MIRT610924	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT610929	hsa-miR-8080	HITS-CLIP	23824327
MIRT610928	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT610927	hsa-miR-4801	HITS-CLIP	23824327
MIRT610926	hsa-miR-8485	HITS-CLIP	23824327
MIRT610925	hsa-miR-1197	HITS-CLIP	23824327
MIRT610924	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT610929	hsa-miR-8080	HITS-CLIP	23824327
MIRT610928	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT610927	hsa-miR-4801	HITS-CLIP	23824327
MIRT610926	hsa-miR-8485	HITS-CLIP	23824327
MIRT610925	hsa-miR-1197	HITS-CLIP	23824327
MIRT610924	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT610928	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT610927	hsa-miR-4801	HITS-CLIP	23824327
MIRT610926	hsa-miR-8485	HITS-CLIP	23824327
MIRT610924	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT610929	hsa-miR-8080	HITS-CLIP	23824327
MIRT610928	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT610927	hsa-miR-4801	HITS-CLIP	23824327
MIRT610926	hsa-miR-8485	HITS-CLIP	23824327
MIRT610925	hsa-miR-1197	HITS-CLIP	23824327
MIRT610924	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT610929	hsa-miR-8080	HITS-CLIP	23824327
MIRT610928	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT610927	hsa-miR-4801	HITS-CLIP	23824327
MIRT610926	hsa-miR-8485	HITS-CLIP	23824327
MIRT610925	hsa-miR-1197	HITS-CLIP	23824327
MIRT610924	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT610929	hsa-miR-8080	HITS-CLIP	23824327
MIRT610928	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT610927	hsa-miR-4801	HITS-CLIP	23824327
MIRT610926	hsa-miR-8485	HITS-CLIP	23824327
MIRT610925	hsa-miR-1197	HITS-CLIP	23824327
MIRT610924	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT610929	hsa-miR-8080	HITS-CLIP	23824327
MIRT610928	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT610927	hsa-miR-4801	HITS-CLIP	23824327
MIRT610926	hsa-miR-8485	HITS-CLIP	23824327
MIRT610925	hsa-miR-1197	HITS-CLIP	23824327
MIRT610924	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT610929	hsa-miR-8080	HITS-CLIP	23824327
MIRT610928	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT610927	hsa-miR-4801	HITS-CLIP	23824327
MIRT610926	hsa-miR-8485	HITS-CLIP	23824327
MIRT610925	hsa-miR-1197	HITS-CLIP	23824327
MIRT610924	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT610929	hsa-miR-8080	HITS-CLIP	23824327
MIRT610928	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT610927	hsa-miR-4801	HITS-CLIP	23824327
MIRT610926	hsa-miR-8485	HITS-CLIP	23824327
MIRT610925	hsa-miR-1197	HITS-CLIP	23824327
MIRT610924	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT610929	hsa-miR-8080	HITS-CLIP	23824327
MIRT610928	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT610927	hsa-miR-4801	HITS-CLIP	23824327
MIRT610926	hsa-miR-8485	HITS-CLIP	23824327
MIRT610925	hsa-miR-1197	HITS-CLIP	23824327
MIRT610924	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT614735	hsa-miR-4763-5p	HITS-CLIP	23824327
MIRT614734	hsa-miR-518a-5p	HITS-CLIP	23824327
MIRT614733	hsa-miR-527	HITS-CLIP	23824327
MIRT614732	hsa-miR-6894-3p	HITS-CLIP	23824327
MIRT610928	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT610927	hsa-miR-4801	HITS-CLIP	23824327
MIRT610926	hsa-miR-8485	HITS-CLIP	23824327
MIRT610924	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT610928	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT610927	hsa-miR-4801	HITS-CLIP	23824327
MIRT610926	hsa-miR-8485	HITS-CLIP	23824327
MIRT610924	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT610929	hsa-miR-8080	HITS-CLIP	23824327
MIRT610928	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT610927	hsa-miR-4801	HITS-CLIP	23824327
MIRT610926	hsa-miR-8485	HITS-CLIP	23824327
MIRT610925	hsa-miR-1197	HITS-CLIP	23824327
MIRT610924	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT610929	hsa-miR-8080	HITS-CLIP	23824327
MIRT610928	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT610927	hsa-miR-4801	HITS-CLIP	23824327
MIRT610926	hsa-miR-8485	HITS-CLIP	23824327
MIRT610925	hsa-miR-1197	HITS-CLIP	23824327
MIRT610924	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT610929	hsa-miR-8080	HITS-CLIP	23824327
MIRT610928	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT610927	hsa-miR-4801	HITS-CLIP	23824327
MIRT610926	hsa-miR-8485	HITS-CLIP	23824327
MIRT610925	hsa-miR-1197	HITS-CLIP	23824327
MIRT610924	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT622038	hsa-miR-603	HITS-CLIP	23824327
MIRT622037	hsa-miR-4639-3p	HITS-CLIP	23824327
MIRT622036	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT622035	hsa-miR-6817-3p	HITS-CLIP	23824327
MIRT622034	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT622033	hsa-miR-3120-5p	HITS-CLIP	23824327
MIRT622032	hsa-miR-1180-5p	HITS-CLIP	23824327
MIRT622031	hsa-miR-7114-3p	HITS-CLIP	23824327
MIRT622030	hsa-miR-6895-3p	HITS-CLIP	23824327
MIRT622029	hsa-miR-593-3p	HITS-CLIP	23824327
MIRT622028	hsa-miR-6873-3p	HITS-CLIP	23824327
MIRT622027	hsa-miR-4753-3p	HITS-CLIP	23824327
MIRT622026	hsa-miR-6888-3p	HITS-CLIP	23824327
MIRT622025	hsa-miR-6818-3p	HITS-CLIP	23824327
MIRT622024	hsa-miR-4768-5p	HITS-CLIP	23824327
MIRT622023	hsa-miR-6833-3p	HITS-CLIP	23824327
MIRT622022	hsa-miR-6809-3p	HITS-CLIP	23824327
MIRT610929	hsa-miR-8080	HITS-CLIP	23824327
MIRT610928	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT610927	hsa-miR-4801	HITS-CLIP	23824327
MIRT610926	hsa-miR-8485	HITS-CLIP	23824327
MIRT610925	hsa-miR-1197	HITS-CLIP	23824327
MIRT610924	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT614735	hsa-miR-4763-5p	HITS-CLIP	23824327
MIRT614734	hsa-miR-518a-5p	HITS-CLIP	23824327
MIRT614733	hsa-miR-527	HITS-CLIP	23824327
MIRT614732	hsa-miR-6894-3p	HITS-CLIP	23824327
MIRT610929	hsa-miR-8080	HITS-CLIP	23824327
MIRT610928	hsa-miR-4731-3p	HITS-CLIP	23824327
MIRT610927	hsa-miR-4801	HITS-CLIP	23824327
MIRT610926	hsa-miR-8485	HITS-CLIP	23824327
MIRT610925	hsa-miR-1197	HITS-CLIP	23824327
MIRT610924	hsa-miR-5589-3p	HITS-CLIP	23824327
MIRT1395997	hsa-miR-1914	CLIP-seq
MIRT1395998	hsa-miR-371-5p	CLIP-seq
MIRT1395999	hsa-miR-4521	CLIP-seq
MIRT1396000	hsa-miR-4639-5p	CLIP-seq
MIRT1396001	hsa-miR-888	CLIP-seq
MIRT2118723	hsa-miR-147	CLIP-seq
MIRT2118724	hsa-miR-3622a-5p	CLIP-seq
MIRT2118725	hsa-miR-3692	CLIP-seq
MIRT2118726	hsa-miR-3911	CLIP-seq
MIRT2118727	hsa-miR-3941	CLIP-seq
MIRT2118728	hsa-miR-4269	CLIP-seq
MIRT2118729	hsa-miR-466	CLIP-seq
MIRT2118730	hsa-miR-4672	CLIP-seq
MIRT2118731	hsa-miR-4717-3p	CLIP-seq
MIRT2118732	hsa-miR-4719	CLIP-seq
MIRT2118733	hsa-miR-593	CLIP-seq
MIRT2118734	hsa-miR-644	CLIP-seq
MIRT2340975	hsa-miR-3127-3p	CLIP-seq
MIRT2340976	hsa-miR-3922-5p	CLIP-seq
MIRT2340977	hsa-miR-4717-5p	CLIP-seq
MIRT2340978	hsa-miR-4753-5p	CLIP-seq
MIRT2634863	hsa-miR-1307	CLIP-seq
MIRT2634864	hsa-miR-1469	CLIP-seq
MIRT2634865	hsa-miR-432	CLIP-seq
MIRT2634866	hsa-miR-4659a-5p	CLIP-seq
MIRT2634867	hsa-miR-4659b-5p	CLIP-seq
MIRT2340977	hsa-miR-4717-5p	CLIP-seq
MIRT2634868	hsa-miR-4766-5p	CLIP-seq
MIRT2634869	hsa-miR-583	CLIP-seq
MIRT2118733	hsa-miR-593	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
PPARA	Unknown	21542777

115

Show/Hide all (115)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000278	Process	Mitotic cell cycle	IEA
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0001553	Process	Luteinization	IEA
GO:0001779	Process	Natural killer cell differentiation	IEA
GO:0001938	Process	Positive regulation of endothelial cell proliferation	IMP	20489169
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IDA	7568001, 8580378, 8631883, 9516478, 10919676, 12393707, 20974963
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003700	Function	DNA-binding transcription factor activity	TAS	7719937, 8631883
GO:0005515	Function	Protein binding	IPI	12237455, 16819511, 20075866, 24658140, 25416956, 31980649
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IC	7568001, 8631883, 12393707, 20974963
GO:0005634	Component	Nucleus	IDA	9516478
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	TAS	8631883
GO:0006366	Process	Transcription by RNA polymerase II	IEA
GO:0006952	Process	Defense response	IBA
GO:0007165	Process	Signal transduction	IEA
GO:0007259	Process	Cell surface receptor signaling pathway via JAK-STAT	IBA
GO:0007259	Process	Cell surface receptor signaling pathway via JAK-STAT	IEA
GO:0007259	Process	Cell surface receptor signaling pathway via JAK-STAT	NAS	24058793
GO:0007259	Process	Cell surface receptor signaling pathway via JAK-STAT	TAS	7719937
GO:0007565	Process	Female pregnancy	IEA
GO:0007595	Process	Lactation	IEA
GO:0007595	Process	Lactation	IEA
GO:0008283	Process	Cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0019218	Process	Regulation of steroid metabolic process	IEA
GO:0019221	Process	Cytokine-mediated signaling pathway	IBA
GO:0019221	Process	Cytokine-mediated signaling pathway	IEA
GO:0019221	Process	Cytokine-mediated signaling pathway	IEA
GO:0019530	Process	Taurine metabolic process	IEA
GO:0019530	Process	Taurine metabolic process	ISS
GO:0019915	Process	Lipid storage	IEA
GO:0030098	Process	Lymphocyte differentiation	IEA
GO:0030155	Process	Regulation of cell adhesion	IEA
GO:0030183	Process	B cell differentiation	IEA
GO:0030218	Process	Erythrocyte differentiation	IEA
GO:0030222	Process	Eosinophil differentiation	IDA	12393707
GO:0030856	Process	Regulation of epithelial cell differentiation	IEA
GO:0030879	Process	Mammary gland development	IEA
GO:0032743	Process	Positive regulation of interleukin-2 production	IEA
GO:0032825	Process	Positive regulation of natural killer cell differentiation	IEA
GO:0033024	Process	Mast cell apoptotic process	IEA
GO:0033026	Process	Negative regulation of mast cell apoptotic process	IEA
GO:0033028	Process	Myeloid cell apoptotic process	IEA
GO:0033033	Process	Negative regulation of myeloid cell apoptotic process	IEA
GO:0033077	Process	T cell differentiation in thymus	IEA
GO:0035723	Process	Interleukin-15-mediated signaling pathway	IDA	7568001
GO:0035771	Process	Interleukin-4-mediated signaling pathway	IDA	17200144
GO:0038026	Process	Reelin-mediated signaling pathway	IDA	29581031
GO:0038043	Process	Interleukin-5-mediated signaling pathway	IDA	12393707
GO:0038110	Process	Interleukin-2-mediated signaling pathway	IDA	8631883
GO:0038111	Process	Interleukin-7-mediated signaling pathway	IDA	20974963
GO:0038113	Process	Interleukin-9-mediated signaling pathway	IDA	10919676
GO:0038156	Process	Interleukin-3-mediated signaling pathway	IDA	22102340
GO:0038163	Process	Thrombopoietin-mediated signaling pathway	IDA	9122198
GO:0040014	Process	Regulation of multicellular organism growth	IEA
GO:0040014	Process	Regulation of multicellular organism growth	ISS
GO:0040018	Process	Positive regulation of multicellular organism growth	IEA
GO:0042098	Process	T cell proliferation	IEA
GO:0042102	Process	Positive regulation of T cell proliferation	IEA
GO:0042104	Process	Positive regulation of activated T cell proliferation	IEA
GO:0042127	Process	Regulation of cell population proliferation	IBA
GO:0042267	Process	Natural killer cell mediated cytotoxicity	IEA
GO:0042301	Function	Phosphate ion binding	IEA
GO:0042492	Process	Gamma-delta T cell differentiation	IEA
GO:0043029	Process	T cell homeostasis	IEA
GO:0043434	Process	Response to peptide hormone	IBA
GO:0043434	Process	Response to peptide hormone	IEA
GO:0043536	Process	Positive regulation of blood vessel endothelial cell migration	IMP	20489169
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0045579	Process	Positive regulation of B cell differentiation	IEA
GO:0045588	Process	Positive regulation of gamma-delta T cell differentiation	IEA
GO:0045621	Process	Positive regulation of lymphocyte differentiation	IEA
GO:0045647	Process	Negative regulation of erythrocyte differentiation	IEA
GO:0045931	Process	Positive regulation of mitotic cell cycle	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	NAS	24058793
GO:0045954	Process	Positive regulation of natural killer cell mediated cytotoxicity	IEA
GO:0046543	Process	Development of secondary female sexual characteristics	IEA
GO:0046544	Process	Development of secondary male sexual characteristics	IEA
GO:0048541	Process	Peyer's patch development	IEA
GO:0050729	Process	Positive regulation of inflammatory response	IEA
GO:0050798	Process	Activated T cell proliferation	IEA
GO:0060374	Process	Mast cell differentiation	IEA
GO:0060376	Process	Positive regulation of mast cell differentiation	IEA
GO:0060397	Process	Growth hormone receptor signaling pathway via JAK-STAT	IBA
GO:0060397	Process	Growth hormone receptor signaling pathway via JAK-STAT	IEA
GO:0060740	Process	Prostate gland epithelium morphogenesis	IEA
GO:0060742	Process	Epithelial cell differentiation involved in prostate gland development	IEA
GO:0061180	Process	Mammary gland epithelium development	IEA
GO:0070662	Process	Mast cell proliferation	IEA
GO:0070668	Process	Positive regulation of mast cell proliferation	IEA
GO:0090575	Component	RNA polymerase II transcription regulator complex	IBA
GO:0090575	Component	RNA polymerase II transcription regulator complex	NAS	24058793
GO:0097011	Process	Cellular response to granulocyte macrophage colony-stimulating factor stimulus	IEA
GO:0140297	Function	DNA-binding transcription factor binding	IPI	35939714
GO:1903706	Process	Regulation of hemopoiesis	IEA
GO:2000329	Process	Negative regulation of T-helper 17 cell lineage commitment	IDA	20696842

MIM	HGNC	e!Ensembl
601511	11366	ENSG00000126561

P42229

Protein name

Signal transducer and activator of transcription 5A

Protein function

Carries out a dual function: signal transduction and activation of transcription. Mediates cellular responses to the cytokine KITLG/SCF and other growth factors. Mediates cellular responses to ERBB4. May mediate cellular responses to activated F

PDB

7TVA , 7TVB , 7UBT , 7UC6 , 7UC7

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02865	STAT_int	2 → 124	STAT protein, protein interaction domain	Domain
PF01017	STAT_alpha	141 → 324	STAT protein, all-alpha domain	Family
PF02864	STAT_bind	336 → 469	STAT protein, DNA binding domain	Domain
PF00017	SH2	589 → 670	SH2 domain	Domain

Sequence

MAGWIQAQQLQGDALRQMQVLYGQHFPIEVRHYLAQWIESQPWDAIDLDNPQDRAQATQL
LEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQKTYDRCPLELVRCIRHILYNEQRLV
REANNCSSPAGILVDAMSQKHLQINQTFEELRLVTQDTENELKKLQQTQEYFIIQYQESL
RIQAQFAQLAQLSPQERLSRETALQQKQVSLEAWLQREAQTLQQYRVELAEKHQKTLQLL
RKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQIRRAEHLC
QQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAATVRLLVGGKL
NVHMNPPQVKATIISEQQAKSLLKNENTRNECSGEILNNCCVMEYHQATGTLSAHFRNMS
LKRIKRADRRGAESVTEEKFTVLFESQFSVGSNELVFQVKTLSLPVVVIVHGSQDHNATA
TVLWDNAFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNN
SSSHLEDYSGLSVSWSQFNRENLPGWNYTFWQWFDGVMEVLKKHHKPHWNDGAILGFVNK
QQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSPERNLWNLKPFTTRDFSIRSLADRL
GDLSYLIYVFPDRPKDEVFSKYYTPVLAKAVDGYVKPQIKQVVPEFVNASADAGGSSATY
MDQAPSPAVCPQAPYNMYPQNPDHVLDQDGEFDLDETMDVARHVEELLRRPMDSLDSRLS
PPAGLFTSARGSLS

Sequence length

794

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (11)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, DUCTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, INTRADUCTAL, NONINFILTRATING	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, LOBULAR	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal atresia	Uncertain significance	ClinVar Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pyloric stenosis	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (362)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Achondroplasia	Achondroplasia	BEFREE	19802676		★★★★★ ★☆☆☆☆ Found in Text Mining only
Achondroplasia	Achondroplasia	Pubtator	19802676	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Acquired Hypogammaglobulinemia	Common Variable Immunodeficiency	BEFREE	30064289		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	25572535		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	BEFREE	20667821, 8861946		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	9498707		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	18193087, 20227268, 21606506, 22685175, 30784762, 8634413		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	28667329		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	11929748		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Undifferentiated Leukemia	Leukemia	BEFREE	19667399		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	14696092		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	CTD_human_DG	20235097, 21552421		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	20717961, 21826656		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	21617857		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Basal Cell	Adenocarcinoma	CTD_human_DG	20235097, 21552421		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Oxyphilic	Adenocarcinoma	CTD_human_DG	20235097, 21552421		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Tubular	Adenocarcinoma	CTD_human_DG	20235097, 21552421		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenocortical carcinoma	Adrenocortical carcinoma	BEFREE	12697691		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	18193087, 21606506, 30784762, 8634413		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	11781246		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	10348340, 21106989		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	32854783, 33239300	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	17531227, 19572220		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic carcinoma	Anaplastic Carcinoma	CTD_human_DG	12376462, 16316942, 17173897		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	29389768		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia Aplastic	Aplastic anemia	Pubtator	33586472	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	27901054		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	27035235, 31395607		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	21493888, 21764069, 25993293	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	25993293		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	21971318		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	25164131, 27629845, 31167762, 31181818, 32998457, 33362761, 35887269, 36726974	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	35706043	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	16081849	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	BEFREE	22970180		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Astrocytoma	Astrocytoma	BEFREE	25907517		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	20334914	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atypical Ductal Breast Hyperplasia	Breast Hyperplasia	CTD_human_DG	15609129		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	28802860		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	22461703	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	31569642		★★★★★ ★☆☆☆☆ Found in Text Mining only
B Acute Lymphoblastic Leukemia with t(9;22)(q34.1;q11.2); BCR-ABL1	Lymphoblastic Leukemia	BEFREE	22895079, 29578162, 30154155		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	16532027, 16819511, 22231445, 25651400, 27436361, 29365089		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	30988120		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	17947454	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	29156772		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	30038233		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	BEFREE	22234689		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Diseases Metabolic	Bone disease	Pubtator	26390436	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Cerebral Ischemia	BEFREE	20494600		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	20336349		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	12374673, 12459712, 15592524, 15686596, 16139998, 16155412, 17546596, 17639043, 18228120, 18378698, 19262752, 19491198, 20124477, 20237142, 21205088 View all (23 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	15609129		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	12888825, 15686596, 16253990, 18254957, 18271926, 18378698, 19014541, 19036881, 19262752, 19491198, 20854925, 20952588, 21205088, 21576635, 21964595 View all (18 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	36862902, 38124049	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bronchiolitis	Bronchiolitis	Pubtator	26541527	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cancer Pain	Cancer	Pubtator	14521520	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	19290007, 23915238, 31646566, 33227411, 34188118	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	CTD_human_DG	12376462, 16316942, 17173897		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma	Carcinoma	BEFREE	23931576		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma Ductal	Ductal carcinoma	Pubtator	24384092	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	31485610, 33155364, 35871161, 36994687	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	36374927	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	26146825	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	25586740, 29752311, 30621055		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	27035235, 39684873	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	17279417, 20339477, 22363690, 26911335, 31401673	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	31323143		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Cribriform	Carcinoma	CTD_human_DG	20235097, 21552421		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Granular Cell	Carcinoma	CTD_human_DG	20235097, 21552421		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	20585448		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Spindle-Cell	Carcinoma	CTD_human_DG	12376462, 16316942, 17173897		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Hypoxia-Ischemia	Cerebral Hypoxia-Ischemia	BEFREE	20494600		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	30676545		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	15337523		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	15337523		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	18193087, 21606506, 30784762, 8634413		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	35683032	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholesteatoma	Cholesteatoma	BEFREE	24321752		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholesterol gallstones	Cholesterol gallstones	BEFREE	27816761		★★★★★ ★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	27452437, 29377304		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chromosome 11p11.2 Deletion Syndrome	11p11.2 Deletion Syndrome	BEFREE	30150979		★★★★★ ★☆☆☆☆ Found in Text Mining only
CHROMOSOME 8p11 MYELOPROLIFERATIVE SYNDROME	8p11 Myeloproliferative Syndrome	BEFREE	22781593		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	17376889	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic eosinophilic leukemia	Eosinophilic Leukemia	BEFREE	22523564		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	29619880, 29738538, 31526861		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	24155890, 27367207, 30988120		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	18479730, 19747364, 20028972, 22144185, 22234689, 22500049, 23386690, 23445613, 24681953, 26754830, 27418650, 28260027, 29202466		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	29454913		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic osteomyelitis	Osteomyelitis	BEFREE	31555698		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	30615095		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	23733954, 24097071, 30952709		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	19290007, 21234733	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	30013992	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	21826656, 22121102, 22367509, 23173124, 27769746, 29118272, 29763380, 30013992, 30670049		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	19290007, 20196786, 21234733, 22121102, 24097071, 29118272, 30013992, 30670049, 31718693, 35502613	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Combined immunodeficiency	Severe combined immunodeficiency disease	GENOMICS_ENGLAND_DG	16418296		★★★★★ ★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common Variable Immunodeficiency	BEFREE	30064289		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital neutropenia	Congenital Neutropenia	BEFREE	11146160, 18513286, 28073911		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	28453725		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	31401673		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	27997991	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	27997991		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Restenosis	Coronary restenosis	Pubtator	35144391	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Craniosynostoses	Craniosynostosis	Pubtator	36312898	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	23929016, 26278503		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	26278503	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystitis Interstitial	Interstitial cystitis	Pubtator	39399486	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia, Vascular	Dementia	BEFREE	28488208		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	24412367, 31556482		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	24412367		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatofibrosarcoma Protuberans	Dermatofibrosarcoma Protuberans	BEFREE	29492209		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	17130555, 18927468		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	17130555, 18927468		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	24204704	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	17030965	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	31332162	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	24204704, 27560779, 27840176		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	17030965, 22322482, 31332162		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Foot	Diabetic foot	Pubtator	35394091	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	23242724	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	15180953, 22322482		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	18755494		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	CTD_human_DG	15609129		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	BEFREE	28253502		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyserythropoietic Anemia with Thrombocytopenia	Dyserythropoietic anemia with thrombocytopenia	Pubtator	36952639	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Eclampsia	Eclampsia	BEFREE	27452437		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	24412367		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	29951943, 35244291	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	24133578	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Enteritis	Enteritis	BEFREE	23929016		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	21819482		★★★★★ ★☆☆☆☆ Found in Text Mining only
Erythrocytosis familial, 1	Erythrocytosis	BEFREE	10498627, 9923445		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	23915238, 32536038	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	31037126	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial erythrocytosis	Erythrocytosis	BEFREE	10498627, 9923445		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	21330473		★★★★★ ★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP A (disorder)	Anemia	BEFREE	21330473		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatigue Syndrome Chronic	Fatigue syndrome	Pubtator	18596870	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	21622209, 29402841		★★★★★ ★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant cell arteritis	Pubtator	35045965	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Giant Cell Fibroblastoma	Giant Cell Fibroblastoma	BEFREE	29492209		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	21214269, 22729867, 23250732, 24821382, 24878107, 29724813		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	23250732, 27788487, 28157712, 29724813, 33104022	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	21214269, 22729867, 23250732, 24821382, 24878107, 29724813		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	24821382, 29724813		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	37616578	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	31490767		★★★★★ ★☆☆☆☆ Found in Text Mining only
Granulomatosis with Polyangiitis	Granulomatosis with polyangiitis	Pubtator	35039330	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	33912135	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hamartoma Syndrome, Multiple	Hamartoma	BEFREE	24469394		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	11973644, 15578920		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head And Neck Neoplasms	LHGDN	11973644		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	28453725		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	16459186, 17038539, 18336085, 21106534, 24155890, 24435449, 25524945, 28202313, 30783189, 31490767		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	24435449, 24910998, 26717567, 27566554, 27853239, 37830151	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematopoietic Neoplasms	Hematopoietic Neoplasms	BEFREE	11973644, 12459712, 27566554, 30783189, 31817042		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	27315061	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	Pubtator	38071211	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	30394935	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Leiomyomatosis and Renal Cell Cancer	Hereditary Leiomyomatosis and Renal Cancer	BEFREE	28011673		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	11781246, 12208876, 28453725		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	12208876, 18296629	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	28453725		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypereosinophilic Syndrome	Hypereosinophilic syndrome	Pubtator	38563187	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypergammaglobulinemia	Hypergammaglobulinemia	BEFREE	25736842		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	29088862		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperprolactinemia	Hyperprolactinemia	BEFREE	29778097		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	25470773		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperthyroidism	Hyperthyroidism	BEFREE	27919641		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	BEFREE	31366244		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	21698228	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	25216946, 29673911, 30140283		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary hypertension	Pulmonary Hypertension	BEFREE	25470773		★★★★★ ★☆☆☆☆ Found in Text Mining only
IMMUNODEFICIENCY 13	Immunodeficiency	BEFREE	22454463		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	26278503		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	26278503, 31732533	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	24412367, 31556482		★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	36238467, 38018587	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
insulinoma	Insulinoma	BEFREE	11145745		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intraepithelial Neoplasia	Intraepithelial Neoplasia	BEFREE	20699217, 23180448		★★★★★ ★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	24384092		★★★★★ ★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron Overload	BEFREE	31838956		★★★★★ ★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron overload	Pubtator	31838956	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	30676545		★★★★★ ★☆☆☆☆ Found in Text Mining only
Isolated somatotropin deficiency	Isolated Somatotropin Deficiency	BEFREE	21470284		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile Myelomonocytic Leukemia	Myelomonocytic Leukemia	BEFREE	26456833, 27418650		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	31401673	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Laron Syndrome	Laron Syndrome	BEFREE	12072393		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	10090948, 10536003, 10812249, 11313280, 17630355, 19709433, 19956772, 21091189, 21356308, 23451206, 24435449, 24761846, 25953263, 27566554, 30185437 View all (5 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	10729993, 15514005, 15578097, 15652752, 16303247, 16502315, 18536571, 19667399, 20227268, 20508164, 21091189, 21220747, 22126101, 22234689, 23451206 View all (14 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	11313280, 27566554, 31546234, 32667731, 39746237	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	10586114, 11698483, 12351411, 12663443, 16946300, 17630355, 21048955, 25006129, 28204819, 28667329, 31434952, 32024878, 32393312, 33948920, 35839275 View all (7 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	11027834, 15498775, 24394665	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myelomonocytic Juvenile	Myelomonocytic leukemia	Pubtator	18835035, 23620576, 26456833	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	11929749, 17913706	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Large Granular Lymphocytic	Lymphoblastic Leukemia	BEFREE	23596048		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Mast-Cell	Leukemia	BEFREE	28011673		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	10698507, 11753614, 12351411, 15128421, 16464493, 17630355, 19036083, 20066533, 22725130, 23509157, 23564444, 24282218, 24394665, 24668492, 25092144 View all (17 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	LHGDN	15313458, 17169805, 18616510		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	21106989		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	16172916		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lipoma	Lipoma	BEFREE	24681953		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lipoma	Lipoma	Pubtator	24681953	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lipomatosis, Multiple	Lipomatosis	BEFREE	24681953		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	17047057, 21793836, 22296499, 27585821, 29340101, 31409773, 31564902, 9647240		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	28176332	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	9647240		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	18461184		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	CTD_human_DG	21552421		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung neoplasms	Pubtator	22348039	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	25187566	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	27216430, 28254841, 31263070		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	21234733	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	40003884	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoid leukemia	Lymphoid leukemia	BEFREE	30784762		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	15870688, 16502315, 19363496, 24435449, 30783189, 31601188		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	LHGDN	17922009, 18483262		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	19363496, 21418178, 23372669, 24435449, 8704235	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	23451206	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	20388848		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	12543077, 16502315, 23676217, 26244872, 27329723		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	LHGDN	16502315		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphopenia	Lymphopenia	BEFREE	28387753		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	30038233		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	11973644, 15578920		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	12374673, 12459712, 15592524, 15686596, 16139998, 16155412, 17546596, 17639043, 18228120, 18378698, 19262752, 19491198, 20124477, 20237142, 21205088 View all (23 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	15609129		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	31401673		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	30377054		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	CTD_human_DG	21552421		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	22348039, 25586740, 29752311, 30621055		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	16172916		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	20585448		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	12719422, 15256446, 18172316, 18316550, 20233708, 20699217, 20854925, 20966544, 21216933, 21704724, 21971318, 23660011, 25552366, 29483142, 31292140, 31817042 View all (1 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of salivary gland	Malignant neoplasm of salivary gland	BEFREE	26252941		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	22328012, 30367831		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11948098, 12865928, 15677477, 15686596, 16459186, 16819511, 17651480, 18228120, 18492722, 18835035, 19014541, 20073576, 20233708, 21860432, 22296499 View all (38 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	15337523		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	23733954, 24097071, 30952709		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	15609129		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	14696092, 15169792, 15592524, 16954437, 18271926		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	15609129		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	15976008, 16954437, 18228120, 21704724		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	15609129		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	28011673		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mastocytosis	Mastocytosis	BEFREE	18579792, 19383925, 24598853, 30018080		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mastocytosis Systemic	Systemic mastocytosis	Pubtator	19747364, 19893034, 21457934	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mastocytosis, Systemic	Mastocytosis	BEFREE	17662084, 19893034, 21457934, 24598853, 30018080		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	16169484, 16741510, 30358226	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	29485532, 31569642		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	36901697	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	27987139	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	27858140		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	28974560, 7687762		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	34318593	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	25039241	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	14726660, 22177381	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	29857127		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	28213589		★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy	Muscular dystrophy	BEFREE	16463438, 20494600		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mycosis Fungoides	Mycosis fungoides	Pubtator	25779945	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	11027834		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	10460607, 11861273, 31838956, 9057652	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelofibrosis	Myelofibrosis	BEFREE	16871275, 22234689, 23386690, 23445613, 24116232, 29650953		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	16459186, 17038539, 27418650, 28654259		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	10727459, 12483533, 15089759, 15128421, 16278304, 17503465, 18537972, 21091189, 21220747, 21356308, 22234689, 22285998, 23233089, 23370613, 23400594 View all (26 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	LHGDN	16572323		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	20028972, 20966544, 21749449, 22234689, 22500049, 23445613, 27418650, 31490767		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloproliferative Disorders	Myeloproliferative disorder	Pubtator	17440089, 21233313	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	CTD_human_DG	15746188		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nasal Polyps	Nasal polyposis	BEFREE	22959364		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	23063330	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	11222718, 12634372, 12865928	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	12865928, 18941378		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11222718, 14741732, 15256446, 15592524, 16532027, 16532038, 16954437, 17021139, 17047057, 17922009, 18316550, 19047094, 19851315, 19966185, 20717961 View all (38 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrosis	Nephrosis	BEFREE	19473628		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic Syndrome	BEFREE	19473628		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic syndrome	Pubtator	28433687, 35734930	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural tube defect	Pubtator	38563187	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurilemmoma	Neurilemmoma	BEFREE	12444102		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	16407271, 17045782		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	18325115, 31475882	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neutropenia Severe Congenital Autosomal Recessive 3	Severe congenital neutropenia	Pubtator	11146160	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	31409773, 31491605		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	20073576, 21617857, 25137041, 29137269, 29345289		★★★★★ ★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	CTD_human_DG	15609129		★★★★★ ★☆☆☆☆ Found in Text Mining only
Noonan Syndrome	Noonan Syndrome	BEFREE	26456833		★★★★★ ★☆☆☆☆ Found in Text Mining only
Noonan Syndrome	Noonan syndrome	Pubtator	26456833	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	17030965, 29111497, 9748302		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	17030965	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	12459712, 16954437		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	33879632	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteomyelitis	Osteomyelitis	Pubtator	32954739	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	40496565	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis, Age-Related	Osteoporosis	BEFREE	30429452		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	30638860		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	20585448		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	20585448, 28536310, 36276992	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	33099939	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	34536521	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
PEELING SKIN SYNDROME	Peeling Skin Syndrome	BEFREE	30150979		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	29682185, 31123029, 31545408		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Diseases	Polycystic kidney disease	BEFREE	28202165		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	BEFREE	28104302		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycythemia	Polycythemia	BEFREE	22234689, 26706855		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycythemia	Polycythemia	Pubtator	38629639	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycythemia primary familial and congenital	Polycythemia, primary familial and congenital	Pubtator	10498627	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia vera	Pubtator	16684963, 21355091, 38563187, 38629639	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia Vera	BEFREE	17533047, 20013324, 21355091, 22144185, 22234689, 28260027, 7589339		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	22234689, 28369050		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	20227268, 21606506, 22685175, 30784762		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	21261500, 30185437, 31687977		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	29429758		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary Myelofibrosis	Myelofibrosis	BEFREE	17255768, 17376889, 20113333, 22234689, 23386690, 23445613, 24116232, 28260027, 29650953, 31369569		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prolactinoma	Prolactinoma	BEFREE	23180448		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	12719422, 15256446, 18172316, 18316550, 20233708, 20699217, 20854925, 20966544, 21216933, 21704724, 21971318, 23660011, 25552366, 29483142, 31292140, 31817042 View all (1 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	28216616	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	12719422, 19567780, 20053773, 20854925, 20966544, 22081596, 23026195, 25552366, 31292140, 32397189, 32790723	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	16115927, 18172316		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	18316550, 20966544, 28440368, 31269779		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	34206428	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	31401673		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	31401673		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	24821571, 30990758		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	22342385, 31181818		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	19036083		★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency disease	BEFREE	12197892, 31799703		★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency	Pubtator	30032486	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary Syndrome	BEFREE	14695224, 27329723		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary syndrome	Pubtator	25779945	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	25736842	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	30150979	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	36072585	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin carcinoma	Skin Carcinoma	BEFREE	31323143		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	30544712		★★★★★ ★☆☆☆☆ Found in Text Mining only
Somatotropin deficiency	Somatotropin Deficiency	BEFREE	21470284		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinal Muscular Atrophy	Spinal Muscular Atrophy	BEFREE	17220171		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	16172916, 16303247, 22090359		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	16303247		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	23915238		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	12771142, 24192080, 27038552, 36097539	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	11973644, 19047094		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	22328012, 30367831		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	31646566, 32086862	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	30150979		★★★★★ ★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	27732937		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tetralogy of Fallot	Tetralogy of fallot	Pubtator	28329231	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombocythemia, Essential	Thrombocythemia	BEFREE	16923108, 17255768, 20113333, 21749449, 26754830, 28260027		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombocytosis	Thrombocytosis	BEFREE	26754830		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thymoma	Thymoma	BEFREE	18482053		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tyrosine Kinase 2 Deficiency	Tyrosine kinase 2 deficiency	Pubtator	34635505, 34811450	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	LHGDN	16804404		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	26278503		★★★★★ ★☆☆☆☆ Found in Text Mining only
Undifferentiated carcinoma	Carcinoma	CTD_human_DG	12376462, 16316942, 17173897		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uremia	Uremia	BEFREE	22322482		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	29517678	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	39684873	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	35492074	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	20489169, 30140283		★★★★★ ★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom`s Macroglobulinemia	BEFREE	24335105		★★★★★ ★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom macroglobulinemia	Pubtator	24335105	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

STAT5A (signal transducer and activator of transcription 5A)