SMIM43 (small integral membrane protein 43)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 132332
Gene name Small integral membrane protein 43
Gene symbol SMIM43
Synonyms (NCBI Gene)
NEMEPTMEM155
Chromosome 4
Chromosome location 4q27
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q4W5P6
Protein name Small integral membrane protein 43 (Nodal enhanced mesendoderm micropeptide) (NEMEP)
Protein function Required for mesendoderm differentiation (By similarity). Interacts with glucose transporters and promotes glucose uptake (PubMed:35810171). Probably augments the glucose uptake capacity of glucose transporter proteins to meet the energy needs o
Family and domains
Sequence 
MEWELNLLLYLALFFFLLFLLFLLLFVVIKQLKNSVANTAGALQPGRLSVHREPWGFSRE
QAV
Sequence length 63
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
3
Download as csvDownload as pdf
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Reference Evidence Score
DIABETES MELLITUS, NON-INSULIN-DEPENDENT — Disgenet —
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, TYPE 2 — CTD 28869590
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS — GWAS catalog 17554300, 28869590
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Diabetes Mellitus, Non-Insulin-Dependent Diabetes Mellitus CTD_human_DG 28869590
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Sort by:
EPC2 2 shared evidence sourcesDisgenet (Diabetes mellitus type 2), CTD (Diabetes mellitus type 2) Related via 2 shared evidence sources. KCNK16 2 shared evidence sourcesDisgenet (Diabetes mellitus type 2), CTD (Diabetes mellitus type 2) Related via 2 shared evidence sources. MAEA 2 shared evidence sourcesDisgenet (Diabetes mellitus type 2), CTD (Diabetes mellitus type 2) Related via 2 shared evidence sources. PSMD6 2 shared evidence sourcesDisgenet (Diabetes mellitus type 2), CTD (Diabetes mellitus type 2) Related via 2 shared evidence sources. SCTR 2 shared evidence sourcesDisgenet (Diabetes mellitus type 2), CTD (Diabetes mellitus type 2) Related via 2 shared evidence sources.
Alzheimer disease Linked via 1 of 5 related genesEPC2 Schizophrenia Linked via 1 of 5 related genesEPC2 Obesity Linked via 1 of 5 related genesMAEA Metabolic syndrome Linked via 1 of 5 related genesPSMD6