Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Other IDs Associated diseases
Entrez ID	6093
Gene name	Rho associated coiled-coil containing protein kinase 1
Gene symbol	ROCK1
Synonyms (NCBI Gene)	P160ROCKROCK-I
Chromosome	18
Chromosome location	18q11.1
Summary	This gene encodes a protein serine/threonine kinase that is activated when bound to the GTP-bound form of Rho. The small GTPase Rho regulates formation of focal adhesions and stress fibers of fibroblasts, as well as adhesion and aggregation of platelets a

Show/Hide all (1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs1057520015	G>A	Likely-pathogenic	Missense variant, coding sequence variant

409

Show/Hide all (409)

miRTarBase ID	miRNA	Experiments	Reference
MIRT000945	hsa-miR-146a-5p	flowWestern blotNorthern blot	18174313
MIRT000945	hsa-miR-146a-5p	Luciferase reporter assay	18174313
MIRT004047	hsa-miR-584-5p	ImmunohistochemistryLuciferase reporter assayMicroarrayqRT-PCRWestern blot	21119662
MIRT004047	hsa-miR-584-5p	ImmunohistochemistryLuciferase reporter assayMicroarrayqRT-PCRWestern blot	21119662
MIRT006776	hsa-miR-124-3p	Luciferase reporter assay	22085528
MIRT006776	hsa-miR-124-3p	Luciferase reporter assay	22085528
MIRT007315	hsa-miR-148b-3p	Western blot	23238785
MIRT007315	hsa-miR-148b-3p	Western blot	23238785
MIRT053076	hsa-miR-335-5p	Luciferase reporter assayqRT-PCRWestern blot	23975506
MIRT053483	hsa-miR-148a-3p	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	21994419
MIRT006776	hsa-miR-124-3p	Luciferase reporter assayqRT-PCRWestern blot	25169484
MIRT006776	hsa-miR-124-3p	Luciferase reporter assayqRT-PCRWestern blot	25169484
MIRT054402	hsa-miR-135a-5p	ImmunohistochemistryLuciferase reporter assayWestern blot	24465504
MIRT007315	hsa-miR-148b-3p	Luciferase reporter assay	23233531
MIRT007315	hsa-miR-148b-3p	Luciferase reporter assay	23233531
MIRT007315	hsa-miR-148b-3p	Luciferase reporter assay	23233531
MIRT053483	hsa-miR-148a-3p	Luciferase reporter assay	23670799
MIRT438654	hsa-miR-340-5p	Luciferase reporter assayqRT-PCRWestern blot	23872151
MIRT438654	hsa-miR-340-5p	Luciferase reporter assayqRT-PCRWestern blot	23872151
MIRT438282	hsa-miR-145-5p	Luciferase reporter assayWestern blot	24573110
MIRT438282	hsa-miR-145-5p	Luciferase reporter assayWestern blot	24573110
MIRT006776	hsa-miR-124-3p	Luciferase reporter assayWestern blotqRT-PCR	23936026
MIRT054402	hsa-miR-135a-5p	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	24465504
MIRT054402	hsa-miR-135a-5p	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	24465504
MIRT438654	hsa-miR-340-5p	Luciferase reporter assayqRT-PCRWestern blot	23872151
MIRT438654	hsa-miR-340-5p	Luciferase reporter assayqRT-PCRWestern blot	23872151
MIRT438282	hsa-miR-145-5p	Luciferase reporter assayWestern blot	24573110
MIRT438282	hsa-miR-145-5p	Luciferase reporter assayWestern blot	24573110
MIRT006776	hsa-miR-124-3p	Luciferase reporter assayWestern blotqRT-PCR	23936026
MIRT054402	hsa-miR-135a-5p	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	24465504
MIRT054402	hsa-miR-135a-5p	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	24465504
MIRT441622	hsa-miR-6768-3p	PAR-CLIP	22291592
MIRT441621	hsa-miR-6507-5p	PAR-CLIP	22291592
MIRT441620	hsa-miR-4753-5p	PAR-CLIP	22291592
MIRT441619	hsa-miR-4662a-5p	PAR-CLIP	22291592
MIRT441622	hsa-miR-6768-3p	PAR-CLIP	23708386
MIRT441621	hsa-miR-6507-5p	PAR-CLIP	23708386
MIRT441620	hsa-miR-4753-5p	PAR-CLIP	23708386
MIRT494989	hsa-miR-3688-3p	PAR-CLIP	23708386
MIRT494988	hsa-miR-548aj-5p	PAR-CLIP	23708386
MIRT494987	hsa-miR-548f-5p	PAR-CLIP	23708386
MIRT494986	hsa-miR-548g-5p	PAR-CLIP	23708386
MIRT494985	hsa-miR-548x-5p	PAR-CLIP	23708386
MIRT494984	hsa-miR-1468-3p	PAR-CLIP	23708386
MIRT494983	hsa-miR-5093	PAR-CLIP	23708386
MIRT441619	hsa-miR-4662a-5p	PAR-CLIP	23708386
MIRT494982	hsa-miR-548aw	PAR-CLIP	23708386
MIRT441622	hsa-miR-6768-3p	PAR-CLIP	22100165
MIRT441621	hsa-miR-6507-5p	PAR-CLIP	22100165
MIRT441620	hsa-miR-4753-5p	PAR-CLIP	22100165
MIRT441619	hsa-miR-4662a-5p	PAR-CLIP	22100165
MIRT731498	hsa-miR-300	Luciferase reporter assay	27145462
MIRT731498	hsa-miR-300	Luciferase reporter assay	27145462
MIRT731717	hsa-miR-506-3p	Luciferase reporter assayqRT-PCRWestern blot	26474697
MIRT731717	hsa-miR-506-3p	Luciferase reporter assayqRT-PCRWestern blot	26474697
MIRT000945	hsa-miR-146a-5p	Luciferase reporter assayqRT-PCRWestern blot	26306811
MIRT000945	hsa-miR-146a-5p	Luciferase reporter assayqRT-PCRWestern blot	26306811
MIRT007315	hsa-miR-148b-3p	Luciferase reporter assayWestern blot	26530325
MIRT007315	hsa-miR-148b-3p	Luciferase reporter assayWestern blot	26530325
MIRT054402	hsa-miR-135a-5p	Luciferase reporter assayqRT-PCRWestern blot	25065599
MIRT054402	hsa-miR-135a-5p	Luciferase reporter assayqRT-PCRWestern blot	25065599
MIRT000945	hsa-miR-146a-5p	ImmunofluorescenceLuciferase reporter assayqRT-PCRWestern blot	27221467
MIRT000945	hsa-miR-146a-5p	ImmunofluorescenceLuciferase reporter assayqRT-PCRWestern blot	27221467
MIRT000945	hsa-miR-146a-5p	ImmunofluorescenceLuciferase reporter assayqRT-PCRWestern blot	27221467
MIRT000945	hsa-miR-146a-5p	ImmunofluorescenceLuciferase reporter assayqRT-PCRWestern blot	27221467
MIRT000945	hsa-miR-146a-5p	ImmunofluorescenceLuciferase reporter assayqRT-PCRWestern blot	27221467
MIRT000945	hsa-miR-146a-5p	ImmunofluorescenceLuciferase reporter assayqRT-PCRWestern blot	27221467
MIRT000945	hsa-miR-146a-5p	ImmunofluorescenceLuciferase reporter assayqRT-PCRWestern blot	27221467
MIRT000945	hsa-miR-146a-5p	ImmunofluorescenceLuciferase reporter assayqRT-PCRWestern blot	27221467
MIRT053076	hsa-miR-335-5p	Luciferase reporter assayWestern blot	27035227
MIRT053076	hsa-miR-335-5p	Luciferase reporter assayWestern blot	27035227
MIRT732668	hsa-miR-136-5p	Luciferase reporter assayqRT-PCRWestern blotting	33717260
MIRT053076	hsa-miR-335-5p	Luciferase reporter assayWestern blottingImmunohistochemistry (IHC)qRT-PCR	31638991
MIRT733939	hsa-miR-501-3p	Immunohistochemistry (IHC)Immunoprecipitaion (IP)In situ hybridizationMicroarrayWestern blotting	33168781
MIRT733939	hsa-miR-501-3p	Immunohistochemistry (IHC)Immunoprecipitaion (IP)In situ hybridizationMicroarrayWestern blotting	33168781
MIRT733939	hsa-miR-501-3p	Immunohistochemistry (IHC)Immunoprecipitaion (IP)In situ hybridizationMicroarrayWestern blotting	33168781
MIRT733939	hsa-miR-501-3p	Luciferase reporter assayqRT-PCRWestern blotting	33168781
MIRT733939	hsa-miR-501-3p	Luciferase reporter assayqRT-PCRWestern blotting	33168781
MIRT441622	hsa-miR-6768-3p	PAR-CLIP	22291592
MIRT441621	hsa-miR-6507-5p	PAR-CLIP	22291592
MIRT441620	hsa-miR-4753-5p	PAR-CLIP	22291592
MIRT441619	hsa-miR-4662a-5p	PAR-CLIP	22291592
MIRT441622	hsa-miR-6768-3p	PAR-CLIP	23708386
MIRT441621	hsa-miR-6507-5p	PAR-CLIP	23708386
MIRT441620	hsa-miR-4753-5p	PAR-CLIP	23708386
MIRT494989	hsa-miR-3688-3p	PAR-CLIP	23708386
MIRT494988	hsa-miR-548aj-5p	PAR-CLIP	23708386
MIRT494987	hsa-miR-548f-5p	PAR-CLIP	23708386
MIRT494986	hsa-miR-548g-5p	PAR-CLIP	23708386
MIRT494985	hsa-miR-548x-5p	PAR-CLIP	23708386
MIRT494984	hsa-miR-1468-3p	PAR-CLIP	23708386
MIRT494983	hsa-miR-5093	PAR-CLIP	23708386
MIRT441619	hsa-miR-4662a-5p	PAR-CLIP	23708386
MIRT494982	hsa-miR-548aw	PAR-CLIP	23708386
MIRT441622	hsa-miR-6768-3p	PAR-CLIP	22100165
MIRT441621	hsa-miR-6507-5p	PAR-CLIP	22100165
MIRT441620	hsa-miR-4753-5p	PAR-CLIP	22100165
MIRT441619	hsa-miR-4662a-5p	PAR-CLIP	22100165
MIRT755857	hsa-miR-448	Luciferase reporter assayWestern blottingqRT-PCR	35281946
MIRT053483	hsa-miR-148a-3p	Luciferase reporter assayWestern blottingqRT-PCR	35127282
MIRT1314627	hsa-miR-101	CLIP-seq
MIRT1314628	hsa-miR-124	CLIP-seq
MIRT1314629	hsa-miR-129-5p	CLIP-seq
MIRT1314630	hsa-miR-1297	CLIP-seq
MIRT1314631	hsa-miR-139-5p	CLIP-seq
MIRT1314632	hsa-miR-142-5p	CLIP-seq
MIRT1314633	hsa-miR-144	CLIP-seq
MIRT1314634	hsa-miR-145	CLIP-seq
MIRT1314635	hsa-miR-1825	CLIP-seq
MIRT1314636	hsa-miR-196a	CLIP-seq
MIRT1314637	hsa-miR-196b	CLIP-seq
MIRT1314638	hsa-miR-199a-5p	CLIP-seq
MIRT1314639	hsa-miR-199b-5p	CLIP-seq
MIRT1314640	hsa-miR-26a	CLIP-seq
MIRT1314641	hsa-miR-26b	CLIP-seq
MIRT1314642	hsa-miR-3065-3p	CLIP-seq
MIRT1314643	hsa-miR-3119	CLIP-seq
MIRT1314644	hsa-miR-3126-3p	CLIP-seq
MIRT1314645	hsa-miR-3140-3p	CLIP-seq
MIRT1314646	hsa-miR-3148	CLIP-seq
MIRT1314647	hsa-miR-3171	CLIP-seq
MIRT1314648	hsa-miR-3180-5p	CLIP-seq
MIRT1314649	hsa-miR-3200-5p	CLIP-seq
MIRT1314650	hsa-miR-337-3p	CLIP-seq
MIRT1314651	hsa-miR-340	CLIP-seq
MIRT1314652	hsa-miR-34a	CLIP-seq
MIRT1314653	hsa-miR-34c-5p	CLIP-seq
MIRT1314654	hsa-miR-3616-3p	CLIP-seq
MIRT1314655	hsa-miR-3689a-5p	CLIP-seq
MIRT1314656	hsa-miR-3689b	CLIP-seq
MIRT1314657	hsa-miR-3689e	CLIP-seq
MIRT1314658	hsa-miR-3689f	CLIP-seq
MIRT1314659	hsa-miR-3714	CLIP-seq
MIRT1314660	hsa-miR-371-5p	CLIP-seq
MIRT1314661	hsa-miR-371b-5p	CLIP-seq
MIRT1314662	hsa-miR-381	CLIP-seq
MIRT1314663	hsa-miR-3910	CLIP-seq
MIRT1314664	hsa-miR-421	CLIP-seq
MIRT1314665	hsa-miR-4255	CLIP-seq
MIRT1314666	hsa-miR-4263	CLIP-seq
MIRT1314667	hsa-miR-4328	CLIP-seq
MIRT1314668	hsa-miR-4422	CLIP-seq
MIRT1314669	hsa-miR-4465	CLIP-seq
MIRT755857	hsa-miR-448	CLIP-seq
MIRT1314670	hsa-miR-4490	CLIP-seq
MIRT1314671	hsa-miR-449a	CLIP-seq
MIRT1314672	hsa-miR-449b	CLIP-seq
MIRT1314673	hsa-miR-450b-5p	CLIP-seq
MIRT1314674	hsa-miR-4528	CLIP-seq
MIRT1314675	hsa-miR-4666-3p	CLIP-seq
MIRT1314676	hsa-miR-4670-3p	CLIP-seq
MIRT1314677	hsa-miR-4690-5p	CLIP-seq
MIRT1314678	hsa-miR-4698	CLIP-seq
MIRT1314679	hsa-miR-4709-5p	CLIP-seq
MIRT1314680	hsa-miR-4721	CLIP-seq
MIRT1314681	hsa-miR-4774-5p	CLIP-seq
MIRT1314682	hsa-miR-4781-3p	CLIP-seq
MIRT1314683	hsa-miR-4789-5p	CLIP-seq
MIRT1314684	hsa-miR-4793-5p	CLIP-seq
MIRT1314685	hsa-miR-488	CLIP-seq
MIRT1314686	hsa-miR-494	CLIP-seq
MIRT1314687	hsa-miR-506	CLIP-seq
MIRT1314688	hsa-miR-507	CLIP-seq
MIRT1314689	hsa-miR-508-3p	CLIP-seq
MIRT1314690	hsa-miR-518a-5p	CLIP-seq
MIRT1314691	hsa-miR-520f	CLIP-seq
MIRT1314692	hsa-miR-527	CLIP-seq
MIRT1314693	hsa-miR-548an	CLIP-seq
MIRT1314694	hsa-miR-550b	CLIP-seq
MIRT1314695	hsa-miR-557	CLIP-seq
MIRT1314696	hsa-miR-570	CLIP-seq
MIRT1314697	hsa-miR-582-3p	CLIP-seq
MIRT1314698	hsa-miR-605	CLIP-seq
MIRT1314699	hsa-miR-628-5p	CLIP-seq
MIRT1314700	hsa-miR-659	CLIP-seq
MIRT1314701	hsa-miR-875-3p	CLIP-seq
MIRT1314702	hsa-miR-888	CLIP-seq
MIRT2093563	hsa-miR-1244	CLIP-seq
MIRT2093564	hsa-miR-1251	CLIP-seq
MIRT1314629	hsa-miR-129-5p	CLIP-seq
MIRT1314630	hsa-miR-1297	CLIP-seq
MIRT2093565	hsa-miR-148a	CLIP-seq
MIRT2093566	hsa-miR-148b	CLIP-seq
MIRT2093567	hsa-miR-150	CLIP-seq
MIRT2093568	hsa-miR-152	CLIP-seq
MIRT2093569	hsa-miR-224	CLIP-seq
MIRT2093570	hsa-miR-2355-3p	CLIP-seq
MIRT1314640	hsa-miR-26a	CLIP-seq
MIRT1314641	hsa-miR-26b	CLIP-seq
MIRT2093571	hsa-miR-3149	CLIP-seq
MIRT2093572	hsa-miR-3157-5p	CLIP-seq
MIRT2093573	hsa-miR-3160-5p	CLIP-seq
MIRT2093574	hsa-miR-3183	CLIP-seq
MIRT2093575	hsa-miR-325	CLIP-seq
MIRT2093576	hsa-miR-335	CLIP-seq
MIRT1314651	hsa-miR-340	CLIP-seq
MIRT2093577	hsa-miR-34c-3p	CLIP-seq
MIRT2093578	hsa-miR-3616-5p	CLIP-seq
MIRT2093579	hsa-miR-3647-5p	CLIP-seq
MIRT1314655	hsa-miR-3689a-5p	CLIP-seq
MIRT1314656	hsa-miR-3689b	CLIP-seq
MIRT1314657	hsa-miR-3689e	CLIP-seq
MIRT1314658	hsa-miR-3689f	CLIP-seq
MIRT2093580	hsa-miR-3909	CLIP-seq
MIRT2093581	hsa-miR-4307	CLIP-seq
MIRT2093582	hsa-miR-431	CLIP-seq
MIRT1314669	hsa-miR-4465	CLIP-seq
MIRT755857	hsa-miR-448	CLIP-seq
MIRT1314674	hsa-miR-4528	CLIP-seq
MIRT2093583	hsa-miR-4646-3p	CLIP-seq
MIRT1314676	hsa-miR-4670-3p	CLIP-seq
MIRT2093584	hsa-miR-4691-3p	CLIP-seq
MIRT2093585	hsa-miR-4696	CLIP-seq
MIRT2093586	hsa-miR-4713-5p	CLIP-seq
MIRT2093587	hsa-miR-4723-3p	CLIP-seq
MIRT1314686	hsa-miR-494	CLIP-seq
MIRT1314690	hsa-miR-518a-5p	CLIP-seq
MIRT1314692	hsa-miR-527	CLIP-seq
MIRT2093588	hsa-miR-532-3p	CLIP-seq
MIRT2093589	hsa-miR-539	CLIP-seq
MIRT2093590	hsa-miR-548ae	CLIP-seq
MIRT2093591	hsa-miR-548aj	CLIP-seq
MIRT2093592	hsa-miR-548am	CLIP-seq
MIRT2093593	hsa-miR-548c-3p	CLIP-seq
MIRT2093594	hsa-miR-548x	CLIP-seq
MIRT2093595	hsa-miR-567	CLIP-seq
MIRT2093596	hsa-miR-568	CLIP-seq
MIRT1314696	hsa-miR-570	CLIP-seq
MIRT2093597	hsa-miR-573	CLIP-seq
MIRT2093598	hsa-miR-579	CLIP-seq
MIRT2093599	hsa-miR-587	CLIP-seq
MIRT2093600	hsa-miR-593	CLIP-seq
MIRT2093601	hsa-miR-607	CLIP-seq
MIRT2093602	hsa-miR-628-3p	CLIP-seq
MIRT1314700	hsa-miR-659	CLIP-seq
MIRT2093603	hsa-miR-664	CLIP-seq
MIRT2093604	hsa-miR-676	CLIP-seq
MIRT1314628	hsa-miR-124	CLIP-seq
MIRT2318102	hsa-miR-1284	CLIP-seq
MIRT1314629	hsa-miR-129-5p	CLIP-seq
MIRT2318103	hsa-miR-136	CLIP-seq
MIRT1314631	hsa-miR-139-5p	CLIP-seq
MIRT1314632	hsa-miR-142-5p	CLIP-seq
MIRT1314634	hsa-miR-145	CLIP-seq
MIRT2093565	hsa-miR-148a	CLIP-seq
MIRT2093566	hsa-miR-148b	CLIP-seq
MIRT2093568	hsa-miR-152	CLIP-seq
MIRT1314635	hsa-miR-1825	CLIP-seq
MIRT1314636	hsa-miR-196a	CLIP-seq
MIRT1314637	hsa-miR-196b	CLIP-seq
MIRT1314638	hsa-miR-199a-5p	CLIP-seq
MIRT1314639	hsa-miR-199b-5p	CLIP-seq
MIRT2318104	hsa-miR-217	CLIP-seq
MIRT1314643	hsa-miR-3119	CLIP-seq
MIRT1314648	hsa-miR-3180-5p	CLIP-seq
MIRT1314649	hsa-miR-3200-5p	CLIP-seq
MIRT2318105	hsa-miR-323-3p	CLIP-seq
MIRT1314651	hsa-miR-340	CLIP-seq
MIRT1314652	hsa-miR-34a	CLIP-seq
MIRT1314653	hsa-miR-34c-5p	CLIP-seq
MIRT1314654	hsa-miR-3616-3p	CLIP-seq
MIRT2318106	hsa-miR-3646	CLIP-seq
MIRT2318107	hsa-miR-3663-3p	CLIP-seq
MIRT1314659	hsa-miR-3714	CLIP-seq
MIRT1314662	hsa-miR-381	CLIP-seq
MIRT1314663	hsa-miR-3910	CLIP-seq
MIRT1314664	hsa-miR-421	CLIP-seq
MIRT1314667	hsa-miR-4328	CLIP-seq
MIRT2318108	hsa-miR-4418	CLIP-seq
MIRT2318109	hsa-miR-4470	CLIP-seq
MIRT755857	hsa-miR-448	CLIP-seq
MIRT1314671	hsa-miR-449a	CLIP-seq
MIRT1314672	hsa-miR-449b	CLIP-seq
MIRT1314673	hsa-miR-450b-5p	CLIP-seq
MIRT1314674	hsa-miR-4528	CLIP-seq
MIRT2318110	hsa-miR-4643	CLIP-seq
MIRT2318111	hsa-miR-466	CLIP-seq
MIRT1314675	hsa-miR-4666-3p	CLIP-seq
MIRT1314677	hsa-miR-4690-5p	CLIP-seq
MIRT1314679	hsa-miR-4709-5p	CLIP-seq
MIRT2318112	hsa-miR-4719	CLIP-seq
MIRT1314680	hsa-miR-4721	CLIP-seq
MIRT2318113	hsa-miR-4729	CLIP-seq
MIRT2318114	hsa-miR-4775	CLIP-seq
MIRT2318115	hsa-miR-4789-3p	CLIP-seq
MIRT1314684	hsa-miR-4793-5p	CLIP-seq
MIRT2318116	hsa-miR-4797-5p	CLIP-seq
MIRT1314685	hsa-miR-488	CLIP-seq
MIRT1314686	hsa-miR-494	CLIP-seq
MIRT1314687	hsa-miR-506	CLIP-seq
MIRT1314688	hsa-miR-507	CLIP-seq
MIRT2318117	hsa-miR-509-3-5p	CLIP-seq
MIRT2318118	hsa-miR-509-5p	CLIP-seq
MIRT2318119	hsa-miR-513b	CLIP-seq
MIRT2318120	hsa-miR-515-5p	CLIP-seq
MIRT1314690	hsa-miR-518a-5p	CLIP-seq
MIRT1314691	hsa-miR-520f	CLIP-seq
MIRT1314692	hsa-miR-527	CLIP-seq
MIRT1314694	hsa-miR-550b	CLIP-seq
MIRT1314695	hsa-miR-557	CLIP-seq
MIRT2093601	hsa-miR-607	CLIP-seq
MIRT2318121	hsa-miR-656	CLIP-seq
MIRT1314634	hsa-miR-145	CLIP-seq
MIRT1314635	hsa-miR-1825	CLIP-seq
MIRT1314638	hsa-miR-199a-5p	CLIP-seq
MIRT1314639	hsa-miR-199b-5p	CLIP-seq
MIRT1314648	hsa-miR-3180-5p	CLIP-seq
MIRT2393857	hsa-miR-3680	CLIP-seq
MIRT2393858	hsa-miR-4420	CLIP-seq
MIRT2318115	hsa-miR-4789-3p	CLIP-seq
MIRT1314686	hsa-miR-494	CLIP-seq
MIRT1314691	hsa-miR-520f	CLIP-seq
MIRT2093590	hsa-miR-548ae	CLIP-seq
MIRT2093591	hsa-miR-548aj	CLIP-seq
MIRT2093592	hsa-miR-548am	CLIP-seq
MIRT2093594	hsa-miR-548x	CLIP-seq
MIRT1314699	hsa-miR-628-5p	CLIP-seq
MIRT2393859	hsa-miR-642b	CLIP-seq
MIRT1314651	hsa-miR-340	CLIP-seq
MIRT1314651	hsa-miR-340	CLIP-seq
MIRT1314627	hsa-miR-101	CLIP-seq
MIRT1314628	hsa-miR-124	CLIP-seq
MIRT2318102	hsa-miR-1284	CLIP-seq
MIRT1314629	hsa-miR-129-5p	CLIP-seq
MIRT2318103	hsa-miR-136	CLIP-seq
MIRT1314633	hsa-miR-144	CLIP-seq
MIRT2613879	hsa-miR-202	CLIP-seq
MIRT2613880	hsa-miR-203	CLIP-seq
MIRT2318104	hsa-miR-217	CLIP-seq
MIRT1314642	hsa-miR-3065-3p	CLIP-seq
MIRT2613881	hsa-miR-3145-3p	CLIP-seq
MIRT2613882	hsa-miR-3150b-3p	CLIP-seq
MIRT2318105	hsa-miR-323-3p	CLIP-seq
MIRT1314651	hsa-miR-340	CLIP-seq
MIRT1314652	hsa-miR-34a	CLIP-seq
MIRT1314653	hsa-miR-34c-5p	CLIP-seq
MIRT2613883	hsa-miR-3647-3p	CLIP-seq
MIRT1314659	hsa-miR-3714	CLIP-seq
MIRT1314660	hsa-miR-371-5p	CLIP-seq
MIRT1314661	hsa-miR-371b-5p	CLIP-seq
MIRT1314663	hsa-miR-3910	CLIP-seq
MIRT2318108	hsa-miR-4418	CLIP-seq
MIRT1314668	hsa-miR-4422	CLIP-seq
MIRT755857	hsa-miR-448	CLIP-seq
MIRT1314671	hsa-miR-449a	CLIP-seq
MIRT1314672	hsa-miR-449b	CLIP-seq
MIRT1314674	hsa-miR-4528	CLIP-seq
MIRT2318110	hsa-miR-4643	CLIP-seq
MIRT2318111	hsa-miR-466	CLIP-seq
MIRT2613884	hsa-miR-4678	CLIP-seq
MIRT2613885	hsa-miR-4689	CLIP-seq
MIRT2318114	hsa-miR-4775	CLIP-seq
MIRT2613886	hsa-miR-4784	CLIP-seq
MIRT2318115	hsa-miR-4789-3p	CLIP-seq
MIRT1314684	hsa-miR-4793-5p	CLIP-seq
MIRT2613887	hsa-miR-487a	CLIP-seq
MIRT1314686	hsa-miR-494	CLIP-seq
MIRT1314687	hsa-miR-506	CLIP-seq
MIRT2318117	hsa-miR-509-3-5p	CLIP-seq
MIRT2318118	hsa-miR-509-5p	CLIP-seq
MIRT2613888	hsa-miR-513a-3p	CLIP-seq
MIRT2318120	hsa-miR-515-5p	CLIP-seq
MIRT1314690	hsa-miR-518a-5p	CLIP-seq
MIRT1314692	hsa-miR-527	CLIP-seq
MIRT1314693	hsa-miR-548an	CLIP-seq
MIRT1314694	hsa-miR-550b	CLIP-seq
MIRT2613889	hsa-miR-590-3p	CLIP-seq
MIRT2393859	hsa-miR-642b	CLIP-seq
MIRT1314700	hsa-miR-659	CLIP-seq
MIRT2613890	hsa-miR-944	CLIP-seq
MIRT1314627	hsa-miR-101	CLIP-seq
MIRT1314628	hsa-miR-124	CLIP-seq
MIRT2318103	hsa-miR-136	CLIP-seq
MIRT1314631	hsa-miR-139-5p	CLIP-seq
MIRT1314633	hsa-miR-144	CLIP-seq
MIRT2613879	hsa-miR-202	CLIP-seq
MIRT2318104	hsa-miR-217	CLIP-seq
MIRT1314642	hsa-miR-3065-3p	CLIP-seq
MIRT1314643	hsa-miR-3119	CLIP-seq
MIRT2613881	hsa-miR-3145-3p	CLIP-seq
MIRT2613882	hsa-miR-3150b-3p	CLIP-seq
MIRT2318105	hsa-miR-323-3p	CLIP-seq
MIRT1314651	hsa-miR-340	CLIP-seq
MIRT1314654	hsa-miR-3616-3p	CLIP-seq
MIRT1314659	hsa-miR-3714	CLIP-seq
MIRT1314663	hsa-miR-3910	CLIP-seq
MIRT1314664	hsa-miR-421	CLIP-seq
MIRT2318108	hsa-miR-4418	CLIP-seq
MIRT1314668	hsa-miR-4422	CLIP-seq
MIRT1314674	hsa-miR-4528	CLIP-seq
MIRT2318110	hsa-miR-4643	CLIP-seq
MIRT2318111	hsa-miR-466	CLIP-seq
MIRT2613884	hsa-miR-4678	CLIP-seq
MIRT2613885	hsa-miR-4689	CLIP-seq
MIRT1314679	hsa-miR-4709-5p	CLIP-seq
MIRT1314680	hsa-miR-4721	CLIP-seq
MIRT2318114	hsa-miR-4775	CLIP-seq
MIRT2613886	hsa-miR-4784	CLIP-seq
MIRT2318115	hsa-miR-4789-3p	CLIP-seq
MIRT2613887	hsa-miR-487a	CLIP-seq
MIRT1314686	hsa-miR-494	CLIP-seq
MIRT1314687	hsa-miR-506	CLIP-seq
MIRT2318117	hsa-miR-509-3-5p	CLIP-seq
MIRT2318118	hsa-miR-509-5p	CLIP-seq
MIRT2318120	hsa-miR-515-5p	CLIP-seq
MIRT1314690	hsa-miR-518a-5p	CLIP-seq
MIRT1314692	hsa-miR-527	CLIP-seq
MIRT1314693	hsa-miR-548an	CLIP-seq
MIRT1314700	hsa-miR-659	CLIP-seq

138

Show/Hide all (138)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IEA
GO:0000166	Function	Nucleotide binding	IEA
GO:0000281	Process	Mitotic cytokinesis	IBA
GO:0001726	Component	Ruffle	IEA
GO:0001726	Component	Ruffle	ISS
GO:0001837	Process	Epithelial to mesenchymal transition	IEA
GO:0001837	Process	Epithelial to mesenchymal transition	ISS
GO:0003180	Process	Aortic valve morphogenesis	ISS
GO:0003383	Process	Apical constriction	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	10652353, 11018042, 18694941, 19036714, 23093407
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	NAS	27853422
GO:0004674	Function	Protein serine/threonine kinase activity	TAS	8798490
GO:0005515	Function	Protein binding	IPI	10652353, 14660612, 17853893, 20230755, 21281639, 22085929, 23093407, 25416956, 25448675, 27853422, 28514442, 33961781
GO:0005524	Function	ATP binding	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005814	Component	Centriole	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IBA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005856	Component	Cytoskeleton	ISS
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0006915	Process	Apoptotic process	IEA
GO:0006939	Process	Smooth muscle contraction	IEA
GO:0006939	Process	Smooth muscle contraction	TAS	12778124
GO:0007159	Process	Leukocyte cell-cell adhesion	IDA	12082081
GO:0007165	Process	Signal transduction	IEA
GO:0007165	Process	Signal transduction	TAS	10436159
GO:0007266	Process	Rho protein signal transduction	IBA
GO:0007266	Process	Rho protein signal transduction	IEA
GO:0007266	Process	Rho protein signal transduction	IGI	27160703
GO:0007266	Process	Rho protein signal transduction	TAS	8798490
GO:0008270	Function	Zinc ion binding	IEA
GO:0010468	Process	Regulation of gene expression	IEA
GO:0010494	Component	Cytoplasmic stress granule	IBA
GO:0010494	Component	Cytoplasmic stress granule	IEA
GO:0010494	Component	Cytoplasmic stress granule	ISS
GO:0010508	Process	Positive regulation of autophagy	IGI	27853422
GO:0010604	Process	Positive regulation of macromolecule metabolic process	IEA
GO:0010613	Process	Positive regulation of cardiac muscle hypertrophy	IMP	28679962
GO:0010628	Process	Positive regulation of gene expression	IMP	27853422, 28679962
GO:0010628	Process	Positive regulation of gene expression	ISS
GO:0016020	Component	Membrane	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016525	Process	Negative regulation of angiogenesis	IEA
GO:0016525	Process	Negative regulation of angiogenesis	IMP	19181962
GO:0016740	Function	Transferase activity	IEA
GO:0018105	Process	Peptidyl-serine phosphorylation	IDA	18573880
GO:0022614	Process	Membrane to membrane docking	IDA	12082081
GO:0030027	Component	Lamellipodium	IEA
GO:0030027	Component	Lamellipodium	ISS
GO:0030036	Process	Actin cytoskeleton organization	IEA
GO:0030036	Process	Actin cytoskeleton organization	IEA
GO:0030036	Process	Actin cytoskeleton organization	ISS
GO:0030036	Process	Actin cytoskeleton organization	TAS	10436159
GO:0030155	Process	Regulation of cell adhesion	TAS	12778124
GO:0030334	Process	Regulation of cell migration	IDA	23093407
GO:0030866	Process	Cortical actin cytoskeleton organization	IBA
GO:0031032	Process	Actomyosin structure organization	IBA
GO:0031175	Process	Neuron projection development	IGI	27160703
GO:0031267	Function	Small GTPase binding	IEA
GO:0032059	Component	Bleb	IEA
GO:0032060	Process	Bleb assembly	IEA
GO:0032091	Process	Negative regulation of protein binding	IDA	18573880
GO:0032956	Process	Regulation of actin cytoskeleton organization	IBA
GO:0032956	Process	Regulation of actin cytoskeleton organization	IDA	25911094
GO:0032956	Process	Regulation of actin cytoskeleton organization	IEA
GO:0032956	Process	Regulation of actin cytoskeleton organization	ISS
GO:0032956	Process	Regulation of actin cytoskeleton organization	TAS	12778124
GO:0032970	Process	Regulation of actin filament-based process	IEA
GO:0034774	Component	Secretory granule lumen	TAS
GO:0035556	Process	Intracellular signal transduction	IMP	27221467
GO:0042995	Component	Cell projection	IEA
GO:0043410	Process	Positive regulation of MAPK cascade	IMP	28679962
GO:0045616	Process	Regulation of keratinocyte differentiation	IEA
GO:0045616	Process	Regulation of keratinocyte differentiation	IMP	19997641
GO:0045664	Process	Regulation of neuron differentiation	IGI	27160703
GO:0045937	Process	Positive regulation of phosphate metabolic process	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0048156	Function	Tau protein binding	NAS	28386764
GO:0048598	Process	Embryonic morphogenesis	IBA
GO:0050321	Function	Tau-protein kinase activity	NAS	28386764
GO:0050900	Process	Leukocyte migration	IDA	12082081
GO:0050901	Process	Leukocyte tethering or rolling	IDA	12082081
GO:0051045	Process	Negative regulation of membrane protein ectodomain proteolysis	TAS	27853422
GO:0051451	Process	Myoblast migration	IEA
GO:0051451	Process	Myoblast migration	ISS
GO:0051492	Process	Regulation of stress fiber assembly	IEA
GO:0051492	Process	Regulation of stress fiber assembly	TAS	12778124
GO:0051893	Process	Regulation of focal adhesion assembly	IEA
GO:0051893	Process	Regulation of focal adhesion assembly	TAS	12778124
GO:0051894	Process	Positive regulation of focal adhesion assembly	IEA
GO:0051894	Process	Positive regulation of focal adhesion assembly	ISS
GO:0061157	Process	MRNA destabilization	IEA
GO:0061157	Process	MRNA destabilization	ISS
GO:0070168	Process	Negative regulation of biomineral tissue development	ISS
GO:0070507	Process	Regulation of microtubule cytoskeleton organization	IDA	23093407
GO:0071559	Process	Response to transforming growth factor beta	IEA
GO:0071559	Process	Response to transforming growth factor beta	ISS
GO:0072518	Function	Rho-dependent protein serine/threonine kinase activity	IBA
GO:0072518	Function	Rho-dependent protein serine/threonine kinase activity	IDA	18573880
GO:0072518	Function	Rho-dependent protein serine/threonine kinase activity	IEA
GO:0072659	Process	Protein localization to plasma membrane	IEA
GO:0072659	Process	Protein localization to plasma membrane	IGI	25816133
GO:0072659	Process	Protein localization to plasma membrane	IMP	25816133
GO:0090128	Process	Regulation of synapse maturation	IEA
GO:0090521	Process	Podocyte cell migration	IEA
GO:0090521	Process	Podocyte cell migration	ISS
GO:0097049	Process	Motor neuron apoptotic process	IEA
GO:0097746	Process	Blood vessel diameter maintenance	IEA
GO:0097746	Process	Blood vessel diameter maintenance	ISS
GO:0098685	Component	Schaffer collateral - CA1 synapse	IEA
GO:0106310	Function	Protein serine kinase activity	IEA
GO:0110061	Process	Regulation of angiotensin-activated signaling pathway	IMP	28679962
GO:0140058	Process	Neuron projection arborization	IGI	27160703
GO:1900223	Process	Positive regulation of amyloid-beta clearance	IGI	27853422
GO:1900242	Process	Regulation of synaptic vesicle endocytosis	IGI	27160703
GO:1901888	Process	Regulation of cell junction assembly	IBA
GO:1902003	Process	Regulation of amyloid-beta formation	IEA
GO:1902430	Process	Negative regulation of amyloid-beta formation	IMP	24305806, 27853422
GO:1902992	Process	Negative regulation of amyloid precursor protein catabolic process	IMP	24305806, 27853422
GO:1903140	Process	Regulation of establishment of endothelial barrier	IEA
GO:1903140	Process	Regulation of establishment of endothelial barrier	IGI	25816133
GO:1903140	Process	Regulation of establishment of endothelial barrier	IMP	25816133
GO:1903347	Process	Negative regulation of bicellular tight junction assembly	IEA
GO:1903347	Process	Negative regulation of bicellular tight junction assembly	IGI	25816133
GO:1905205	Process	Positive regulation of connective tissue replacement	IMP	28679962
GO:1990776	Process	Response to angiotensin	IEA
GO:1990776	Process	Response to angiotensin	ISS
GO:2000114	Process	Regulation of establishment of cell polarity	IEA
GO:2000114	Process	Regulation of establishment of cell polarity	TAS	20803696
GO:2000145	Process	Regulation of cell motility	TAS	12778124
GO:2000672	Process	Negative regulation of motor neuron apoptotic process	IEA

MIM	HGNC	e!Ensembl
601702	10251	ENSG00000067900

Q13464

Protein name

Rho-associated protein kinase 1 (EC 2.7.11.1) (Renal carcinoma antigen NY-REN-35) (Rho-associated, coiled-coil-containing protein kinase 1) (Rho-associated, coiled-coil-containing protein kinase I) (ROCK-I) (p160 ROCK-1) (p160ROCK)

Protein function

Protein kinase which is a key regulator of the actin cytoskeleton and cell polarity (PubMed:10436159, PubMed:10652353, PubMed:11018042, PubMed:11283607, PubMed:17158456, PubMed:18573880, PubMed:19131646, PubMed:8617235, PubMed:9722579). Involved

PDB

1S1C , 2ESM , 2ETK , 2ETR , 2V55 , 3D9V , 3NCZ , 3NDM , 3O0Z , 3TV7 , 3TWJ , 3V8S , 4L2W , 4W7P , 4YVC , 4YVE , 5BML , 5F5P , 5HVU , 5KKS , 5KKT , 5UZJ , 5WNE , 5WNF , 5WNG , 5WNH , 6E9W , 7JOU , 7S25 , 7S26 , 8P0S , 8ZH5

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	76 → 338	Protein kinase domain	Domain
PF08912	Rho_Binding	948 → 1014	Rho Binding	Coiled-coil

Tissue specificity

TISSUE SPECIFICITY: Detected in blood platelets. {ECO:0000269|PubMed:8617235}.

Sequence

MSTGDSFETRFEKMDNLLRDPKSEVNSDCLLDGLDALVYDLDFPALRKNKNIDNFLSRYK
DTINKIRDLRMKAEDYEVVKVIGRGAFGEVQLVRHKSTRKVYAMKLLSKFEMIKRSDSAF
FWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWARFYTA
EVVLALDAIHSMGFIHRDVKPDNMLLDKSGHLKLADFGTCMKMNKEGMVRCDTAVGTPDY
ISPEVLKSQGGDGYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMNHKNSLTFP
DDNDISKEAKNLICAFLTDREVRLGRNGVEEIKRHLFFKNDQWAWETLRDTVAPVVPDLS
SDIDTSNFDDLEEDKGEEETFPIPKAFVGNQLPFVGFTYYSNRRYLSSANPNDNRTSSNA
DKSLQESLQKTIYKLEEQLHNEMQLKDEMEQKCRTSNIKLDKIMKELDEEGNQRRNLEST
VSQIEKEKMLLQHRINEYQRKAEQENEKRRNVENEVSTLKDQLEDLKKVSQNSQLANEKL
SQLQKQLEEANDLLRTESDTAVRLRKSHTEMSKSISQLESLNRELQERNRILENSKSQTD
KDYYQLQAILEAERRDRGHDSEMIGDLQARITSLQEEVKHLKHNLEKVEGERKEAQDMLN
HSEKEKNNLEIDLNYKLKSLQQRLEQEVNEHKVTKARLTDKHQSIEEAKSVAMCEMEKKL
KEEREAREKAENRVVQIEKQCSMLDVDLKQSQQKLEHLTGNKERMEDEVKNLTLQLEQES
NKRLLLQNELKTQAFEADNLKGLEKQMKQEINTLLEAKRLLEFELAQLTKQYRGNEGQMR
ELQDQLEAEQYFSTLYKTQVKELKEEIEEKNRENLKKIQELQNEKETLATQLDLAETKAE
SEQLARGLLEEQYFELTQESKKAASRNRQEITDKDHTVSRLEEANSMLTKDIEILRRENE
ELTEKMKKAEEEYKLEKEEEISNLKAAFEKNINTERTLKTQAVNKLAEIMNRKDFKIDRK
KANTQDLRKKEKENRKLQLELNQEREKFNQMVVKHQKELNDMQAQLVEECAHRNELQMQL
ASKESDIEQLRAKLLDLSDSTSVASFPSADETDGNLPESRIEGWLSVPNRGNIKRYGWKK
QYVVVSSKKILFYNDEQDKEQSNPSMVLDIDKLFHVRPVTQGDVYRAETEEIPKIFQILY
ANEGECRKDVEMEPVQQAEKTNFQNHKGHEFIPTLYHFPANCDACAKPLWHVFKPPPALE
CRRCHVKCHRDHLDKKEDLICPCKVSYDVTSARDMLLLACSQDEQKKWVTHLVKKIPKNP
PSGFVRASPRTLSTRSTANQSFRKVVKNTSGKTS

Sequence length

1354

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CARCINOMA, BASAL CELL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA, PROMYELOCYTIC, ACUTE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (192)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	BEFREE	28434818		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	23068101, 31483565		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	28841710		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	29324316, 29414040, 29860109		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	28265821		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	29324316, 29414040, 29860109		★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	24566943		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	29749520		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	22057916, 23056431, 27035227		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	18695890, 26715279, 26758430, 28042775, 28818997, 30771534, 30982494		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	23233531, 26715279, 26758430, 30982494, 31986487, 32729299, 34486491	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	12508342	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	22942252, 26124099, 32154766, 32787581	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	25804796, 26615424, 30279202, 31117934, 31900116, 32787581, 35287604	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	22057916, 23056431, 27035227		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	CLINVAR_DG	20140017		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	31270811		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	37820923	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	26530532	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	21119662, 26066055, 27108693, 29130345	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	24457551, 25380619	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	16371346, 20022093		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	24901055		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	37852321	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	37852321	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	15956119, 16469861, 27694793		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	27694793	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	24351102, 29246448	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	29246448		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	25104222, 30362591		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	25104222, 30362591		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholesteatoma	Cholesteatoma	Pubtator	35177391	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	27277835		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	16543245		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	23328676, 25820997, 25987767, 26026086, 26562026, 27159971, 29807462		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	25987767, 26026086, 27159971, 27249601, 34080666, 35101080, 35647190	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Heart Defects	Congenital heart defects	BEFREE	28131915		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	24901055, 29987023, 31541994		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	21119662, 26066055, 27108693, 27841867, 29130345, 29343969		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	29027377		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	29027377	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Deuteranomaly	Deuteranomaly	BEFREE	26818518		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	15956119		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	15956119		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	22430126, 26066055, 29768267, 34080666, 36736734	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	29768267, 30478982, 36736734	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	34080666	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	21189360, 29768267, 30478982, 30688006, 30989671, 31618077		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	35291991	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	26842599		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	28821742		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	29765452		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	30387365, 39297944	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	22544491		★★★★★ ★☆☆☆☆ Found in Text Mining only
Erectile dysfunction	Erectile Dysfunction	LHGDN	15713824		★★★★★ ★☆☆☆☆ Found in Text Mining only
Erectile dysfunction	Erectile Dysfunction	BEFREE	26884827, 27763717		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	12508342	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	36781836	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	28112365, 29270775, 29434937		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	30226474		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	26764184, 30226474		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	31295018		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	29928876		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	24617500		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	23577178, 24170433, 27145462, 27666391, 29115617, 29724193		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	31515278, 34536977, 35281946	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	23577178, 24170433, 27145462, 27666391, 29115617, 29724193		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	23577178, 23936026, 24170433, 24573110, 25266804, 30169426, 31083169		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	23936026, 25266804, 30915607	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	31083169	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glucocorticoid Receptor Deficiency	Glucocorticoid receptor deficiency/resistance	Pubtator	34262023	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hairy Cell Leukemia	Hairy Cell Leukemia	BEFREE	30234377		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Defects Congenital	Congenital heart defect	Pubtator	35737725	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	26452457, 30999892	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	24901055, 29987023		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Hemangiosarcoma	BEFREE	28709411		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	24309928		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemorrhagic Stroke	Hemorrhagic stroke	Pubtator	29246448	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	30066939, 31263414		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	Pubtator	35179516	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung Disease	BEFREE	26276426		★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	25941073		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	29351188	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	29860109, 30226474, 31830262		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	21189360		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	31830262		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	22430126, 26066055, 29246448	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	29246448, 29921927, 9353125		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	29351188	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	29319354, 31533472		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	25358403	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	37683138	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	28901478		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	32417359	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	Pubtator	29593724	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	24309928, 29039493, 29844397		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	25931586	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	25931586, 30840284, 36175877	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	30840284, 31306637		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	14716844		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	25804796, 26530325, 26615424, 28978024, 31081143, 31117934, 31140617		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	18615591		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	32554853	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	23298303, 25755711, 31638991	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	24465504, 25380619	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	24357726	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Bone Neoplasm	Malignant Bone Neoplasm	BEFREE	31136973		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	20944130, 25266804		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	18695890, 26715279, 26758430, 28042775, 28818997, 30771534, 30982494		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	29928876		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	27159971		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	31270811		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	16371346, 20022093		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	11893932, 27824338, 28841710, 29616134		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	18174313, 28184030, 29435058, 30195463, 30874288, 31026254, 31210296, 31557128		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	21994419, 29544562, 31115002, 31140617		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	22057916, 23056431, 27035227		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11893932, 12794027, 16371346, 20140017, 22085929, 22430126, 25987767, 27159971, 27566106, 27694793, 28279687, 28450943, 28841710, 28848996, 29328417 View all (5 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	25104222, 30362591		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	15843433, 18695890		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CLINVAR_DG	20140017		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	25538140, 26464464, 27311960, 31423160		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	25538140	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	26004609	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	30320378, 31009148, 32554853	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	BEFREE	29382705		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	36767649	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	25277193, 31799660, 33336739, 37173390	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	28450943, 31799660		★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrotizing enterocolitis in fetus OR newborn	Necrotizing Enterocolitis	BEFREE	30480807		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15604264, 18174313, 21119662, 22057916, 23056431, 24309928, 24434521, 24573110, 25065599, 25266804, 25380619, 25804796, 26026086, 26615424, 26715279 View all (14 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	22382496, 26818518, 28123576, 28739902		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	22382496	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	25960282	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibrosarcoma	Neurofibrosarcoma	Pubtator	34530870	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	30226474, 31484042		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	23670799, 24894676, 31140617, 31485605, 31638991		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	21189360		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	23948067	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	37683138	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	21387396, 23975506, 24398981, 24789502, 24801908, 25912304, 26081423, 28081735, 28117029, 28123850, 28225457, 28454380, 28558357, 29328417, 29441962 View all (8 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	21387396, 24398981, 24801908, 30674565, 32660450, 32963586	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	16371346, 20022093		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	16371346		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	16371346, 21459799, 29642915, 29790629	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	11893932, 27824338, 28841710, 29616134		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	27824338, 28841710		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	11893932		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	22232555, 36077069, 37164685	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	28656254, 28848996, 29710554, 31696481		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	31578315		★★★★★ ★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	17353442		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	30704840		★★★★★ ★☆☆☆☆ Found in Text Mining only
Progressive supranuclear palsy	Progressive Supranuclear Palsy	BEFREE	26818518		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	18174313, 28184030, 29435058, 30195463, 30474879, 30874288, 31026254, 31210296, 31557128		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	18780293		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	28184030, 31210296, 31557128	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	29319354		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	22913419	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary fibrosis	Pubtator	25358403	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	29211497		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	26458302		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	27159971		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	27108693, 29130345		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Newborn	Congenital alveolar dysplasia	BEFREE	27269648		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	24528629	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	29517104, 31432120		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	20956521		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	20956521	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	28112365, 29270775	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	37052185	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	29475915	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	29475915		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	34271873	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinal Muscular Atrophies of Childhood	Spinal muscular atrophy	Pubtator	32558393	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	30364063		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	25755711, 30364063	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of vulva	Carcinoma Of Vulva	BEFREE	25380619		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	30226474		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	21994419, 29544562, 31115002, 31140617		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	23298303, 24465504, 25169484, 26811494, 31115002, 32679742	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	LHGDN	15665056		★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	26615410		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tetralogy of Fallot	Tetralogy of Fallot	BEFREE	23782575		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tetralogy of Fallot	Tetralogy of fallot	Pubtator	23782575	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	31696481	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	32729299	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uranostaphyloschisis	Uranostaphyloschisis	BEFREE	31715657		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	23056431, 24180482, 35127282	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	24457551, 31939597, 37486699	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Van der Woude syndrome	Van Der Woude Syndrome	BEFREE	31059087		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	30999892	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

ROCK1 (Rho associated coiled-coil containing protein kinase 1)