RHOA (ras homolog family member A)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 387
• Gene name: Ras homolog family member A
• Gene symbol: RHOA
• Synonyms (NCBI Gene): ARH12, ARHA, EDFAOB, RHO12, RHOH12
• Chromosome: 3
• Chromosome location: 3p21.31
• Summary: This gene encodes a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskel

SNPs Show/Hide all (6)

SNP ID	Visualize variation	Clinical significance	Consequence
rs1057519951	C>G,T	Likely-pathogenic	Missense variant, 5 prime UTR variant, coding sequence variant
rs1057519952	G>A	Likely-pathogenic	Intron variant, missense variant, coding sequence variant
rs1057519953	C>A,T	Likely-pathogenic	Intron variant, missense variant, coding sequence variant
rs1057519954	T>A,C,G	Likely-pathogenic	Missense variant, 5 prime UTR variant, coding sequence variant
rs1575647025	G>A	Pathogenic	Intron variant, 5 prime UTR variant, coding sequence variant, missense variant
rs1575653629	C>T	Pathogenic	Intron variant, 5 prime UTR variant, coding sequence variant, missense variant

miRNA Show/Hide all (738)

miRTarBase ID	miRNA	Experiments	Reference
MIRT001961	hsa-miR-155-5p	Luciferase reporter assay	18794355
MIRT001961	hsa-miR-155-5p	Luciferase reporter assay	18794355
MIRT001961	hsa-miR-155-5p	Luciferase reporter assay	18794355
MIRT001961	hsa-miR-155-5p	Western blot	18794355
MIRT001961	hsa-miR-155-5p	qRT-PCR	18794355
MIRT000717	hsa-miR-122-5p	Luciferase reporter assay	19617899
MIRT000717	hsa-miR-122-5p	Luciferase reporter assay	19617899
MIRT000717	hsa-miR-122-5p	Luciferase reporter assay, Review	19935707
MIRT001961	hsa-miR-155-5p	Luciferase reporter assay	18794355
MIRT001961	hsa-miR-155-5p	Luciferase reporter assay	18794355
MIRT000088	hsa-miR-31-5p	Luciferase reporter assay, qRT-PCR, Western blot	19524507
MIRT000088	hsa-miR-31-5p	Luciferase reporter assay, qRT-PCR, Western blot	19524507
MIRT000088	hsa-miR-31-5p	Luciferase reporter assay, qRT-PCR, Western blot	19524507
MIRT004036	hsa-miR-185-5p	Luciferase reporter assay, qRT-PCR, Western blot	21186079
MIRT004036	hsa-miR-185-5p	Luciferase reporter assay, qRT-PCR, Western blot	21186079
MIRT000088	hsa-miR-31-5p	qRT-PCR, Western blot	22854067
MIRT007065	hsa-miR-31-3p	qRT-PCR, Western blot	22854067
MIRT007345	hsa-miR-200c-3p	Luciferase reporter assay, qRT-PCR, Western blot	23272142
MIRT019977	hsa-miR-375	Western blot;qRT-PCR;Microarray	20584986
MIRT022883	hsa-miR-124-3p	Microarray	18668037
MIRT046885	hsa-miR-221-3p	CLASH	23622248
MIRT041611	hsa-miR-146b-5p	CLASH	23622248
MIRT036175	hsa-miR-320c	CLASH	23622248
MIRT053178	hsa-miR-133b	Immunoblot, Luciferase reporter assay, Microarray	22179829
MIRT000088	hsa-miR-31-5p	qRT-PCR, Western blot	22736314
MIRT053178	hsa-miR-133b	Luciferase reporter assay, qRT-PCR, Western blot	22179829
MIRT437799	hsa-miR-125a-3p	Immunofluorescence, Luciferase reporter assay, qRT-PCR	23525486
MIRT438245	hsa-miR-340-5p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	24980435
MIRT438245	hsa-miR-340-5p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	24980435
MIRT712848	hsa-miR-548ac	HITS-CLIP	19536157
MIRT712847	hsa-miR-548bb-3p	HITS-CLIP	19536157
MIRT712846	hsa-miR-548d-3p	HITS-CLIP	19536157
MIRT712845	hsa-miR-548h-3p	HITS-CLIP	19536157
MIRT712844	hsa-miR-548z	HITS-CLIP	19536157
MIRT712843	hsa-miR-6800-3p	HITS-CLIP	19536157
MIRT307754	hsa-miR-3613-3p	HITS-CLIP	19536157
MIRT712842	hsa-miR-483-3p	HITS-CLIP	19536157
MIRT712841	hsa-miR-3183	HITS-CLIP	19536157
MIRT712840	hsa-miR-4723-3p	HITS-CLIP	19536157
MIRT712839	hsa-miR-6769b-3p	HITS-CLIP	19536157
MIRT355605	hsa-miR-1304-3p	HITS-CLIP	19536157
MIRT712838	hsa-miR-7110-3p	HITS-CLIP	19536157
MIRT712837	hsa-miR-607	HITS-CLIP	19536157
MIRT573551	hsa-miR-3936	PAR-CLIP	20371350
MIRT573550	hsa-miR-4517	PAR-CLIP	20371350
MIRT573549	hsa-miR-5583-3p	PAR-CLIP	20371350
MIRT573548	hsa-miR-4529-5p	PAR-CLIP	20371350
MIRT573546	hsa-miR-6877-5p	PAR-CLIP	20371350
MIRT573547	hsa-miR-6762-5p	PAR-CLIP	20371350
MIRT573545	hsa-miR-6845-5p	PAR-CLIP	20371350
MIRT573544	hsa-miR-128-1-5p	PAR-CLIP	20371350
MIRT573543	hsa-miR-128-2-5p	PAR-CLIP	20371350
MIRT573542	hsa-miR-6881-5p	PAR-CLIP	20371350
MIRT573541	hsa-miR-3187-3p	PAR-CLIP	20371350
MIRT573540	hsa-miR-1227-5p	PAR-CLIP	20371350
MIRT566020	hsa-miR-6768-3p	PAR-CLIP	20371350
MIRT566019	hsa-miR-3646	PAR-CLIP	20371350
MIRT566018	hsa-miR-1252-3p	PAR-CLIP	20371350
MIRT566017	hsa-miR-4753-5p	PAR-CLIP	20371350
MIRT566016	hsa-miR-577	PAR-CLIP	20371350
MIRT566015	hsa-miR-331-5p	PAR-CLIP	20371350
MIRT566014	hsa-miR-2054	PAR-CLIP	20371350
MIRT566013	hsa-miR-6509-5p	PAR-CLIP	20371350
MIRT469298	hsa-miR-2278	PAR-CLIP	23592263
MIRT469297	hsa-miR-4519	PAR-CLIP	23592263
MIRT469296	hsa-miR-4779	PAR-CLIP	23592263
MIRT307761	hsa-miR-4446-3p	PAR-CLIP	23592263
MIRT469295	hsa-miR-6847-5p	PAR-CLIP	23592263
MIRT437799	hsa-miR-125a-3p	PAR-CLIP	23592263
MIRT469294	hsa-miR-764	PAR-CLIP	23592263
MIRT469293	hsa-miR-3934-5p	PAR-CLIP	23592263
MIRT469292	hsa-miR-4721	PAR-CLIP	23592263
MIRT469291	hsa-miR-2467-3p	PAR-CLIP	23592263
MIRT469290	hsa-miR-6499-3p	PAR-CLIP	23592263
MIRT469289	hsa-miR-504-3p	PAR-CLIP	23592263
MIRT469288	hsa-miR-4687-3p	PAR-CLIP	23592263
MIRT469287	hsa-miR-4675	PAR-CLIP	23592263
MIRT469286	hsa-miR-4741	PAR-CLIP	23592263
MIRT469285	hsa-miR-1233-5p	PAR-CLIP	23592263
MIRT469284	hsa-miR-6778-5p	PAR-CLIP	23592263
MIRT469283	hsa-miR-597-5p	PAR-CLIP	23592263
MIRT469282	hsa-miR-3678-3p	PAR-CLIP	23592263
MIRT469281	hsa-miR-592	PAR-CLIP	23592263
MIRT469280	hsa-miR-4722-5p	PAR-CLIP	23592263
MIRT439773	ebv-miR-BART7-3p	HITS-CLIP	22473208
MIRT439772	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT439773	ebv-miR-BART7-3p	HITS-CLIP	22473208
MIRT439772	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT731596	hsa-miR-200b-3p	Luciferase reporter assay	26903801
MIRT731596	hsa-miR-200b-3p	Luciferase reporter assay	26903801
MIRT004036	hsa-miR-185-5p	qRT-PCR, Western blot	27250838
MIRT000088	hsa-miR-31-5p	Immunohistochemistry, In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	27904131
MIRT000088	hsa-miR-31-5p	Immunohistochemistry, In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	27904131
MIRT001961	hsa-miR-155-5p	qRT-PCR	28146427
MIRT001961	hsa-miR-155-5p	qRT-PCR	28146427
MIRT437799	hsa-miR-125a-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	26148871
MIRT437799	hsa-miR-125a-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	26148871
MIRT469298	hsa-miR-2278	PAR-CLIP	26701625
MIRT469291	hsa-miR-2467-3p	PAR-CLIP	26701625
MIRT307761	hsa-miR-4446-3p	PAR-CLIP	26701625
MIRT469297	hsa-miR-4519	PAR-CLIP	26701625
MIRT469287	hsa-miR-4675	PAR-CLIP	26701625
MIRT469288	hsa-miR-4687-3p	PAR-CLIP	26701625
MIRT469292	hsa-miR-4721	PAR-CLIP	26701625
MIRT469280	hsa-miR-4722-5p	PAR-CLIP	26701625
MIRT469286	hsa-miR-4741	PAR-CLIP	26701625
MIRT469296	hsa-miR-4779	PAR-CLIP	26701625
MIRT469290	hsa-miR-6499-3p	PAR-CLIP	26701625
MIRT469295	hsa-miR-6847-5p	PAR-CLIP	26701625
MIRT734264	hsa-miR-27a-3p	Immunohistochemistry (IHC), qRT-PCR, Western blotting	31915154
MIRT734265	hsa-miR-21-3p	Immunohistochemistry (IHC), qRT-PCR, Western blotting	31915154
MIRT053178	hsa-miR-133b	Luciferase reporter assay, Western blotting, qRT-PCR	32547232
MIRT736359	hsa-miR-140-3p	Western blotting, qRT-PCR	33427568
MIRT712848	hsa-miR-548ac	HITS-CLIP	19536157
MIRT712847	hsa-miR-548bb-3p	HITS-CLIP	19536157
MIRT712846	hsa-miR-548d-3p	HITS-CLIP	19536157
MIRT712845	hsa-miR-548h-3p	HITS-CLIP	19536157
MIRT712844	hsa-miR-548z	HITS-CLIP	19536157
MIRT712843	hsa-miR-6800-3p	HITS-CLIP	19536157
MIRT307754	hsa-miR-3613-3p	HITS-CLIP	19536157
MIRT712842	hsa-miR-483-3p	HITS-CLIP	19536157
MIRT712841	hsa-miR-3183	HITS-CLIP	19536157
MIRT712840	hsa-miR-4723-3p	HITS-CLIP	19536157
MIRT712839	hsa-miR-6769b-3p	HITS-CLIP	19536157
MIRT355605	hsa-miR-1304-3p	HITS-CLIP	19536157
MIRT712838	hsa-miR-7110-3p	HITS-CLIP	19536157
MIRT712837	hsa-miR-607	HITS-CLIP	19536157
MIRT573551	hsa-miR-3936	PAR-CLIP	20371350
MIRT573550	hsa-miR-4517	PAR-CLIP	20371350
MIRT573549	hsa-miR-5583-3p	PAR-CLIP	20371350
MIRT573548	hsa-miR-4529-5p	PAR-CLIP	20371350
MIRT573546	hsa-miR-6877-5p	PAR-CLIP	20371350
MIRT573547	hsa-miR-6762-5p	PAR-CLIP	20371350
MIRT573545	hsa-miR-6845-5p	PAR-CLIP	20371350
MIRT573544	hsa-miR-128-1-5p	PAR-CLIP	20371350
MIRT573543	hsa-miR-128-2-5p	PAR-CLIP	20371350
MIRT573542	hsa-miR-6881-5p	PAR-CLIP	20371350
MIRT573541	hsa-miR-3187-3p	PAR-CLIP	20371350
MIRT573540	hsa-miR-1227-5p	PAR-CLIP	20371350
MIRT566020	hsa-miR-6768-3p	PAR-CLIP	20371350
MIRT566019	hsa-miR-3646	PAR-CLIP	20371350
MIRT566018	hsa-miR-1252-3p	PAR-CLIP	20371350
MIRT566017	hsa-miR-4753-5p	PAR-CLIP	20371350
MIRT566016	hsa-miR-577	PAR-CLIP	20371350
MIRT566015	hsa-miR-331-5p	PAR-CLIP	20371350
MIRT566014	hsa-miR-2054	PAR-CLIP	20371350
MIRT566013	hsa-miR-6509-5p	PAR-CLIP	20371350
MIRT469298	hsa-miR-2278	PAR-CLIP	23592263
MIRT469297	hsa-miR-4519	PAR-CLIP	23592263
MIRT469296	hsa-miR-4779	PAR-CLIP	23592263
MIRT307761	hsa-miR-4446-3p	PAR-CLIP	23592263
MIRT469295	hsa-miR-6847-5p	PAR-CLIP	23592263
MIRT437799	hsa-miR-125a-3p	PAR-CLIP	23592263
MIRT469294	hsa-miR-764	PAR-CLIP	23592263
MIRT469293	hsa-miR-3934-5p	PAR-CLIP	23592263
MIRT469292	hsa-miR-4721	PAR-CLIP	23592263
MIRT469291	hsa-miR-2467-3p	PAR-CLIP	23592263
MIRT469290	hsa-miR-6499-3p	PAR-CLIP	23592263
MIRT469289	hsa-miR-504-3p	PAR-CLIP	23592263
MIRT469288	hsa-miR-4687-3p	PAR-CLIP	23592263
MIRT469287	hsa-miR-4675	PAR-CLIP	23592263
MIRT469286	hsa-miR-4741	PAR-CLIP	23592263
MIRT469285	hsa-miR-1233-5p	PAR-CLIP	23592263
MIRT469284	hsa-miR-6778-5p	PAR-CLIP	23592263
MIRT469283	hsa-miR-597-5p	PAR-CLIP	23592263
MIRT469282	hsa-miR-3678-3p	PAR-CLIP	23592263
MIRT469281	hsa-miR-592	PAR-CLIP	23592263
MIRT469280	hsa-miR-4722-5p	PAR-CLIP	23592263
MIRT736359	hsa-miR-140-3p	Western blotting, qRT-PCR	33427568
MIRT756260	hsa-miR-1301-3p	Luciferase reporter assay	35256884
MIRT1305113	hsa-miR-103a	CLIP-seq
MIRT1305114	hsa-miR-107	CLIP-seq
MIRT1305115	hsa-miR-1207-3p	CLIP-seq
MIRT1305116	hsa-miR-1226	CLIP-seq
MIRT1305117	hsa-miR-1227	CLIP-seq
MIRT1305118	hsa-miR-1253	CLIP-seq
MIRT1305119	hsa-miR-1257	CLIP-seq
MIRT1305120	hsa-miR-1276	CLIP-seq
MIRT1305121	hsa-miR-1301	CLIP-seq
MIRT1305122	hsa-miR-144	CLIP-seq
MIRT1305123	hsa-miR-146a	CLIP-seq
MIRT1305124	hsa-miR-154	CLIP-seq
MIRT1305125	hsa-miR-185	CLIP-seq
MIRT1305126	hsa-miR-1911	CLIP-seq
MIRT1305127	hsa-miR-200b	CLIP-seq
MIRT1305128	hsa-miR-200c	CLIP-seq
MIRT1305129	hsa-miR-218	CLIP-seq
MIRT1305130	hsa-miR-300	CLIP-seq
MIRT1305131	hsa-miR-3064-3p	CLIP-seq
MIRT1305132	hsa-miR-3132	CLIP-seq
MIRT1305133	hsa-miR-3135b	CLIP-seq
MIRT1305134	hsa-miR-3150b-3p	CLIP-seq
MIRT1305135	hsa-miR-3192	CLIP-seq
MIRT1305136	hsa-miR-3200-3p	CLIP-seq
MIRT1305137	hsa-miR-323-3p	CLIP-seq
MIRT1305138	hsa-miR-326	CLIP-seq
MIRT1305139	hsa-miR-330-5p	CLIP-seq
MIRT1305140	hsa-miR-3616-5p	CLIP-seq
MIRT1305141	hsa-miR-3647-5p	CLIP-seq
MIRT1305142	hsa-miR-3650	CLIP-seq
MIRT1305143	hsa-miR-3660	CLIP-seq
MIRT1305144	hsa-miR-3689a-3p	CLIP-seq
MIRT1305145	hsa-miR-3689c	CLIP-seq
MIRT1305146	hsa-miR-381	CLIP-seq
MIRT1305147	hsa-miR-3920	CLIP-seq
MIRT1305148	hsa-miR-3934	CLIP-seq
MIRT1305149	hsa-miR-3935	CLIP-seq
MIRT1305150	hsa-miR-4259	CLIP-seq
MIRT1305151	hsa-miR-4268	CLIP-seq
MIRT1305152	hsa-miR-429	CLIP-seq
MIRT1305153	hsa-miR-4306	CLIP-seq
MIRT1305154	hsa-miR-4314	CLIP-seq
MIRT1305155	hsa-miR-4327	CLIP-seq
MIRT1305156	hsa-miR-4452	CLIP-seq
MIRT1305157	hsa-miR-4496	CLIP-seq
MIRT1305158	hsa-miR-4499	CLIP-seq
MIRT1305159	hsa-miR-451b	CLIP-seq
MIRT1305160	hsa-miR-4520a-3p	CLIP-seq
MIRT1305161	hsa-miR-4520b-3p	CLIP-seq
MIRT1305162	hsa-miR-4526	CLIP-seq
MIRT1305163	hsa-miR-4633-5p	CLIP-seq
MIRT1305164	hsa-miR-4644	CLIP-seq
MIRT1305165	hsa-miR-4645-3p	CLIP-seq
MIRT1305166	hsa-miR-4646-5p	CLIP-seq
MIRT1305167	hsa-miR-4660	CLIP-seq
MIRT1305168	hsa-miR-4666-3p	CLIP-seq
MIRT1305169	hsa-miR-4667-5p	CLIP-seq
MIRT1305170	hsa-miR-4689	CLIP-seq
MIRT1305171	hsa-miR-4698	CLIP-seq
MIRT1305172	hsa-miR-4700-5p	CLIP-seq
MIRT1305173	hsa-miR-4704-5p	CLIP-seq
MIRT1305174	hsa-miR-4715-3p	CLIP-seq
MIRT1305175	hsa-miR-4715-5p	CLIP-seq
MIRT1305176	hsa-miR-4720-3p	CLIP-seq
MIRT1305177	hsa-miR-4727-5p	CLIP-seq
MIRT1305178	hsa-miR-4728-5p	CLIP-seq
MIRT1305179	hsa-miR-4733-3p	CLIP-seq
MIRT1305180	hsa-miR-4762-3p	CLIP-seq
MIRT1305181	hsa-miR-4769-3p	CLIP-seq
MIRT1305182	hsa-miR-4784	CLIP-seq
MIRT1305183	hsa-miR-4788	CLIP-seq
MIRT1305184	hsa-miR-4789-5p	CLIP-seq
MIRT1305185	hsa-miR-4795-5p	CLIP-seq
MIRT1305186	hsa-miR-4799-5p	CLIP-seq
MIRT1305187	hsa-miR-4803	CLIP-seq
MIRT1305188	hsa-miR-4804-3p	CLIP-seq
MIRT1305189	hsa-miR-485-3p	CLIP-seq
MIRT1305190	hsa-miR-487a	CLIP-seq
MIRT1305191	hsa-miR-502-5p	CLIP-seq
MIRT1305192	hsa-miR-504	CLIP-seq
MIRT1305193	hsa-miR-5047	CLIP-seq
MIRT1305194	hsa-miR-520g	CLIP-seq
MIRT1305195	hsa-miR-520h	CLIP-seq
MIRT1305196	hsa-miR-541	CLIP-seq
MIRT1305197	hsa-miR-554	CLIP-seq
MIRT1305198	hsa-miR-561	CLIP-seq
MIRT1305199	hsa-miR-573	CLIP-seq
MIRT1305200	hsa-miR-582-3p	CLIP-seq
MIRT1305201	hsa-miR-589	CLIP-seq
MIRT1305202	hsa-miR-597	CLIP-seq
MIRT1305203	hsa-miR-617	CLIP-seq
MIRT1305204	hsa-miR-618	CLIP-seq
MIRT1305205	hsa-miR-619	CLIP-seq
MIRT1305206	hsa-miR-636	CLIP-seq
MIRT1305207	hsa-miR-637	CLIP-seq
MIRT1305127	hsa-miR-200b	CLIP-seq
MIRT1305128	hsa-miR-200c	CLIP-seq
MIRT1305147	hsa-miR-3920	CLIP-seq
MIRT1305152	hsa-miR-429	CLIP-seq
MIRT1305159	hsa-miR-451b	CLIP-seq
MIRT1305180	hsa-miR-4762-3p	CLIP-seq
MIRT1305203	hsa-miR-617	CLIP-seq
MIRT1305142	hsa-miR-3650	CLIP-seq
MIRT1305148	hsa-miR-3934	CLIP-seq
MIRT1305159	hsa-miR-451b	CLIP-seq
MIRT1305202	hsa-miR-597	CLIP-seq
MIRT2090326	hsa-miR-1185	CLIP-seq
MIRT1305115	hsa-miR-1207-3p	CLIP-seq
MIRT2090327	hsa-miR-1224-5p	CLIP-seq
MIRT1305116	hsa-miR-1226	CLIP-seq
MIRT1305118	hsa-miR-1253	CLIP-seq
MIRT1305119	hsa-miR-1257	CLIP-seq
MIRT1305120	hsa-miR-1276	CLIP-seq
MIRT2090328	hsa-miR-1286	CLIP-seq
MIRT1305121	hsa-miR-1301	CLIP-seq
MIRT2090329	hsa-miR-1304	CLIP-seq
MIRT1305122	hsa-miR-144	CLIP-seq
MIRT1305125	hsa-miR-185	CLIP-seq
MIRT1305126	hsa-miR-1911	CLIP-seq
MIRT1305127	hsa-miR-200b	CLIP-seq
MIRT1305128	hsa-miR-200c	CLIP-seq
MIRT2090330	hsa-miR-2682	CLIP-seq
MIRT2090331	hsa-miR-3129-3p	CLIP-seq
MIRT1305133	hsa-miR-3135b	CLIP-seq
MIRT1305136	hsa-miR-3200-3p	CLIP-seq
MIRT2090332	hsa-miR-323b-3p	CLIP-seq
MIRT2090333	hsa-miR-3605-5p	CLIP-seq
MIRT1305140	hsa-miR-3616-5p	CLIP-seq
MIRT1305141	hsa-miR-3647-5p	CLIP-seq
MIRT2090334	hsa-miR-3679-5p	CLIP-seq
MIRT2090335	hsa-miR-3915	CLIP-seq
MIRT1305147	hsa-miR-3920	CLIP-seq
MIRT2090336	hsa-miR-3941	CLIP-seq
MIRT1305150	hsa-miR-4259	CLIP-seq
MIRT1305152	hsa-miR-429	CLIP-seq
MIRT1305153	hsa-miR-4306	CLIP-seq
MIRT2090337	hsa-miR-4436a	CLIP-seq
MIRT1305158	hsa-miR-4499	CLIP-seq
MIRT2090338	hsa-miR-449c	CLIP-seq
MIRT1305159	hsa-miR-451b	CLIP-seq
MIRT2090339	hsa-miR-452	CLIP-seq
MIRT1305160	hsa-miR-4520a-3p	CLIP-seq
MIRT1305161	hsa-miR-4520b-3p	CLIP-seq
MIRT1305164	hsa-miR-4644	CLIP-seq
MIRT1305165	hsa-miR-4645-3p	CLIP-seq
MIRT2090340	hsa-miR-466	CLIP-seq
MIRT1305167	hsa-miR-4660	CLIP-seq
MIRT2090341	hsa-miR-4672	CLIP-seq
MIRT2090342	hsa-miR-4676-3p	CLIP-seq
MIRT1305170	hsa-miR-4689	CLIP-seq
MIRT1305171	hsa-miR-4698	CLIP-seq
MIRT1305173	hsa-miR-4704-5p	CLIP-seq
MIRT1305175	hsa-miR-4715-5p	CLIP-seq
MIRT1305179	hsa-miR-4733-3p	CLIP-seq
MIRT1305180	hsa-miR-4762-3p	CLIP-seq
MIRT1305185	hsa-miR-4795-5p	CLIP-seq
MIRT1305186	hsa-miR-4799-5p	CLIP-seq
MIRT1305189	hsa-miR-485-3p	CLIP-seq
MIRT1305190	hsa-miR-487a	CLIP-seq
MIRT1305192	hsa-miR-504	CLIP-seq
MIRT1305193	hsa-miR-5047	CLIP-seq
MIRT1305196	hsa-miR-541	CLIP-seq
MIRT2090343	hsa-miR-548a-3p	CLIP-seq
MIRT2090344	hsa-miR-548ag	CLIP-seq
MIRT2090345	hsa-miR-548ai	CLIP-seq
MIRT2090346	hsa-miR-548e	CLIP-seq
MIRT2090347	hsa-miR-548f	CLIP-seq
MIRT1305199	hsa-miR-573	CLIP-seq
MIRT1305203	hsa-miR-617	CLIP-seq
MIRT2090348	hsa-miR-940	CLIP-seq
MIRT1305113	hsa-miR-103a	CLIP-seq
MIRT1305114	hsa-miR-107	CLIP-seq
MIRT1305115	hsa-miR-1207-3p	CLIP-seq
MIRT1305116	hsa-miR-1226	CLIP-seq
MIRT2315200	hsa-miR-1244	CLIP-seq
MIRT1305118	hsa-miR-1253	CLIP-seq
MIRT1305119	hsa-miR-1257	CLIP-seq
MIRT1305121	hsa-miR-1301	CLIP-seq
MIRT2315201	hsa-miR-142-5p	CLIP-seq
MIRT1305123	hsa-miR-146a	CLIP-seq
MIRT1305124	hsa-miR-154	CLIP-seq
MIRT1305125	hsa-miR-185	CLIP-seq
MIRT1305126	hsa-miR-1911	CLIP-seq
MIRT1305127	hsa-miR-200b	CLIP-seq
MIRT1305128	hsa-miR-200c	CLIP-seq
MIRT1305129	hsa-miR-218	CLIP-seq
MIRT1305130	hsa-miR-300	CLIP-seq
MIRT2315202	hsa-miR-302f	CLIP-seq
MIRT1305132	hsa-miR-3132	CLIP-seq
MIRT1305133	hsa-miR-3135b	CLIP-seq
MIRT2315203	hsa-miR-3152-5p	CLIP-seq
MIRT1305135	hsa-miR-3192	CLIP-seq
MIRT1305136	hsa-miR-3200-3p	CLIP-seq
MIRT1305138	hsa-miR-326	CLIP-seq
MIRT1305139	hsa-miR-330-5p	CLIP-seq
MIRT2315204	hsa-miR-337-3p	CLIP-seq
MIRT2315205	hsa-miR-340	CLIP-seq
MIRT1305142	hsa-miR-3650	CLIP-seq
MIRT1305143	hsa-miR-3660	CLIP-seq
MIRT1305144	hsa-miR-3689a-3p	CLIP-seq
MIRT1305145	hsa-miR-3689c	CLIP-seq
MIRT1305146	hsa-miR-381	CLIP-seq
MIRT1305147	hsa-miR-3920	CLIP-seq
MIRT1305148	hsa-miR-3934	CLIP-seq
MIRT1305149	hsa-miR-3935	CLIP-seq
MIRT2315206	hsa-miR-3937	CLIP-seq
MIRT1305150	hsa-miR-4259	CLIP-seq
MIRT1305151	hsa-miR-4268	CLIP-seq
MIRT1305152	hsa-miR-429	CLIP-seq
MIRT1305153	hsa-miR-4306	CLIP-seq
MIRT1305154	hsa-miR-4314	CLIP-seq
MIRT1305155	hsa-miR-4327	CLIP-seq
MIRT1305156	hsa-miR-4452	CLIP-seq
MIRT1305158	hsa-miR-4499	CLIP-seq
MIRT1305159	hsa-miR-451b	CLIP-seq
MIRT1305160	hsa-miR-4520a-3p	CLIP-seq
MIRT1305161	hsa-miR-4520b-3p	CLIP-seq
MIRT1305162	hsa-miR-4526	CLIP-seq
MIRT1305163	hsa-miR-4633-5p	CLIP-seq
MIRT1305164	hsa-miR-4644	CLIP-seq
MIRT1305166	hsa-miR-4646-5p	CLIP-seq
MIRT1305167	hsa-miR-4660	CLIP-seq
MIRT1305168	hsa-miR-4666-3p	CLIP-seq
MIRT1305169	hsa-miR-4667-5p	CLIP-seq
MIRT1305171	hsa-miR-4698	CLIP-seq
MIRT2315207	hsa-miR-4699-3p	CLIP-seq
MIRT1305172	hsa-miR-4700-5p	CLIP-seq
MIRT1305173	hsa-miR-4704-5p	CLIP-seq
MIRT1305174	hsa-miR-4715-3p	CLIP-seq
MIRT1305175	hsa-miR-4715-5p	CLIP-seq
MIRT2315208	hsa-miR-4719	CLIP-seq
MIRT1305176	hsa-miR-4720-3p	CLIP-seq
MIRT1305178	hsa-miR-4728-5p	CLIP-seq
MIRT1305179	hsa-miR-4733-3p	CLIP-seq
MIRT2315209	hsa-miR-4735-5p	CLIP-seq
MIRT2315210	hsa-miR-4760-3p	CLIP-seq
MIRT1305180	hsa-miR-4762-3p	CLIP-seq
MIRT1305184	hsa-miR-4789-5p	CLIP-seq
MIRT1305186	hsa-miR-4799-5p	CLIP-seq
MIRT1305188	hsa-miR-4804-3p	CLIP-seq
MIRT1305192	hsa-miR-504	CLIP-seq
MIRT1305193	hsa-miR-5047	CLIP-seq
MIRT2315211	hsa-miR-513b	CLIP-seq
MIRT1305194	hsa-miR-520g	CLIP-seq
MIRT1305195	hsa-miR-520h	CLIP-seq
MIRT1305196	hsa-miR-541	CLIP-seq
MIRT2315212	hsa-miR-548a-5p	CLIP-seq
MIRT2315213	hsa-miR-548ab	CLIP-seq
MIRT2315214	hsa-miR-548ak	CLIP-seq
MIRT2315215	hsa-miR-548b-5p	CLIP-seq
MIRT2315216	hsa-miR-548c-5p	CLIP-seq
MIRT2315217	hsa-miR-548d-5p	CLIP-seq
MIRT2315218	hsa-miR-548h	CLIP-seq
MIRT2315219	hsa-miR-548i	CLIP-seq
MIRT2315220	hsa-miR-548j	CLIP-seq
MIRT2315221	hsa-miR-548k	CLIP-seq
MIRT2315222	hsa-miR-548l	CLIP-seq
MIRT2315223	hsa-miR-548w	CLIP-seq
MIRT2315224	hsa-miR-548y	CLIP-seq
MIRT1305197	hsa-miR-554	CLIP-seq
MIRT2315225	hsa-miR-559	CLIP-seq
MIRT1305198	hsa-miR-561	CLIP-seq
MIRT1305200	hsa-miR-582-3p	CLIP-seq
MIRT1305201	hsa-miR-589	CLIP-seq
MIRT1305202	hsa-miR-597	CLIP-seq
MIRT1305203	hsa-miR-617	CLIP-seq
MIRT1305206	hsa-miR-636	CLIP-seq
MIRT1305207	hsa-miR-637	CLIP-seq
MIRT1305117	hsa-miR-1227	CLIP-seq
MIRT2315202	hsa-miR-302f	CLIP-seq
MIRT2315203	hsa-miR-3152-5p	CLIP-seq
MIRT2315206	hsa-miR-3937	CLIP-seq
MIRT1305174	hsa-miR-4715-3p	CLIP-seq
MIRT2315209	hsa-miR-4735-5p	CLIP-seq
MIRT1305194	hsa-miR-520g	CLIP-seq
MIRT1305195	hsa-miR-520h	CLIP-seq
MIRT1305205	hsa-miR-619	CLIP-seq
MIRT1305127	hsa-miR-200b	CLIP-seq
MIRT1305128	hsa-miR-200c	CLIP-seq
MIRT1305150	hsa-miR-4259	CLIP-seq
MIRT1305152	hsa-miR-429	CLIP-seq
MIRT1305160	hsa-miR-4520a-3p	CLIP-seq
MIRT1305161	hsa-miR-4520b-3p	CLIP-seq
MIRT1305175	hsa-miR-4715-5p	CLIP-seq
MIRT1305186	hsa-miR-4799-5p	CLIP-seq
MIRT1305196	hsa-miR-541	CLIP-seq
MIRT2611490	hsa-miR-1225-3p	CLIP-seq
MIRT1305116	hsa-miR-1226	CLIP-seq
MIRT2611491	hsa-miR-1233	CLIP-seq
MIRT2315200	hsa-miR-1244	CLIP-seq
MIRT1305119	hsa-miR-1257	CLIP-seq
MIRT1305120	hsa-miR-1276	CLIP-seq
MIRT2090328	hsa-miR-1286	CLIP-seq
MIRT1305121	hsa-miR-1301	CLIP-seq
MIRT2611492	hsa-miR-1305	CLIP-seq
MIRT2315201	hsa-miR-142-5p	CLIP-seq
MIRT1305122	hsa-miR-144	CLIP-seq
MIRT1305123	hsa-miR-146a	CLIP-seq
MIRT1305124	hsa-miR-154	CLIP-seq
MIRT2611493	hsa-miR-1587	CLIP-seq
MIRT1305126	hsa-miR-1911	CLIP-seq
MIRT1305127	hsa-miR-200b	CLIP-seq
MIRT1305128	hsa-miR-200c	CLIP-seq
MIRT2090330	hsa-miR-2682	CLIP-seq
MIRT1305130	hsa-miR-300	CLIP-seq
MIRT2315202	hsa-miR-302f	CLIP-seq
MIRT1305131	hsa-miR-3064-3p	CLIP-seq
MIRT2611494	hsa-miR-3065-5p	CLIP-seq
MIRT2611495	hsa-miR-3119	CLIP-seq
MIRT1305132	hsa-miR-3132	CLIP-seq
MIRT1305134	hsa-miR-3150b-3p	CLIP-seq
MIRT2315203	hsa-miR-3152-5p	CLIP-seq
MIRT1305135	hsa-miR-3192	CLIP-seq
MIRT1305136	hsa-miR-3200-3p	CLIP-seq
MIRT1305137	hsa-miR-323-3p	CLIP-seq
MIRT1305138	hsa-miR-326	CLIP-seq
MIRT1305139	hsa-miR-330-5p	CLIP-seq
MIRT2315204	hsa-miR-337-3p	CLIP-seq
MIRT2315205	hsa-miR-340	CLIP-seq
MIRT2611496	hsa-miR-345	CLIP-seq
MIRT2611497	hsa-miR-3609	CLIP-seq
MIRT2611498	hsa-miR-361-5p	CLIP-seq
MIRT1305140	hsa-miR-3616-5p	CLIP-seq
MIRT1305141	hsa-miR-3647-5p	CLIP-seq
MIRT1305142	hsa-miR-3650	CLIP-seq
MIRT2611499	hsa-miR-3653	CLIP-seq
MIRT2611500	hsa-miR-3658	CLIP-seq
MIRT1305143	hsa-miR-3660	CLIP-seq
MIRT2611501	hsa-miR-3662	CLIP-seq
MIRT2611502	hsa-miR-3675-5p	CLIP-seq
MIRT1305144	hsa-miR-3689a-3p	CLIP-seq
MIRT1305145	hsa-miR-3689c	CLIP-seq
MIRT1305146	hsa-miR-381	CLIP-seq
MIRT1305147	hsa-miR-3920	CLIP-seq
MIRT1305148	hsa-miR-3934	CLIP-seq
MIRT1305149	hsa-miR-3935	CLIP-seq
MIRT2315206	hsa-miR-3937	CLIP-seq
MIRT1305150	hsa-miR-4259	CLIP-seq
MIRT2611503	hsa-miR-4267	CLIP-seq
MIRT1305151	hsa-miR-4268	CLIP-seq
MIRT1305152	hsa-miR-429	CLIP-seq
MIRT1305154	hsa-miR-4314	CLIP-seq
MIRT2090337	hsa-miR-4436a	CLIP-seq
MIRT1305156	hsa-miR-4452	CLIP-seq
MIRT1305157	hsa-miR-4496	CLIP-seq
MIRT2090338	hsa-miR-449c	CLIP-seq
MIRT2611504	hsa-miR-4504	CLIP-seq
MIRT1305159	hsa-miR-451b	CLIP-seq
MIRT2090339	hsa-miR-452	CLIP-seq
MIRT1305162	hsa-miR-4526	CLIP-seq
MIRT1305163	hsa-miR-4633-5p	CLIP-seq
MIRT1305165	hsa-miR-4645-3p	CLIP-seq
MIRT1305166	hsa-miR-4646-5p	CLIP-seq
MIRT1305167	hsa-miR-4660	CLIP-seq
MIRT1305168	hsa-miR-4666-3p	CLIP-seq
MIRT1305169	hsa-miR-4667-5p	CLIP-seq
MIRT2611505	hsa-miR-4670-3p	CLIP-seq
MIRT2611506	hsa-miR-4674	CLIP-seq
MIRT2090342	hsa-miR-4676-3p	CLIP-seq
MIRT2611507	hsa-miR-4681	CLIP-seq
MIRT1305170	hsa-miR-4689	CLIP-seq
MIRT2315207	hsa-miR-4699-3p	CLIP-seq
MIRT1305172	hsa-miR-4700-5p	CLIP-seq
MIRT1305174	hsa-miR-4715-3p	CLIP-seq
MIRT1305175	hsa-miR-4715-5p	CLIP-seq
MIRT2315208	hsa-miR-4719	CLIP-seq
MIRT1305176	hsa-miR-4720-3p	CLIP-seq
MIRT1305177	hsa-miR-4727-5p	CLIP-seq
MIRT1305178	hsa-miR-4728-5p	CLIP-seq
MIRT1305179	hsa-miR-4733-3p	CLIP-seq
MIRT2315209	hsa-miR-4735-5p	CLIP-seq
MIRT2611508	hsa-miR-4753-3p	CLIP-seq
MIRT2315210	hsa-miR-4760-3p	CLIP-seq
MIRT1305180	hsa-miR-4762-3p	CLIP-seq
MIRT2611509	hsa-miR-4768-5p	CLIP-seq
MIRT1305181	hsa-miR-4769-3p	CLIP-seq
MIRT2611510	hsa-miR-4777-5p	CLIP-seq
MIRT1305182	hsa-miR-4784	CLIP-seq
MIRT1305183	hsa-miR-4788	CLIP-seq
MIRT1305184	hsa-miR-4789-5p	CLIP-seq
MIRT1305185	hsa-miR-4795-5p	CLIP-seq
MIRT1305186	hsa-miR-4799-5p	CLIP-seq
MIRT2611511	hsa-miR-4802-3p	CLIP-seq
MIRT1305187	hsa-miR-4803	CLIP-seq
MIRT1305188	hsa-miR-4804-3p	CLIP-seq
MIRT1305191	hsa-miR-502-5p	CLIP-seq
MIRT1305192	hsa-miR-504	CLIP-seq
MIRT1305193	hsa-miR-5047	CLIP-seq
MIRT2315211	hsa-miR-513b	CLIP-seq
MIRT2611512	hsa-miR-518d-5p	CLIP-seq
MIRT2611513	hsa-miR-519b-5p	CLIP-seq
MIRT2611514	hsa-miR-519c-5p	CLIP-seq
MIRT2611515	hsa-miR-520c-5p	CLIP-seq
MIRT1305194	hsa-miR-520g	CLIP-seq
MIRT1305195	hsa-miR-520h	CLIP-seq
MIRT2611516	hsa-miR-526a	CLIP-seq
MIRT1305196	hsa-miR-541	CLIP-seq
MIRT2090343	hsa-miR-548a-3p	CLIP-seq
MIRT2315212	hsa-miR-548a-5p	CLIP-seq
MIRT2315213	hsa-miR-548ab	CLIP-seq
MIRT2611517	hsa-miR-548ae	CLIP-seq
MIRT2611518	hsa-miR-548ah	CLIP-seq
MIRT2611519	hsa-miR-548aj	CLIP-seq
MIRT2315214	hsa-miR-548ak	CLIP-seq
MIRT2611520	hsa-miR-548am	CLIP-seq
MIRT2315215	hsa-miR-548b-5p	CLIP-seq
MIRT2315216	hsa-miR-548c-5p	CLIP-seq
MIRT2315217	hsa-miR-548d-5p	CLIP-seq
MIRT2090346	hsa-miR-548e	CLIP-seq
MIRT2090347	hsa-miR-548f	CLIP-seq
MIRT2315218	hsa-miR-548h	CLIP-seq
MIRT2315219	hsa-miR-548i	CLIP-seq
MIRT2315220	hsa-miR-548j	CLIP-seq
MIRT2315221	hsa-miR-548k	CLIP-seq
MIRT2315222	hsa-miR-548l	CLIP-seq
MIRT2611521	hsa-miR-548t	CLIP-seq
MIRT2315223	hsa-miR-548w	CLIP-seq
MIRT2611522	hsa-miR-548x	CLIP-seq
MIRT2315224	hsa-miR-548y	CLIP-seq
MIRT1305197	hsa-miR-554	CLIP-seq
MIRT2315225	hsa-miR-559	CLIP-seq
MIRT2611523	hsa-miR-563	CLIP-seq
MIRT1305199	hsa-miR-573	CLIP-seq
MIRT1305200	hsa-miR-582-3p	CLIP-seq
MIRT2611524	hsa-miR-587	CLIP-seq
MIRT1305201	hsa-miR-589	CLIP-seq
MIRT1305202	hsa-miR-597	CLIP-seq
MIRT1305203	hsa-miR-617	CLIP-seq
MIRT1305204	hsa-miR-618	CLIP-seq
MIRT1305205	hsa-miR-619	CLIP-seq
MIRT2611525	hsa-miR-635	CLIP-seq
MIRT1305207	hsa-miR-637	CLIP-seq
MIRT2090348	hsa-miR-940	CLIP-seq
MIRT2611490	hsa-miR-1225-3p	CLIP-seq
MIRT1305116	hsa-miR-1226	CLIP-seq
MIRT2611491	hsa-miR-1233	CLIP-seq
MIRT2315200	hsa-miR-1244	CLIP-seq
MIRT1305119	hsa-miR-1257	CLIP-seq
MIRT1305120	hsa-miR-1276	CLIP-seq
MIRT2090328	hsa-miR-1286	CLIP-seq
MIRT2611492	hsa-miR-1305	CLIP-seq
MIRT2315201	hsa-miR-142-5p	CLIP-seq
MIRT1305122	hsa-miR-144	CLIP-seq
MIRT1305123	hsa-miR-146a	CLIP-seq
MIRT1305124	hsa-miR-154	CLIP-seq
MIRT2611493	hsa-miR-1587	CLIP-seq
MIRT1305127	hsa-miR-200b	CLIP-seq
MIRT1305128	hsa-miR-200c	CLIP-seq
MIRT2090330	hsa-miR-2682	CLIP-seq
MIRT1305130	hsa-miR-300	CLIP-seq
MIRT2315202	hsa-miR-302f	CLIP-seq
MIRT1305131	hsa-miR-3064-3p	CLIP-seq
MIRT2611494	hsa-miR-3065-5p	CLIP-seq
MIRT2611495	hsa-miR-3119	CLIP-seq
MIRT1305132	hsa-miR-3132	CLIP-seq
MIRT1305134	hsa-miR-3150b-3p	CLIP-seq
MIRT2315203	hsa-miR-3152-5p	CLIP-seq
MIRT1305135	hsa-miR-3192	CLIP-seq
MIRT1305137	hsa-miR-323-3p	CLIP-seq
MIRT1305138	hsa-miR-326	CLIP-seq
MIRT1305139	hsa-miR-330-5p	CLIP-seq
MIRT2315204	hsa-miR-337-3p	CLIP-seq
MIRT2315205	hsa-miR-340	CLIP-seq
MIRT2611496	hsa-miR-345	CLIP-seq
MIRT2611498	hsa-miR-361-5p	CLIP-seq
MIRT1305140	hsa-miR-3616-5p	CLIP-seq
MIRT1305141	hsa-miR-3647-5p	CLIP-seq
MIRT1305142	hsa-miR-3650	CLIP-seq
MIRT2611499	hsa-miR-3653	CLIP-seq
MIRT2611500	hsa-miR-3658	CLIP-seq
MIRT2611501	hsa-miR-3662	CLIP-seq
MIRT2611502	hsa-miR-3675-5p	CLIP-seq
MIRT1305144	hsa-miR-3689a-3p	CLIP-seq
MIRT1305145	hsa-miR-3689c	CLIP-seq
MIRT1305146	hsa-miR-381	CLIP-seq
MIRT1305147	hsa-miR-3920	CLIP-seq
MIRT1305148	hsa-miR-3934	CLIP-seq
MIRT1305149	hsa-miR-3935	CLIP-seq
MIRT2315206	hsa-miR-3937	CLIP-seq
MIRT1305150	hsa-miR-4259	CLIP-seq
MIRT2611503	hsa-miR-4267	CLIP-seq
MIRT1305151	hsa-miR-4268	CLIP-seq
MIRT1305152	hsa-miR-429	CLIP-seq
MIRT1305154	hsa-miR-4314	CLIP-seq
MIRT2090337	hsa-miR-4436a	CLIP-seq
MIRT1305156	hsa-miR-4452	CLIP-seq
MIRT1305157	hsa-miR-4496	CLIP-seq
MIRT2090338	hsa-miR-449c	CLIP-seq
MIRT1305159	hsa-miR-451b	CLIP-seq
MIRT2090339	hsa-miR-452	CLIP-seq
MIRT1305160	hsa-miR-4520a-3p	CLIP-seq
MIRT1305161	hsa-miR-4520b-3p	CLIP-seq
MIRT1305163	hsa-miR-4633-5p	CLIP-seq
MIRT1305165	hsa-miR-4645-3p	CLIP-seq
MIRT1305166	hsa-miR-4646-5p	CLIP-seq
MIRT1305168	hsa-miR-4666-3p	CLIP-seq
MIRT1305169	hsa-miR-4667-5p	CLIP-seq
MIRT2611505	hsa-miR-4670-3p	CLIP-seq
MIRT2611506	hsa-miR-4674	CLIP-seq
MIRT2090342	hsa-miR-4676-3p	CLIP-seq
MIRT2611507	hsa-miR-4681	CLIP-seq
MIRT1305170	hsa-miR-4689	CLIP-seq
MIRT2315207	hsa-miR-4699-3p	CLIP-seq
MIRT1305172	hsa-miR-4700-5p	CLIP-seq
MIRT1305174	hsa-miR-4715-3p	CLIP-seq
MIRT1305175	hsa-miR-4715-5p	CLIP-seq
MIRT2315208	hsa-miR-4719	CLIP-seq
MIRT1305176	hsa-miR-4720-3p	CLIP-seq
MIRT1305178	hsa-miR-4728-5p	CLIP-seq
MIRT1305179	hsa-miR-4733-3p	CLIP-seq
MIRT2315209	hsa-miR-4735-5p	CLIP-seq
MIRT2611508	hsa-miR-4753-3p	CLIP-seq
MIRT2315210	hsa-miR-4760-3p	CLIP-seq
MIRT1305180	hsa-miR-4762-3p	CLIP-seq
MIRT2611509	hsa-miR-4768-5p	CLIP-seq
MIRT2611510	hsa-miR-4777-5p	CLIP-seq
MIRT1305182	hsa-miR-4784	CLIP-seq
MIRT1305183	hsa-miR-4788	CLIP-seq
MIRT1305184	hsa-miR-4789-5p	CLIP-seq
MIRT1305185	hsa-miR-4795-5p	CLIP-seq
MIRT1305186	hsa-miR-4799-5p	CLIP-seq
MIRT2611511	hsa-miR-4802-3p	CLIP-seq
MIRT1305187	hsa-miR-4803	CLIP-seq
MIRT1305188	hsa-miR-4804-3p	CLIP-seq
MIRT1305191	hsa-miR-502-5p	CLIP-seq
MIRT1305192	hsa-miR-504	CLIP-seq
MIRT2315211	hsa-miR-513b	CLIP-seq
MIRT2611512	hsa-miR-518d-5p	CLIP-seq
MIRT2611513	hsa-miR-519b-5p	CLIP-seq
MIRT2611514	hsa-miR-519c-5p	CLIP-seq
MIRT2611515	hsa-miR-520c-5p	CLIP-seq
MIRT1305194	hsa-miR-520g	CLIP-seq
MIRT1305195	hsa-miR-520h	CLIP-seq
MIRT2611516	hsa-miR-526a	CLIP-seq
MIRT1305196	hsa-miR-541	CLIP-seq
MIRT2090343	hsa-miR-548a-3p	CLIP-seq
MIRT2315212	hsa-miR-548a-5p	CLIP-seq
MIRT2315213	hsa-miR-548ab	CLIP-seq
MIRT2611517	hsa-miR-548ae	CLIP-seq
MIRT2611519	hsa-miR-548aj	CLIP-seq
MIRT2315214	hsa-miR-548ak	CLIP-seq
MIRT2611520	hsa-miR-548am	CLIP-seq
MIRT2315215	hsa-miR-548b-5p	CLIP-seq
MIRT2315216	hsa-miR-548c-5p	CLIP-seq
MIRT2315217	hsa-miR-548d-5p	CLIP-seq
MIRT2090346	hsa-miR-548e	CLIP-seq
MIRT2090347	hsa-miR-548f	CLIP-seq
MIRT2315218	hsa-miR-548h	CLIP-seq
MIRT2315219	hsa-miR-548i	CLIP-seq
MIRT2315220	hsa-miR-548j	CLIP-seq
MIRT2315221	hsa-miR-548k	CLIP-seq
MIRT2315222	hsa-miR-548l	CLIP-seq
MIRT2315223	hsa-miR-548w	CLIP-seq
MIRT2611522	hsa-miR-548x	CLIP-seq
MIRT2315224	hsa-miR-548y	CLIP-seq
MIRT1305197	hsa-miR-554	CLIP-seq
MIRT2315225	hsa-miR-559	CLIP-seq
MIRT2611523	hsa-miR-563	CLIP-seq
MIRT1305199	hsa-miR-573	CLIP-seq
MIRT1305200	hsa-miR-582-3p	CLIP-seq
MIRT2611524	hsa-miR-587	CLIP-seq
MIRT1305201	hsa-miR-589	CLIP-seq
MIRT1305202	hsa-miR-597	CLIP-seq
MIRT1305203	hsa-miR-617	CLIP-seq
MIRT1305205	hsa-miR-619	CLIP-seq
MIRT2611525	hsa-miR-635	CLIP-seq
MIRT1305207	hsa-miR-637	CLIP-seq
MIRT2090348	hsa-miR-940	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
PTTG1	Activation	22081074
STAT6	Activation	19857574

Gene ontology (GO) Show/Hide all (156)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000281	Process	Mitotic cytokinesis	IEA
GO:0000902	Process	Cell morphogenesis	IEA
GO:0001764	Process	Neuron migration	IEA
GO:0001822	Process	Kidney development	IEA
GO:0001998	Process	Angiotensin-mediated vasoconstriction involved in regulation of systemic arterial blood pressure	IEA
GO:0002363	Process	Alpha-beta T cell lineage commitment	IEA
GO:0003100	Process	Regulation of systemic arterial blood pressure by endothelin	IEA
GO:0003189	Process	Aortic valve formation	IGI	26188246
GO:0003924	Function	GTPase activity	EXP	18829532
GO:0003924	Function	GTPase activity	IBA
GO:0003924	Function	GTPase activity	IDA	19734146, 19787194, 26529257, 27917469
GO:0003924	Function	GTPase activity	IEA
GO:0003924	Function	GTPase activity	TAS	10436159
GO:0003925	Function	G protein activity	IDA	21565175, 23940119
GO:0003925	Function	G protein activity	IEA
GO:0005515	Function	Protein binding	IPI	9214622, 10051605, 10066731, 10489445, 11067852, 11335720, 11889037, 11927263, 12006984, 12879077, 14660612, 15364580, 15530360, 15644318, 16189514, 17115030, 18218625, 18256687, 19470470, 19887681, 19944695, 20195357, 20300064, 20348415, 20711218, 20974804, 21029865, 21281639, 2170
GO:0005525	Function	GTP binding	IBA
GO:0005525	Function	GTP binding	IDA	12777804, 15601624
GO:0005525	Function	GTP binding	IEA
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005768	Component	Endosome	IMP	19887681
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA	1328215
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0005938	Component	Cell cortex	IDA	16103226
GO:0005938	Component	Cell cortex	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0007010	Process	Cytoskeleton organization	IEA
GO:0007155	Process	Cell adhesion	IEA
GO:0007160	Process	Cell-matrix adhesion	IEA
GO:0007264	Process	Small GTPase-mediated signal transduction	IEA
GO:0007266	Process	Rho protein signal transduction	IBA
GO:0007266	Process	Rho protein signal transduction	IDA	21565175, 26529257
GO:0007266	Process	Rho protein signal transduction	IEA
GO:0007266	Process	Rho protein signal transduction	IMP	23241886, 31570889
GO:0007266	Process	Rho protein signal transduction	ISS
GO:0007266	Process	Rho protein signal transduction	TAS	10436159
GO:0007519	Process	Skeletal muscle tissue development	IEA
GO:0009898	Component	Cytoplasmic side of plasma membrane	IDA	1328215
GO:0010812	Process	Negative regulation of cell-substrate adhesion	IEA
GO:0010812	Process	Negative regulation of cell-substrate adhesion	ISS
GO:0010975	Process	Regulation of neuron projection development	IEA
GO:0016020	Component	Membrane	IEA
GO:0016477	Process	Cell migration	IBA
GO:0016477	Process	Cell migration	IDA	26529257
GO:0016477	Process	Cell migration	IGI	26188246
GO:0016477	Process	Cell migration	IMP	19782033
GO:0016787	Function	Hydrolase activity	IEA
GO:0017022	Function	Myosin binding	IPI	15644318
GO:0019901	Function	Protein kinase binding	IBA
GO:0021762	Process	Substantia nigra development	HEP	22926577
GO:0021795	Process	Cerebral cortex cell migration	IEA
GO:0021861	Process	Forebrain radial glial cell differentiation	IEA
GO:0030027	Component	Lamellipodium	IEA
GO:0030027	Component	Lamellipodium	ISS
GO:0030036	Process	Actin cytoskeleton organization	IEA
GO:0030036	Process	Actin cytoskeleton organization	IMP	19782033
GO:0030036	Process	Actin cytoskeleton organization	TAS	10436159
GO:0030054	Component	Cell junction	TAS
GO:0030154	Process	Cell differentiation	IEA
GO:0030334	Process	Regulation of cell migration	IMP	19934221
GO:0030335	Process	Positive regulation of cell migration	IEA
GO:0030425	Component	Dendrite	IEA
GO:0030496	Component	Midbody	IEA
GO:0030521	Process	Androgen receptor signaling pathway	IEA
GO:0030667	Component	Secretory granule membrane	TAS
GO:0031122	Process	Cytoplasmic microtubule organization	IMP	31570889
GO:0031982	Component	Vesicle	IDA	19887681
GO:0032154	Component	Cleavage furrow	IDA	16103226
GO:0032154	Component	Cleavage furrow	IEA
GO:0032467	Process	Positive regulation of cytokinesis	IMP	16103226, 17115030
GO:0032587	Component	Ruffle membrane	IEA
GO:0032956	Process	Regulation of actin cytoskeleton organization	IBA
GO:0032956	Process	Regulation of actin cytoskeleton organization	IDA	25911094
GO:0032956	Process	Regulation of actin cytoskeleton organization	IEA
GO:0033144	Process	Negative regulation of intracellular steroid hormone receptor signaling pathway	IEA
GO:0033688	Process	Regulation of osteoblast proliferation	IEA
GO:0033688	Process	Regulation of osteoblast proliferation	ISS
GO:0034329	Process	Cell junction assembly	IMP	22891260
GO:0034446	Process	Substrate adhesion-dependent cell spreading	IMP	31570889
GO:0035385	Process	Roundabout signaling pathway	IDA	26529257
GO:0036089	Process	Cleavage furrow formation	IDA	16103226
GO:0038027	Process	Apolipoprotein A-I-mediated signaling pathway	IMP	23726972
GO:0042476	Process	Odontogenesis	IEA
GO:0042995	Component	Cell projection	IEA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IEP	12761501
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IMP	25515214
GO:0043149	Process	Stress fiber assembly	IBA
GO:0043149	Process	Stress fiber assembly	IEA
GO:0043149	Process	Stress fiber assembly	IMP	19782033, 31570889
GO:0043197	Component	Dendritic spine	IBA
GO:0043296	Component	Apical junction complex	IDA	20974804
GO:0043297	Process	Apical junction assembly	IEA
GO:0043297	Process	Apical junction assembly	IMP	20974804
GO:0043366	Process	Beta selection	IEA
GO:0043542	Process	Endothelial cell migration	IGI	20208559
GO:0043931	Process	Ossification involved in bone maturation	IEA
GO:0043931	Process	Ossification involved in bone maturation	ISS
GO:0044319	Process	Wound healing, spreading of cells	ISS
GO:0045198	Process	Establishment of epithelial cell apical/basal polarity	IMP	22891260
GO:0045666	Process	Positive regulation of neuron differentiation	IMP	17488780
GO:0045792	Process	Negative regulation of cell size	IMP	8625410
GO:0046638	Process	Positive regulation of alpha-beta T cell differentiation	IEA
GO:0050919	Process	Negative chemotaxis	IMP	23726972
GO:0051301	Process	Cell division	IEA
GO:0051496	Process	Positive regulation of stress fiber assembly	IDA	15467718
GO:0051496	Process	Positive regulation of stress fiber assembly	IEA
GO:0051496	Process	Positive regulation of stress fiber assembly	IMP	8625410
GO:0051893	Process	Regulation of focal adhesion assembly	TAS	18981818
GO:0060071	Process	Wnt signaling pathway, planar cell polarity pathway	NAS	24431302
GO:0060193	Process	Positive regulation of lipase activity	IDA	19887681
GO:0060193	Process	Positive regulation of lipase activity	IMP	22740689
GO:0061430	Process	Bone trabecula morphogenesis	IEA
GO:0061430	Process	Bone trabecula morphogenesis	ISS
GO:0070062	Component	Extracellular exosome	HDA	19056867, 20458337
GO:0070507	Process	Regulation of microtubule cytoskeleton organization	IEA
GO:0071222	Process	Cellular response to lipopolysaccharide	IDA	19734146
GO:0071345	Process	Cellular response to cytokine stimulus	IMP	25515214
GO:0071526	Process	Semaphorin-plexin signaling pathway	IEA
GO:0071526	Process	Semaphorin-plexin signaling pathway	ISS
GO:0071803	Process	Positive regulation of podosome assembly	IEA
GO:0071902	Process	Positive regulation of protein serine/threonine kinase activity	IDA	8617235
GO:0071944	Component	Cell periphery	IMP	25911094
GO:0090051	Process	Negative regulation of cell migration involved in sprouting angiogenesis	IGI	20208559
GO:0090307	Process	Mitotic spindle assembly	IMP	19635168
GO:0090324	Process	Negative regulation of oxidative phosphorylation	IEA
GO:0097049	Process	Motor neuron apoptotic process	IEA
GO:0097498	Process	Endothelial tube lumen extension	IGI	20208559
GO:0098794	Component	Postsynapse	IDA	21423166, 24352656
GO:0098794	Component	Postsynapse	IMP	21423166, 24352656
GO:0098978	Component	Glutamatergic synapse	IDA	21423166, 24352656
GO:0098978	Component	Glutamatergic synapse	IMP	21423166, 24352656
GO:0099159	Process	Regulation of modification of postsynaptic structure	IDA	21423166
GO:0099159	Process	Regulation of modification of postsynaptic structure	IMP	21423166
GO:0101003	Component	Ficolin-1-rich granule membrane	TAS
GO:1901224	Process	Positive regulation of non-canonical NF-kappaB signal transduction	NAS	12761501
GO:1902766	Process	Skeletal muscle satellite cell migration	ISS
GO:1903427	Process	Negative regulation of reactive oxygen species biosynthetic process	IEA
GO:1903673	Process	Mitotic cleavage furrow formation	IMP	16103226
GO:1904695	Process	Positive regulation of vascular associated smooth muscle contraction	IEA
GO:1904996	Process	Positive regulation of leukocyte adhesion to vascular endothelial cell	IMP	25515214
GO:1905274	Process	Regulation of modification of postsynaptic actin cytoskeleton	IDA	21423166
GO:1905274	Process	Regulation of modification of postsynaptic actin cytoskeleton	IMP	21423166
GO:1990869	Process	Cellular response to chemokine	IMP	23241886
GO:2000177	Process	Regulation of neural precursor cell proliferation	IEA
GO:2000406	Process	Positive regulation of T cell migration	IMP	23241886
GO:2000672	Process	Negative regulation of motor neuron apoptotic process	IEA

Other IDs

• MIM: 165390
• HGNC: 667
• e!Ensembl: ENSG00000067560

Protein

• UniProt ID: P61586
• Protein name: Transforming protein RhoA (EC 3.6.5.2) (Rho cDNA clone 12) (h12)
• Protein function: Small GTPase which cycles between an active GTP-bound and an inactive GDP-bound state. Mainly associated with cytoskeleton organization, in active state binds to a variety of effector proteins to regulate cellular responses such as cytoskeletal
• PDB: 1A2B , 1CC0 , 1CXZ , 1DPF , 1FTN , 1KMQ , 1LB1 , 1OW3 , 1S1C , 1TX4 , 1X86 , 1XCG , 2RGN , 3KZ1 , 3LW8 , 3LWN , 3LXR , 3MSX , 3T06 , 4D0N , 4XH9 , 4XOI , 4XSG , 4XSH , 5A0F , 5BWM , 5C2K , 5C4M , 5EZ6 , 5FR1 , 5FR2 , 5HPY , 5IRC , 5JCP , 5JHG , 5JHH , 5M6X , 5M70 , 5ZHX , 6BC0 , 6BCA , 6BCB , 6KX2 , 6KX3 , 6R3V , 6V6M , 6V6U , 6V6V , 7G80 , 7G81 , 7G82
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00071	Ras	7 → 180	Ras family	Domain

• Sequence:

  MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT
  AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD
  LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ
  ARRGKKKSGCLVL

• Sequence length: 193

Pathways

KEGG Pathway	Reactome Pathway
Ras signaling pathway	GPVI-mediated activation cascade
Rap1 signaling pathway	Axonal growth inhibition (RHOA activation)
cGMP-PKG signaling pathway	Rho GTPase cycle
cAMP signaling pathway	PI3K/AKT activation
Chemokine signaling pathway	Axonal growth stimulation
Sphingolipid signaling pathway	TGF-beta receptor signaling in EMT (epithelial to mesenchymal transition)
Phospholipase D signaling pathway	G beta:gamma signalling through PI3Kgamma
Hormone signaling	EPHB-mediated forward signaling
Endocytosis	EPHA-mediated growth cone collapse
mTOR signaling pathway	PCP/CE pathway
Vascular smooth muscle contraction	G alpha (12/13) signalling events
Wnt signaling pathway	Sema4D mediated inhibition of cell attachment and migration
TGF-beta signaling pathway	Sema4D induced cell migration and growth-cone collapse
Axon guidance	VEGFA-VEGFR2 Pathway
Focal adhesion	RHO GTPases activate PKNs
Adherens junction	RHO GTPases activate CIT
Tight junction	RHO GTPases activate KTN1
Platelet activation	RHO GTPases Activate ROCKs
NOD-like receptor signaling pathway	RHO GTPases Activate Formins
C-type lectin receptor signaling pathway	RHO GTPases Activate Rhotekin and Rhophilins
T cell receptor signaling pathway	Ovarian tumor domain proteases
Leukocyte transendothelial migration	ERBB2 Regulates Cell Motility
Neurotrophin signaling pathway	Neutrophil degranulation
Regulation of actin cytoskeleton	PTK6 Regulates RHO GTPases, RAS GTPase and MAP kinases
Oxytocin signaling pathway	SLIT2:ROBO1 increases RHOA activity
Parathyroid hormone synthesis, secretion and action
Pancreatic secretion
Bacterial invasion of epithelial cells
Pathogenic Escherichia coli infection
Shigellosis
Salmonella infection
Pertussis
Yersinia infection
Tuberculosis
Human cytomegalovirus infection
Pathways in cancer
Viral carcinogenesis
Proteoglycans in cancer
MicroRNAs in cancer
Colorectal cancer
Lipid and atherosclerosis
Fluid shear stress and atherosclerosis

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
EBV-positive nodal T- and NK-cell lymphoma	Pathogenic	rs11552761	RCV004557917	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Ectodermal dysplasia with facial dysmorphism and acral, ocular, and brain anomalies	Likely pathogenic; Pathogenic	rs1333410252, rs1575653629, rs1575647025	RCV001526566 RCV001526531 RCV002221594	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Hemihypertrophy	Pathogenic	rs1575653629	RCV001526536	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Neoplasm	Pathogenic	rs11552761	RCV005230514	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
neuro-ectodermal phenotype	Pathogenic	rs1575653629	RCV001095368	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (18)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	34743297	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	35764056	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	35764056	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA	—	CTD	24816255	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL HEMIHYPERTROPHY	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	28714974, 28714975, 29212778, 36474045	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CRANIOFACIAL ABNORMALITIES	—	CTD, Disgenet CTD, Disgenet	31570889	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ECTODERMAL DYSPLASIA	—	CTD, Disgenet CTD, Disgenet	31570889	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	33462484	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	39792054	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	GWAS catalog	38072966	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROTEINURIA	—	CTD	19955829	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHOA-related disorder	Uncertain significance; Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STOMACH NEOPLASMS	—	CTD	15448013, 24816253, 24816255, 36914835	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE WITHDRAWAL SYNDROME	—	CTD	30158054	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TOOTH DISEASES	—	CTD, Disgenet CTD, Disgenet	31570889	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URINARY BLADDER NEOPLASMS	—	CTD	19896475	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (281)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	LHGDN	18495213		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	30425335		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	23358651		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	CLINVAR_DG	26619011		★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	26616858		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	26574607, 26847067		★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	CTD_human_DG	31570889		★☆☆☆☆ Found in Text Mining only
Alopecia, Male Pattern	Alopecia, Male Pattern	CTD_human_DG	31570889		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	28558704, 34326892	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anaplastic carcinoma	Anaplastic Carcinoma	CTD_human_DG	24816255		★☆☆☆☆ Found in Text Mining only
Androgenetic Alopecia	Androgenetic Alopecia	CTD_human_DG	31570889		★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	22982429	Inhibit	★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	22982429	Associate	★☆☆☆☆ Found in Text Mining only
Angioimmunoblastic Lymphadenopathy	Angioimmunoblastic T-cell lymphoma	BEFREE	24413734, 24413737, 24584070, 24689848, 25310466, 26431836, 26574844, 26719098, 27158755, 27177312, 28157189, 28634614, 28832024, 28945625, 29493850, 31394087		★☆☆☆☆ Found in Text Mining only
Angioimmunoblastic Lymphadenopathy	Angioimmunoblastic T-cell lymphoma	CTD_human_DG	24413737, 24584070		★☆☆☆☆ Found in Text Mining only
Anhydrotic Ectodermal Dysplasias	Hypohidrotic ectodermal dysplasia	CTD_human_DG	31570889		★☆☆☆☆ Found in Text Mining only
Antiphospholipid Syndrome	Antiphospholipid syndrome	Pubtator	18759277, 38155384	Associate	★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	CTD_human_DG	31570889		★☆☆☆☆ Found in Text Mining only
Arrhythmogenic Right Ventricular Dysplasia	Arrhythmogenic right ventricular cardiomyopathy	Pubtator	33670616	Associate	★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	23334894, 30957191		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	27498552	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	28791377		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	20006706, 20859068	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	23269839, 31361966		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	LHGDN	16978776		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	24333506	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	23334894, 30957191		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	25740292	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	28899000		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	33834070	Associate	★☆☆☆☆ Found in Text Mining only
Atrioventricular Block	Atrioventricular block	BEFREE	30412368		★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder with Hyperactivity	Attention deficit hyperactivity disorder	Pubtator	27004716	Associate	★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	24584070		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	29749520		★☆☆☆☆ Found in Text Mining only
Bernard Soulier Syndrome	Bernard-soulier syndrome	Pubtator	40045897	Associate	★☆☆☆☆ Found in Text Mining only
Beta ketothiolase deficiency	Beta-ketothiolase deficiency	Pubtator	26251521	Associate	★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	CTD_human_DG	19896475		★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	BEFREE	24098519		★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Brain ischemia	Pubtator	35760846	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	19124484, 22907703, 26142737, 27401250, 27713154, 30209686, 30719106, 8039707		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	12237774, 12771933, 15843433, 17332506, 18493596, 19533666, 19550117, 19815594, 20503409, 20655307, 20843787, 22002306, 22655072, 22992742, 23176180, 23420497, 23689132, 23762409, 23975422, 24086724, 24096540, 24241683, 25909173, 26142737, 26231656, 27175941, 27216196, 27626171, 27713154, 28232662, 29333087, 29752407, 31072418, 33162807, 34486491, 34895237, 37511111	Associate	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	25044415, 26616858		★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	26468873	Associate	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	18445682, 18505685, 18751372, 20503409, 24351810, 26066055, 26409448, 29949791, 32154766, 33388549	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	CTD_human_DG	24816255		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma	Carcinoma	BEFREE	28873240		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	33162807	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	18781093, 24498348, 24992599, 25238232, 25472720, 26846339, 27831648, 28695771, 31324164, 32955083, 35941537, 38341081	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	31339860, 34469466	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	23358651, 23704209, 27829229		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	17314270, 24351810, 29949791, 30795761	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	26483550, 26530532	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	18751372	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	23521319, 25343250, 26066055, 26177500, 30872677, 35373928, 36812376, 37298689	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Small Cell	Small cell carcinoma	Pubtator	36812376	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	26409448	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	30232004, 31976530	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	24351810		★☆☆☆☆ Found in Text Mining only
Carcinoma, Spindle-Cell	Carcinoma	CTD_human_DG	24816255		★☆☆☆☆ Found in Text Mining only
Cardiac Tamponade	Cardiac tamponade	Pubtator	35732446	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Alcoholic	Cardiomyopathy	BEFREE	31777538		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	26240115, 29735721	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	26556565, 31564129		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	23982754	Associate	★☆☆☆☆ Found in Text Mining only
Childhood Ataxia with Central Nervous System Hypomyelinization	Leukoencephalopathy with vanishing white matter	CTD_human_DG	31570889		★☆☆☆☆ Found in Text Mining only
Cholesteatoma	Cholesteatoma	Pubtator	35177391	Associate	★☆☆☆☆ Found in Text Mining only
Chromosomal Instability	Chromosomal instability	Pubtator	35484119	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	28260872		★☆☆☆☆ Found in Text Mining only
Cleft Lip	Cleft lip	Pubtator	34024335, 40414526	Associate	★☆☆☆☆ Found in Text Mining only
Cleft Palate	Cleft palate	Pubtator	34024335	Stimulate	★☆☆☆☆ Found in Text Mining only
Cleft Palate	Cleft palate	Pubtator	40414526	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	25413277		★☆☆☆☆ Found in Text Mining only
Colonic Diseases	Colonic disease	Pubtator	23437299	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	17178865		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	25413277, 8039707		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	25413277, 29206819		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	17597401		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	18922976, 19374769, 21430067, 21968138, 24958816, 27249601, 27333992, 27888624, 28146427, 28492141, 29206819, 30296500, 30846413, 33037251, 35647190, 36982429, 37193711	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	26261596	Inhibit	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	CLINVAR_DG	26619011		★☆☆☆☆ Found in Text Mining only
Conduction disorder of the heart	Conduction Disorder Of The Heart	BEFREE	30412368		★☆☆☆☆ Found in Text Mining only
Congenital diaphragmatic hernia	Congenital diaphragmatic hernia	CTD_human_DG	25783350		★☆☆☆☆ Found in Text Mining only
Congenital ectodermal dysplasia of face	Congenital Ectodermal Dysplasia Of Face	CTD_human_DG	31570889		★☆☆☆☆ Found in Text Mining only
Congenital hernia of foramen of Bochdalek	Posterolateral diaphragmatic hernia	CTD_human_DG	25783350		★☆☆☆☆ Found in Text Mining only
Congenital hernia of foramen of Morgagni	Morgagni diaphragmatic hernia	CTD_human_DG	25783350		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	26556565, 31777538		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	GWASCAT_DG	28714974, 28714975, 29212778		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Vasospasm	Coronary vasospasm	Pubtator	35096275	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	GWASDB_DG	17804789		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	33973626, 36812376	Associate	★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	36444838	Inhibit	★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	12948935		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	12948935	Stimulate	★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	17499483, 29239766	Associate	★☆☆☆☆ Found in Text Mining only
Deficiency of mevalonate kinase	Deficiency Of Mevalonate Kinase	BEFREE	25107911		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	31632513		★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	29498756	Associate	★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	40414526	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Complications	Diabetes complications	Pubtator	35806251	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	19754670, 22694757, 35592524	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	37182870	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	24642103	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	29654829		★☆☆☆☆ Found in Text Mining only
Diabetic Angiopathies	Diabetic angiopathies	Pubtator	22694757	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	32778679	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	29786744	Associate	★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	26616858		★☆☆☆☆ Found in Text Mining only
Ectodermal Dysplasia	Ectodermal Dysplasia	CTD_human_DG	31570889		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ectodermal Dysplasia	Ectodermal dysplasia	Pubtator	40414526	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Encephalitis	Encephalitis	Pubtator	22586486	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	30387365, 32457342, 39297944	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	24551285	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	CLINVAR_DG	26619011		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	31054987	Associate	★☆☆☆☆ Found in Text Mining only
Facial Dysmorphism with Multiple Malformations	Facial dysmorphism syndrome	Pubtator	40414526	Associate	★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	26385087		★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	CLINVAR_DG	26619011		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	CGI_DG			★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	27195967		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	LHGDN	17951409		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	17951409, 26459764, 26741994, 29115617, 29207169, 30886866, 32693062, 32945485, 34376733, 34638872, 35639414, 37427593, 39390804	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	31262726		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	30864699, 31262726		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	15992376, 17951409, 23577178	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	18088600		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	30848088		★☆☆☆☆ Found in Text Mining only
Glucocorticoid Receptor Deficiency	Glucocorticoid receptor deficiency/resistance	Pubtator	34262023	Associate	★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	20018869	Associate	★☆☆☆☆ Found in Text Mining only
Granulomatous Slack Skin	Granulomatous Slack Skin	CTD_human_DG	26192916		★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	35937945	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	29928977	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	31777538		★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	19451088	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Diffuse Gastric Cancer	Gastric Cancer	CTD_human_DG	15448013, 24816253, 24816255		★☆☆☆☆ Found in Text Mining only
Hidrotic Ectodermal Dysplasia	Hidrotic Ectodermal Dysplasia	CTD_human_DG	31570889		★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	28400465		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	23963366	Stimulate	★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	Pubtator	10930411	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	22430126, 26066055, 26100637	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension Pulmonary	Pulmonary hypertension	Pubtator	25853972	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	26556565		★☆☆☆☆ Found in Text Mining only
Hypopigmentation disorder	Hypopigmentation Disorder	BEFREE	31570889		★☆☆☆☆ Found in Text Mining only
Hypopigmentation disorder	Hypopigmentation Disorder	CTD_human_DG	31570889		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	17332506, 30535445, 31931758, 32671953, 35484119	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	21357506	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	28254846	Inhibit	★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	29673911		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	LHGDN	16776827		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	16776827, 29995590	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	35222396	Inhibit	★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	LHGDN	15925904		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	17218473	Associate	★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	35806251	Associate	★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	40414526	Associate	★☆☆☆☆ Found in Text Mining only
Interleukin 2 Receptor Alpha Deficiency of	Interleukin 2 receptor deficiency	Pubtator	22736314	Associate	★☆☆☆☆ Found in Text Mining only
Ischemic Stroke	Ischemic stroke	Pubtator	32945445	Associate	★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	26431836		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	40414526	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	30212930	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	18567581	Associate	★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	23023061	Associate	★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	Pubtator	29593724	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	11373293, 15331592, 30217930, 30568170	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	24280143, 25494542, 34792179	Associate	★☆☆☆☆ Found in Text Mining only
Leukoencephalopathy	Leukoencephalopathy	CTD_human_DG	31570889		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	17914970, 18651974, 18937283, 18996642		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	23842948, 31339860		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	35357779	Associate	★☆☆☆☆ Found in Text Mining only
Long QT Syndrome	Long qt syndrome	Pubtator	20629659	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	17273773		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	19154401, 19568240, 25120748, 25869366, 27802291, 28487954, 32495879, 34321041, 35538035, 36509758	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	22736314	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	38243295	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	23420497	Inhibit	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	25120748, 37132640	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	26409448	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	20844236, 25310466, 33567811	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	24675518, 25310466, 26574844, 31488561		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	25044415		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	25044415		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	CLINVAR_DG	26619011		★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	CTD_human_DG	26192916		★☆☆☆☆ Found in Text Mining only
Malformations of Cortical Development, Group II	Malformation of cortical development	BEFREE	31176306		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	19124484, 22907703, 26142737, 27401250, 27713154, 30719106, 8039707		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	29084958		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	23358651, 27829229		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	24351810		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	15754346, 22456196		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	CTD_human_DG	15448013, 24816253, 24816255		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	25823974, 26251521, 27566106, 27806312, 28522256, 28624843, 31115002, 31156701, 31771969		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	31820783		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	CTD_human_DG	19896475		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	20347825, 20383141, 25310466, 27566106, 27693615, 28624843, 30866419, 31156701, 31485674		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	25413277		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	15535843, 15574779, 15843433, 17332506		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CLINVAR_DG	26619011		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	18922893		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	19293150, 21917148, 23859498, 26823948, 26828592, 27549189, 27818281, 29048609, 31659259, 32085741, 33402468, 35440004	Associate	★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	37960805	Associate	★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	26554828, 36323745	Associate	★☆☆☆☆ Found in Text Mining only
Mevalonate Kinase Deficiency	Mevalonate kinase deficiency	Pubtator	20814828, 25107911, 38636615	Associate	★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	28254846	Inhibit	★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	28886265	Associate	★☆☆☆☆ Found in Text Mining only
Moyamoya Disease	Moyamoya disease	Pubtator	40634490	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	14504085, 18923442	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	32763844	Inhibit	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	33795012	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	31698570	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myopia	Myopia	BEFREE	30029249		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	33155211	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	18190825, 21208644, 23842948, 24337141, 25001480, 25079317, 25238232, 25823974, 26142737, 26554828, 26616858, 27806312, 29206819, 29398449, 30425335, 30785643, 31485674, 31771969		★☆☆☆☆ Found in Text Mining only
Neurocutaneous Syndromes	Neurocutaneous Syndromes	CTD_human_DG	31570889		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	28300846		★☆☆☆☆ Found in Text Mining only
Neuromuscular Diseases	Neuromuscular disease	Pubtator	37353484	Associate	★☆☆☆☆ Found in Text Mining only
Neutropenia Severe Congenital Autosomal Recessive 3	Severe congenital neutropenia	Pubtator	10779444	Associate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	36194662	Associate	★☆☆☆☆ Found in Text Mining only
Oculocerebrorenal Syndrome	Oculocerebrorenal syndrome	Pubtator	20629659	Associate	★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	27153759	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	LHGDN	18757369		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	19635168, 29751634	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	24614149, 30674565		★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	24351810		★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	24351810	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	19038009		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	12808121, 21643014, 22610942, 23042265, 24351810, 29642915, 33423701, 33685573	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	29949791	Stimulate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	23322732, 25019574, 26483550, 26747707, 27145964, 35277915	Associate	★☆☆☆☆ Found in Text Mining only
Papillary craniopharyngioma	Papillary Craniopharyngioma	BEFREE	16273260		★☆☆☆☆ Found in Text Mining only
Pelvic Organ Prolapse	Pelvic organ prolapse	Pubtator	25692679	Associate	★☆☆☆☆ Found in Text Mining only
Pemphigus	Pemphigus	Pubtator	24711455	Inhibit	★☆☆☆☆ Found in Text Mining only
Pericardial Effusion	Pericardial effusion	Pubtator	35732446	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	24413734, 24675518, 24689848, 26574844, 28157189, 29493850, 30829413, 31394087		★☆☆☆☆ Found in Text Mining only
Peripheral T-Cell Lymphoma	T-Cell Lymphoma	CTD_human_DG	24413734, 24413737		★☆☆☆☆ Found in Text Mining only
Pituitary dwarfism 1	Pituitary dwarfism	Pubtator	25485589	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	28949383	Associate	★☆☆☆☆ Found in Text Mining only
Portal Hypertension	Portal Hypertension	BEFREE	30840291		★☆☆☆☆ Found in Text Mining only
Prion Diseases	Prion disease	Pubtator	40414526	Associate	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	15754346, 22456196		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	12534282, 16402387, 16652149, 18172303, 18694745		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	17658517, 22504159, 23773523, 28184030, 29330286, 33897882	Associate	★☆☆☆☆ Found in Text Mining only
Pseudopelade	Pseudopelade	CTD_human_DG	31570889		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	29499154		★☆☆☆☆ Found in Text Mining only
Robinow Syndrome	Robinow syndrome	Pubtator	31570889	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	35484119	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	25569678	Associate	★☆☆☆☆ Found in Text Mining only
Spinal Muscular Atrophies of Childhood	Spinal muscular atrophy	Pubtator	32558393	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	17896152		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	30232004		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	11568556, 17018591, 20805359, 28886265	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	CLINVAR_DG	26619011		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	25001480		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	24816255, 25823974, 27566106, 27806312, 28522256, 28624843, 29247652, 31115002, 31156701, 31771969		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	15448013, 18300342		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach Neoplasms	CTD_human_DG	15448013, 24816253, 24816255		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach neoplasms	Pubtator	17659701, 18231637, 18300342, 18827818, 19372585, 24351810, 25079317, 25823974, 26251521, 26811494, 26830684, 27756879, 27904131, 28624843, 28836853, 29622765, 30425335, 31115002, 32053639, 33288739, 35076580, 37591783, 37670284, 38584451, 39350044	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stroke	Stroke	Pubtator	22167233	Associate	★☆☆☆☆ Found in Text Mining only
Syndactyly type 3	Syndactyly	Pubtator	40414526	Associate	★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	26615410		★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	24584070, 28157189		★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	CTD_human_DG	24584070		★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	18759277	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	31820783		★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	29236027	Inhibit	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	31820783		★☆☆☆☆ Found in Text Mining only
Tongue Neoplasms	Tongue cancer	Pubtator	37132640	Associate	★☆☆☆☆ Found in Text Mining only
Tooth Diseases	Tooth Diseases	CTD_human_DG	31570889		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	28779705		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	31836816, 33205415	Associate	★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous sclerosis complex	Pubtator	33972524	Associate	★☆☆☆☆ Found in Text Mining only
Undifferentiated carcinoma	Carcinoma	CTD_human_DG	24816255		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	32705161, 34285193	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	20429915, 31976530, 36300671	Associate	★☆☆☆☆ Found in Text Mining only
Vaginal Neoplasms	Vaginal neoplasms	Pubtator	28843271	Associate	★☆☆☆☆ Found in Text Mining only
Varicosity	Vulval varices	BEFREE	26827791		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	LHGDN	17947237		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	20530044, 22251897	Associate	★☆☆☆☆ Found in Text Mining only
Vascular System Injuries	Vascular system injury	Pubtator	26100637, 30536538	Associate	★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	Pubtator	29993181	Associate	★☆☆☆☆ Found in Text Mining only
Vasospasm Intracranial	Intracranial vasospasm	Pubtator	29735721	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

KRT16 2 shared diseasesEctodermal dysplasia, Urinary bladder neoplasms 2 shared evidence sourcesDisgenet (Ectodermal dysplasia), CTD (Urinary bladder neoplasms) Related via 2 shared diseases including Ectodermal dysplasia, Urinary bladder neoplasms — evidence mostly Disgenet. ANXA1 2 shared diseasesCarcinoma, Craniofacial abnormalities 3 shared evidence sourcesCTD (Carcinoma), CTD (Craniofacial abnormalities), Disgenet (Craniofacial abnormalities) Related via 2 shared diseases including Carcinoma, Craniofacial abnormalities — evidence mostly CTD. ACTG1 2 shared diseasesCarcinoma, Craniofacial abnormalities 18 shared pathwaysRap1 signaling pathway, Focal adhesion, Adherens junction, Tight junction, Platelet activation, Leukocyte transendothelial migration, Regulation of actin cytoskeleton, Oxytocin signaling pathway, Bacterial invasion of epithelial cells, Pathogenic Escherichia coli infection, Shigellosis, Salmonella infection +6 more 3 shared evidence sourcesCTD (Carcinoma), CTD (Craniofacial abnormalities), Disgenet (Craniofacial abnormalities) Related via 18 shared pathways including Rap1 signaling pathway, Focal adhesion — evidence mostly CTD. ACTB 2 shared diseasesCarcinoma, Craniofacial abnormalities 18 shared pathwaysRap1 signaling pathway, Focal adhesion, Adherens junction, Tight junction, Platelet activation, Leukocyte transendothelial migration, Regulation of actin cytoskeleton, Oxytocin signaling pathway, Bacterial invasion of epithelial cells, Pathogenic Escherichia coli infection, Shigellosis, Salmonella infection +6 more 3 shared evidence sourcesCTD (Carcinoma), CTD (Craniofacial abnormalities), Disgenet (Craniofacial abnormalities) Related via 18 shared pathways including Rap1 signaling pathway, Focal adhesion — evidence mostly CTD. ROCK2 26 shared pathwayscGMP-PKG signaling pathway, cAMP signaling pathway, Chemokine signaling pathway, Sphingolipid signaling pathway, Vascular smooth muscle contraction, Wnt signaling pathway, Axon guidance, Focal adhesion, Adherens junction, Tight junction, Platelet activation, Leukocyte transendothelial migration +14 more Related via 26 shared pathways including cGMP-PKG signaling pathway, cAMP signaling pathway.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
KRT16	2	["Ectodermal dysplasia","Urinary bladder neoplasms"]	0	[]	2	["Disgenet (Ectodermal dysplasia)","CTD (Urinary bladder neoplasms)"]
ANXA1	2	["Carcinoma","Craniofacial abnormalities"]	0	[]	3	["CTD (Carcinoma)","CTD (Craniofacial abnormalities)","Disgenet (Craniofacial abnormalities)"]
ACTG1	2	["Carcinoma","Craniofacial abnormalities"]	18	["Rap1 signaling pathway","Focal adhesion","Adherens junction","Tight junction","Platelet activation","Leukocyte transendothelial migration","Regulation of actin cytoskeleton","Oxytocin signaling pathway","Bacterial invasion of epithelial cells","Pathogenic Escherichia coli infection","Shigellosis","Salmonella infection"]	3	["CTD (Carcinoma)","CTD (Craniofacial abnormalities)","Disgenet (Craniofacial abnormalities)"]
ACTB	2	["Carcinoma","Craniofacial abnormalities"]	18	["Rap1 signaling pathway","Focal adhesion","Adherens junction","Tight junction","Platelet activation","Leukocyte transendothelial migration","Regulation of actin cytoskeleton","Oxytocin signaling pathway","Bacterial invasion of epithelial cells","Pathogenic Escherichia coli infection","Shigellosis","Salmonella infection"]	3	["CTD (Carcinoma)","CTD (Craniofacial abnormalities)","Disgenet (Craniofacial abnormalities)"]
ROCK2	0	[]	26	["cGMP-PKG signaling pathway","cAMP signaling pathway","Chemokine signaling pathway","Sphingolipid signaling pathway","Vascular smooth muscle contraction","Wnt signaling pathway","Axon guidance","Focal adhesion","Adherens junction","Tight junction","Platelet activation","Leukocyte transendothelial migration"]	0	[]

Diseases Linked via Similar Genes

Bipolar disorder Linked via 2 of 5 related genesANXA1, ACTB Baraitser-winter cerebrofrontofacial syndrome Linked via 2 of 5 related genesACTG1, ACTB Coloboma Linked via 2 of 5 related genesACTG1, ACTB Congenital neurologic anomalies Linked via 2 of 5 related genesACTG1, ACTB Congenital ocular coloboma Linked via 2 of 5 related genesACTG1, ACTB

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Bipolar disorder	2	["ANXA1","ACTB"]
Baraitser-winter cerebrofrontofacial syndrome	2	["ACTG1","ACTB"]
Coloboma	2	["ACTG1","ACTB"]
Congenital neurologic anomalies	2	["ACTG1","ACTB"]
Congenital ocular coloboma	2	["ACTG1","ACTB"]