Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Other IDs Associated diseases
Entrez ID	9475
Gene name	Rho associated coiled-coil containing protein kinase 2
Gene symbol	ROCK2
Synonyms (NCBI Gene)	ROCK-II
Chromosome	2
Chromosome location	2p25.1
Summary	The protein encoded by this gene is a serine/threonine kinase that regulates cytokinesis, smooth muscle contraction, the formation of actin stress fibers and focal adhesions, and the activation of the c-fos serum response element. This protein, which is a

423

Show/Hide all (423)

miRTarBase ID	miRNA	Experiments	Reference
MIRT000494	hsa-miR-138-5p	qRT-PCRLuciferase reporter assayWestern blot	20232393
MIRT006478	hsa-miR-124-3p	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	21672940
MIRT006478	hsa-miR-124-3p	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	21672940
MIRT000494	hsa-miR-138-5p	Reporter assay;Other	20232393
MIRT006478	hsa-miR-124-3p	Reporter assay;qRT-PCR	21672940
MIRT052902	hsa-miR-142-3p	Luciferase reporter assayqRT-PCRWestern blot	24743945
MIRT054808	hsa-miR-139-5p	Luciferase reporter assayWestern blotqRT-PCR	24942287
MIRT438204	hsa-miR-200b-3p	Luciferase reporter assay	24169343
MIRT438203	hsa-miR-200c-3p	Luciferase reporter assay	24169343
MIRT438204	hsa-miR-200b-3p	Luciferase reporter assay	24169343
MIRT438203	hsa-miR-200c-3p	Luciferase reporter assay	24169343
MIRT542158	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT707468	hsa-miR-625-3p	HITS-CLIP	21572407
MIRT542164	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT707467	hsa-miR-511-3p	HITS-CLIP	21572407
MIRT707466	hsa-miR-574-5p	HITS-CLIP	21572407
MIRT707465	hsa-miR-6867-5p	HITS-CLIP	21572407
MIRT707464	hsa-miR-4789-5p	HITS-CLIP	21572407
MIRT542161	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT707463	hsa-miR-4455	HITS-CLIP	21572407
MIRT542158	hsa-miR-1277-5p	HITS-CLIP	23313552
MIRT542163	hsa-miR-519d-5p	HITS-CLIP	23313552
MIRT542162	hsa-miR-5695	HITS-CLIP	23313552
MIRT542161	hsa-miR-190a-3p	HITS-CLIP	23313552
MIRT542160	hsa-miR-515-5p	HITS-CLIP	23313552
MIRT542159	hsa-miR-519e-5p	HITS-CLIP	23313552
MIRT542158	hsa-miR-1277-5p	HITS-CLIP	23313552
MIRT542163	hsa-miR-519d-5p	HITS-CLIP	23313552
MIRT542162	hsa-miR-5695	HITS-CLIP	23313552
MIRT542160	hsa-miR-515-5p	HITS-CLIP	23313552
MIRT542159	hsa-miR-519e-5p	HITS-CLIP	23313552
MIRT542164	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT542163	hsa-miR-519d-5p	HITS-CLIP	23824327
MIRT542162	hsa-miR-5695	HITS-CLIP	23824327
MIRT542161	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT542160	hsa-miR-515-5p	HITS-CLIP	23824327
MIRT542159	hsa-miR-519e-5p	HITS-CLIP	23824327
MIRT542158	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT542164	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT542163	hsa-miR-519d-5p	PAR-CLIP	21572407
MIRT542162	hsa-miR-5695	PAR-CLIP	21572407
MIRT542161	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT542160	hsa-miR-515-5p	PAR-CLIP	21572407
MIRT542159	hsa-miR-519e-5p	PAR-CLIP	21572407
MIRT542158	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT448514	hsa-miR-30a-5p	PAR-CLIP	22100165
MIRT448513	hsa-miR-30d-5p	PAR-CLIP	22100165
MIRT448512	hsa-miR-30e-5p	PAR-CLIP	22100165
MIRT448511	hsa-miR-30c-5p	PAR-CLIP	22100165
MIRT448510	hsa-miR-30b-5p	PAR-CLIP	22100165
MIRT448509	hsa-miR-4495	PAR-CLIP	22100165
MIRT448508	hsa-miR-379-3p	PAR-CLIP	22100165
MIRT448507	hsa-miR-411-3p	PAR-CLIP	22100165
MIRT448506	hsa-miR-380-3p	PAR-CLIP	22100165
MIRT448505	hsa-miR-5007-3p	PAR-CLIP	22100165
MIRT448504	hsa-miR-203a-3p	PAR-CLIP	22100165
MIRT448514	hsa-miR-30a-5p	PAR-CLIP	22100165
MIRT448513	hsa-miR-30d-5p	PAR-CLIP	22100165
MIRT448512	hsa-miR-30e-5p	PAR-CLIP	22100165
MIRT448511	hsa-miR-30c-5p	PAR-CLIP	22100165
MIRT448510	hsa-miR-30b-5p	PAR-CLIP	22100165
MIRT448509	hsa-miR-4495	PAR-CLIP	22100165
MIRT448508	hsa-miR-379-3p	PAR-CLIP	22100165
MIRT448507	hsa-miR-411-3p	PAR-CLIP	22100165
MIRT448506	hsa-miR-380-3p	PAR-CLIP	22100165
MIRT448505	hsa-miR-5007-3p	PAR-CLIP	22100165
MIRT448504	hsa-miR-203a-3p	PAR-CLIP	22100165
MIRT052902	hsa-miR-142-3p	HITS-CLIP	22473208
MIRT052902	hsa-miR-142-3p	HITS-CLIP	22473208
MIRT438204	hsa-miR-200b-3p	Luciferase reporter assay	26903801
MIRT438204	hsa-miR-200b-3p	Luciferase reporter assay	26903801
MIRT542158	hsa-miR-1277-5p	HITS-CLIP	21572407
MIRT707468	hsa-miR-625-3p	HITS-CLIP	21572407
MIRT542164	hsa-miR-5011-5p	HITS-CLIP	21572407
MIRT707467	hsa-miR-511-3p	HITS-CLIP	21572407
MIRT707466	hsa-miR-574-5p	HITS-CLIP	21572407
MIRT707465	hsa-miR-6867-5p	HITS-CLIP	21572407
MIRT707464	hsa-miR-4789-5p	HITS-CLIP	21572407
MIRT542161	hsa-miR-190a-3p	HITS-CLIP	21572407
MIRT707463	hsa-miR-4455	HITS-CLIP	21572407
MIRT542158	hsa-miR-1277-5p	HITS-CLIP	23313552
MIRT542163	hsa-miR-519d-5p	HITS-CLIP	23313552
MIRT542162	hsa-miR-5695	HITS-CLIP	23313552
MIRT542161	hsa-miR-190a-3p	HITS-CLIP	23313552
MIRT542160	hsa-miR-515-5p	HITS-CLIP	23313552
MIRT542159	hsa-miR-519e-5p	HITS-CLIP	23313552
MIRT542158	hsa-miR-1277-5p	HITS-CLIP	23313552
MIRT542163	hsa-miR-519d-5p	HITS-CLIP	23313552
MIRT542162	hsa-miR-5695	HITS-CLIP	23313552
MIRT542160	hsa-miR-515-5p	HITS-CLIP	23313552
MIRT542159	hsa-miR-519e-5p	HITS-CLIP	23313552
MIRT542164	hsa-miR-5011-5p	HITS-CLIP	23824327
MIRT542163	hsa-miR-519d-5p	HITS-CLIP	23824327
MIRT542162	hsa-miR-5695	HITS-CLIP	23824327
MIRT542161	hsa-miR-190a-3p	HITS-CLIP	23824327
MIRT542160	hsa-miR-515-5p	HITS-CLIP	23824327
MIRT542159	hsa-miR-519e-5p	HITS-CLIP	23824327
MIRT542158	hsa-miR-1277-5p	HITS-CLIP	23824327
MIRT542164	hsa-miR-5011-5p	PAR-CLIP	21572407
MIRT542163	hsa-miR-519d-5p	PAR-CLIP	21572407
MIRT542162	hsa-miR-5695	PAR-CLIP	21572407
MIRT542161	hsa-miR-190a-3p	PAR-CLIP	21572407
MIRT542160	hsa-miR-515-5p	PAR-CLIP	21572407
MIRT542159	hsa-miR-519e-5p	PAR-CLIP	21572407
MIRT542158	hsa-miR-1277-5p	PAR-CLIP	21572407
MIRT448514	hsa-miR-30a-5p	PAR-CLIP	22100165
MIRT448513	hsa-miR-30d-5p	PAR-CLIP	22100165
MIRT448512	hsa-miR-30e-5p	PAR-CLIP	22100165
MIRT448511	hsa-miR-30c-5p	PAR-CLIP	22100165
MIRT448510	hsa-miR-30b-5p	PAR-CLIP	22100165
MIRT448509	hsa-miR-4495	PAR-CLIP	22100165
MIRT448508	hsa-miR-379-3p	PAR-CLIP	22100165
MIRT448507	hsa-miR-411-3p	PAR-CLIP	22100165
MIRT448506	hsa-miR-380-3p	PAR-CLIP	22100165
MIRT448505	hsa-miR-5007-3p	PAR-CLIP	22100165
MIRT448504	hsa-miR-203a-3p	PAR-CLIP	22100165
MIRT448514	hsa-miR-30a-5p	PAR-CLIP	22100165
MIRT448513	hsa-miR-30d-5p	PAR-CLIP	22100165
MIRT448512	hsa-miR-30e-5p	PAR-CLIP	22100165
MIRT448511	hsa-miR-30c-5p	PAR-CLIP	22100165
MIRT448510	hsa-miR-30b-5p	PAR-CLIP	22100165
MIRT448509	hsa-miR-4495	PAR-CLIP	22100165
MIRT448508	hsa-miR-379-3p	PAR-CLIP	22100165
MIRT448507	hsa-miR-411-3p	PAR-CLIP	22100165
MIRT448506	hsa-miR-380-3p	PAR-CLIP	22100165
MIRT448505	hsa-miR-5007-3p	PAR-CLIP	22100165
MIRT448504	hsa-miR-203a-3p	PAR-CLIP	22100165
MIRT755497	hsa-miR-30a-3p	Luciferase reporter assayWestern blottingqRT-PCRIn situ hybridization	37899171
MIRT1314703	hsa-miR-103a	CLIP-seq
MIRT1314704	hsa-miR-107	CLIP-seq
MIRT1314705	hsa-miR-1184	CLIP-seq
MIRT1314706	hsa-miR-122	CLIP-seq
MIRT1314707	hsa-miR-1299	CLIP-seq
MIRT1314708	hsa-miR-1324	CLIP-seq
MIRT1314709	hsa-miR-135a	CLIP-seq
MIRT1314710	hsa-miR-135b	CLIP-seq
MIRT1314711	hsa-miR-150	CLIP-seq
MIRT1314712	hsa-miR-153	CLIP-seq
MIRT1314713	hsa-miR-1972	CLIP-seq
MIRT1314714	hsa-miR-1976	CLIP-seq
MIRT1314715	hsa-miR-200b	CLIP-seq
MIRT1314716	hsa-miR-200c	CLIP-seq
MIRT1314717	hsa-miR-22	CLIP-seq
MIRT1314718	hsa-miR-31	CLIP-seq
MIRT1314719	hsa-miR-3119	CLIP-seq
MIRT1314720	hsa-miR-3126-3p	CLIP-seq
MIRT1314721	hsa-miR-3135b	CLIP-seq
MIRT1314722	hsa-miR-3145-5p	CLIP-seq
MIRT1314723	hsa-miR-3148	CLIP-seq
MIRT1314724	hsa-miR-3149	CLIP-seq
MIRT1314725	hsa-miR-3163	CLIP-seq
MIRT1314726	hsa-miR-3192	CLIP-seq
MIRT1314727	hsa-miR-3529	CLIP-seq
MIRT1314728	hsa-miR-362-5p	CLIP-seq
MIRT1314729	hsa-miR-3652	CLIP-seq
MIRT1314730	hsa-miR-3662	CLIP-seq
MIRT1314731	hsa-miR-3672	CLIP-seq
MIRT1314732	hsa-miR-3674	CLIP-seq
MIRT1314733	hsa-miR-3681	CLIP-seq
MIRT1314734	hsa-miR-3688-3p	CLIP-seq
MIRT1314735	hsa-miR-374c	CLIP-seq
MIRT1314736	hsa-miR-379	CLIP-seq
MIRT1314737	hsa-miR-4279	CLIP-seq
MIRT1314738	hsa-miR-4289	CLIP-seq
MIRT1314739	hsa-miR-429	CLIP-seq
MIRT1314740	hsa-miR-4314	CLIP-seq
MIRT1314741	hsa-miR-4329	CLIP-seq
MIRT1314742	hsa-miR-4418	CLIP-seq
MIRT1314743	hsa-miR-4421	CLIP-seq
MIRT1314744	hsa-miR-4422	CLIP-seq
MIRT1314745	hsa-miR-4430	CLIP-seq
MIRT1314746	hsa-miR-4438	CLIP-seq
MIRT1314747	hsa-miR-4446-3p	CLIP-seq
MIRT1314748	hsa-miR-4451	CLIP-seq
MIRT1314749	hsa-miR-4474-5p	CLIP-seq
MIRT1314750	hsa-miR-448	CLIP-seq
MIRT1314751	hsa-miR-450b-3p	CLIP-seq
MIRT1314752	hsa-miR-4646-5p	CLIP-seq
MIRT1314753	hsa-miR-4650-3p	CLIP-seq
MIRT1314754	hsa-miR-4656	CLIP-seq
MIRT1314755	hsa-miR-4676-5p	CLIP-seq
MIRT1314756	hsa-miR-4684-3p	CLIP-seq
MIRT1314757	hsa-miR-4713-3p	CLIP-seq
MIRT1314758	hsa-miR-4735-5p	CLIP-seq
MIRT1314759	hsa-miR-4775	CLIP-seq
MIRT1314760	hsa-miR-500b	CLIP-seq
MIRT1314761	hsa-miR-501-5p	CLIP-seq
MIRT1314762	hsa-miR-509-3-5p	CLIP-seq
MIRT1314763	hsa-miR-5095	CLIP-seq
MIRT1314764	hsa-miR-509-5p	CLIP-seq
MIRT1314765	hsa-miR-545	CLIP-seq
MIRT1314766	hsa-miR-548al	CLIP-seq
MIRT1314767	hsa-miR-562	CLIP-seq
MIRT1314768	hsa-miR-568	CLIP-seq
MIRT1314769	hsa-miR-575	CLIP-seq
MIRT1314770	hsa-miR-580	CLIP-seq
MIRT1314771	hsa-miR-590-3p	CLIP-seq
MIRT1314772	hsa-miR-603	CLIP-seq
MIRT1314773	hsa-miR-638	CLIP-seq
MIRT1314774	hsa-miR-655	CLIP-seq
MIRT1314775	hsa-miR-659	CLIP-seq
MIRT1314776	hsa-miR-7	CLIP-seq
MIRT1314777	hsa-miR-769-3p	CLIP-seq
MIRT1314778	hsa-miR-875-3p	CLIP-seq
MIRT1314779	hsa-miR-891b	CLIP-seq
MIRT1314706	hsa-miR-122	CLIP-seq
MIRT1314717	hsa-miR-22	CLIP-seq
MIRT1314721	hsa-miR-3135b	CLIP-seq
MIRT1314729	hsa-miR-3652	CLIP-seq
MIRT1314745	hsa-miR-4430	CLIP-seq
MIRT1314776	hsa-miR-7	CLIP-seq
MIRT2093605	hsa-miR-1185	CLIP-seq
MIRT1314706	hsa-miR-122	CLIP-seq
MIRT2093606	hsa-miR-1254	CLIP-seq
MIRT2093607	hsa-miR-1266	CLIP-seq
MIRT2093608	hsa-miR-1279	CLIP-seq
MIRT2093609	hsa-miR-1343	CLIP-seq
MIRT1314711	hsa-miR-150	CLIP-seq
MIRT1314712	hsa-miR-153	CLIP-seq
MIRT1314713	hsa-miR-1972	CLIP-seq
MIRT1314714	hsa-miR-1976	CLIP-seq
MIRT1314715	hsa-miR-200b	CLIP-seq
MIRT1314716	hsa-miR-200c	CLIP-seq
MIRT1314717	hsa-miR-22	CLIP-seq
MIRT2093610	hsa-miR-297	CLIP-seq
MIRT2093611	hsa-miR-3064-3p	CLIP-seq
MIRT2093612	hsa-miR-3116	CLIP-seq
MIRT1314721	hsa-miR-3135b	CLIP-seq
MIRT2093613	hsa-miR-3605-5p	CLIP-seq
MIRT1314728	hsa-miR-362-5p	CLIP-seq
MIRT1314729	hsa-miR-3652	CLIP-seq
MIRT2093614	hsa-miR-3659	CLIP-seq
MIRT2093615	hsa-miR-3664-3p	CLIP-seq
MIRT2093616	hsa-miR-3679-5p	CLIP-seq
MIRT2093617	hsa-miR-3924	CLIP-seq
MIRT1314737	hsa-miR-4279	CLIP-seq
MIRT1314738	hsa-miR-4289	CLIP-seq
MIRT1314739	hsa-miR-429	CLIP-seq
MIRT2093618	hsa-miR-4420	CLIP-seq
MIRT1314743	hsa-miR-4421	CLIP-seq
MIRT1314745	hsa-miR-4430	CLIP-seq
MIRT2093619	hsa-miR-4435	CLIP-seq
MIRT1314746	hsa-miR-4438	CLIP-seq
MIRT1314749	hsa-miR-4474-5p	CLIP-seq
MIRT2093620	hsa-miR-4518	CLIP-seq
MIRT2093621	hsa-miR-4649-3p	CLIP-seq
MIRT2093622	hsa-miR-4658	CLIP-seq
MIRT2093623	hsa-miR-4717-5p	CLIP-seq
MIRT1314758	hsa-miR-4735-5p	CLIP-seq
MIRT1314759	hsa-miR-4775	CLIP-seq
MIRT2093624	hsa-miR-4789-3p	CLIP-seq
MIRT2093625	hsa-miR-498	CLIP-seq
MIRT1314760	hsa-miR-500b	CLIP-seq
MIRT1314761	hsa-miR-501-5p	CLIP-seq
MIRT1314763	hsa-miR-5095	CLIP-seq
MIRT2093626	hsa-miR-5096	CLIP-seq
MIRT2093627	hsa-miR-513a-3p	CLIP-seq
MIRT1314767	hsa-miR-562	CLIP-seq
MIRT2093628	hsa-miR-567	CLIP-seq
MIRT1314771	hsa-miR-590-3p	CLIP-seq
MIRT2093629	hsa-miR-622	CLIP-seq
MIRT2093630	hsa-miR-654-3p	CLIP-seq
MIRT1314775	hsa-miR-659	CLIP-seq
MIRT2093631	hsa-miR-661	CLIP-seq
MIRT1314776	hsa-miR-7	CLIP-seq
MIRT2093632	hsa-miR-873	CLIP-seq
MIRT1314703	hsa-miR-103a	CLIP-seq
MIRT1314704	hsa-miR-107	CLIP-seq
MIRT1314705	hsa-miR-1184	CLIP-seq
MIRT2318122	hsa-miR-1207-3p	CLIP-seq
MIRT1314706	hsa-miR-122	CLIP-seq
MIRT2093607	hsa-miR-1266	CLIP-seq
MIRT2093608	hsa-miR-1279	CLIP-seq
MIRT2093609	hsa-miR-1343	CLIP-seq
MIRT1314711	hsa-miR-150	CLIP-seq
MIRT1314712	hsa-miR-153	CLIP-seq
MIRT1314713	hsa-miR-1972	CLIP-seq
MIRT1314714	hsa-miR-1976	CLIP-seq
MIRT1314717	hsa-miR-22	CLIP-seq
MIRT2318123	hsa-miR-300	CLIP-seq
MIRT1314721	hsa-miR-3135b	CLIP-seq
MIRT2318124	hsa-miR-3200-5p	CLIP-seq
MIRT2318125	hsa-miR-3591-3p	CLIP-seq
MIRT1314728	hsa-miR-362-5p	CLIP-seq
MIRT1314729	hsa-miR-3652	CLIP-seq
MIRT2093615	hsa-miR-3664-3p	CLIP-seq
MIRT1314732	hsa-miR-3674	CLIP-seq
MIRT2318126	hsa-miR-3689a-5p	CLIP-seq
MIRT2318127	hsa-miR-3689b	CLIP-seq
MIRT2318128	hsa-miR-3689e	CLIP-seq
MIRT2318129	hsa-miR-3689f	CLIP-seq
MIRT2318130	hsa-miR-381	CLIP-seq
MIRT2318131	hsa-miR-3920	CLIP-seq
MIRT2318132	hsa-miR-3977	CLIP-seq
MIRT1314737	hsa-miR-4279	CLIP-seq
MIRT1314738	hsa-miR-4289	CLIP-seq
MIRT1314742	hsa-miR-4418	CLIP-seq
MIRT2093618	hsa-miR-4420	CLIP-seq
MIRT1314743	hsa-miR-4421	CLIP-seq
MIRT1314745	hsa-miR-4430	CLIP-seq
MIRT1314746	hsa-miR-4438	CLIP-seq
MIRT1314749	hsa-miR-4474-5p	CLIP-seq
MIRT1314750	hsa-miR-448	CLIP-seq
MIRT2093620	hsa-miR-4518	CLIP-seq
MIRT2318133	hsa-miR-4529-5p	CLIP-seq
MIRT2318134	hsa-miR-4640-5p	CLIP-seq
MIRT2318135	hsa-miR-4666-3p	CLIP-seq
MIRT2318136	hsa-miR-4672	CLIP-seq
MIRT1314756	hsa-miR-4684-3p	CLIP-seq
MIRT2318137	hsa-miR-4714-3p	CLIP-seq
MIRT2093623	hsa-miR-4717-5p	CLIP-seq
MIRT2318138	hsa-miR-4720-3p	CLIP-seq
MIRT2318139	hsa-miR-4726-5p	CLIP-seq
MIRT1314758	hsa-miR-4735-5p	CLIP-seq
MIRT2318140	hsa-miR-4765	CLIP-seq
MIRT1314759	hsa-miR-4775	CLIP-seq
MIRT2318141	hsa-miR-4804-3p	CLIP-seq
MIRT2093625	hsa-miR-498	CLIP-seq
MIRT1314760	hsa-miR-500b	CLIP-seq
MIRT1314761	hsa-miR-501-5p	CLIP-seq
MIRT1314762	hsa-miR-509-3-5p	CLIP-seq
MIRT1314763	hsa-miR-5095	CLIP-seq
MIRT1314764	hsa-miR-509-5p	CLIP-seq
MIRT2093626	hsa-miR-5096	CLIP-seq
MIRT2318142	hsa-miR-519a	CLIP-seq
MIRT2318143	hsa-miR-519b-3p	CLIP-seq
MIRT2318144	hsa-miR-519c-3p	CLIP-seq
MIRT2318145	hsa-miR-548ac	CLIP-seq
MIRT2318146	hsa-miR-548d-3p	CLIP-seq
MIRT2318147	hsa-miR-548z	CLIP-seq
MIRT1314767	hsa-miR-562	CLIP-seq
MIRT1314771	hsa-miR-590-3p	CLIP-seq
MIRT2093629	hsa-miR-622	CLIP-seq
MIRT2318148	hsa-miR-649	CLIP-seq
MIRT2318149	hsa-miR-656	CLIP-seq
MIRT1314775	hsa-miR-659	CLIP-seq
MIRT1314776	hsa-miR-7	CLIP-seq
MIRT2093632	hsa-miR-873	CLIP-seq
MIRT1314779	hsa-miR-891b	CLIP-seq
MIRT1314703	hsa-miR-103a	CLIP-seq
MIRT1314704	hsa-miR-107	CLIP-seq
MIRT1314705	hsa-miR-1184	CLIP-seq
MIRT2093609	hsa-miR-1343	CLIP-seq
MIRT1314711	hsa-miR-150	CLIP-seq
MIRT1314712	hsa-miR-153	CLIP-seq
MIRT1314714	hsa-miR-1976	CLIP-seq
MIRT2318124	hsa-miR-3200-5p	CLIP-seq
MIRT2393860	hsa-miR-3614-3p	CLIP-seq
MIRT2318131	hsa-miR-3920	CLIP-seq
MIRT1314737	hsa-miR-4279	CLIP-seq
MIRT1314742	hsa-miR-4418	CLIP-seq
MIRT1314743	hsa-miR-4421	CLIP-seq
MIRT2318136	hsa-miR-4672	CLIP-seq
MIRT1314756	hsa-miR-4684-3p	CLIP-seq
MIRT2393861	hsa-miR-4764-3p	CLIP-seq
MIRT2093625	hsa-miR-498	CLIP-seq
MIRT1314762	hsa-miR-509-3-5p	CLIP-seq
MIRT1314764	hsa-miR-509-5p	CLIP-seq
MIRT2318142	hsa-miR-519a	CLIP-seq
MIRT2318143	hsa-miR-519b-3p	CLIP-seq
MIRT2318144	hsa-miR-519c-3p	CLIP-seq
MIRT1314767	hsa-miR-562	CLIP-seq
MIRT2393862	hsa-miR-618	CLIP-seq
MIRT1314779	hsa-miR-891b	CLIP-seq
MIRT2458503	hsa-miR-106a	CLIP-seq
MIRT2458504	hsa-miR-106b	CLIP-seq
MIRT2458505	hsa-miR-142-5p	CLIP-seq
MIRT2458506	hsa-miR-17	CLIP-seq
MIRT2458507	hsa-miR-20a	CLIP-seq
MIRT2458508	hsa-miR-20b	CLIP-seq
MIRT1314725	hsa-miR-3163	CLIP-seq
MIRT2458509	hsa-miR-3609	CLIP-seq
MIRT2458510	hsa-miR-4747-5p	CLIP-seq
MIRT2458511	hsa-miR-4796-3p	CLIP-seq
MIRT2458512	hsa-miR-519d	CLIP-seq
MIRT2458513	hsa-miR-548ah	CLIP-seq
MIRT1314768	hsa-miR-568	CLIP-seq
MIRT2458514	hsa-miR-93	CLIP-seq
MIRT2093605	hsa-miR-1185	CLIP-seq
MIRT2613891	hsa-miR-124	CLIP-seq
MIRT2093608	hsa-miR-1279	CLIP-seq
MIRT2613892	hsa-miR-130a	CLIP-seq
MIRT2613893	hsa-miR-130b	CLIP-seq
MIRT2093609	hsa-miR-1343	CLIP-seq
MIRT1314714	hsa-miR-1976	CLIP-seq
MIRT2613894	hsa-miR-2277-3p	CLIP-seq
MIRT2613895	hsa-miR-301a	CLIP-seq
MIRT2613896	hsa-miR-301b	CLIP-seq
MIRT2093611	hsa-miR-3064-3p	CLIP-seq
MIRT2318125	hsa-miR-3591-3p	CLIP-seq
MIRT2093613	hsa-miR-3605-5p	CLIP-seq
MIRT2613897	hsa-miR-3666	CLIP-seq
MIRT1314731	hsa-miR-3672	CLIP-seq
MIRT2093616	hsa-miR-3679-5p	CLIP-seq
MIRT2613898	hsa-miR-3714	CLIP-seq
MIRT2613899	hsa-miR-3910	CLIP-seq
MIRT2613900	hsa-miR-3913-3p	CLIP-seq
MIRT2613901	hsa-miR-4295	CLIP-seq
MIRT2613902	hsa-miR-4310	CLIP-seq
MIRT2613903	hsa-miR-4423-5p	CLIP-seq
MIRT2613904	hsa-miR-4506	CLIP-seq
MIRT2613905	hsa-miR-454	CLIP-seq
MIRT2093621	hsa-miR-4649-3p	CLIP-seq
MIRT2613906	hsa-miR-4671-3p	CLIP-seq
MIRT2613907	hsa-miR-4698	CLIP-seq
MIRT2613908	hsa-miR-4774-3p	CLIP-seq
MIRT2093625	hsa-miR-498	CLIP-seq
MIRT2613909	hsa-miR-506	CLIP-seq
MIRT2613910	hsa-miR-548c-3p	CLIP-seq
MIRT2613911	hsa-miR-555	CLIP-seq
MIRT2613912	hsa-miR-561	CLIP-seq
MIRT2093630	hsa-miR-654-3p	CLIP-seq
MIRT2318149	hsa-miR-656	CLIP-seq
MIRT2613913	hsa-miR-885-5p	CLIP-seq
MIRT2093605	hsa-miR-1185	CLIP-seq
MIRT2093609	hsa-miR-1343	CLIP-seq
MIRT1314714	hsa-miR-1976	CLIP-seq
MIRT2093613	hsa-miR-3605-5p	CLIP-seq
MIRT2093616	hsa-miR-3679-5p	CLIP-seq
MIRT2093621	hsa-miR-4649-3p	CLIP-seq
MIRT2093625	hsa-miR-498	CLIP-seq
MIRT2613910	hsa-miR-548c-3p	CLIP-seq
MIRT2093630	hsa-miR-654-3p	CLIP-seq

112

Show/Hide all (112)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000281	Process	Mitotic cytokinesis	IBA
GO:0001837	Process	Epithelial to mesenchymal transition	ISS
GO:0002020	Function	Protease binding	IPI	24305806
GO:0002931	Process	Response to ischemia	ISS
GO:0003180	Process	Aortic valve morphogenesis	ISS
GO:0003723	Function	RNA binding	HDA	22681889
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	16574662, 21147781
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IMP	24305806, 29353861
GO:0004674	Function	Protein serine/threonine kinase activity	ISS	24305806
GO:0005198	Function	Structural molecule activity	NAS	9933571
GO:0005515	Function	Protein binding	IPI	17015463, 20230755, 24305806, 30413785, 32814053
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	39106863
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IBA
GO:0005813	Component	Centrosome	IDA	17015463
GO:0005813	Component	Centrosome	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IBA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0006468	Process	Protein phosphorylation	IDA	18559669
GO:0006939	Process	Smooth muscle contraction	IEA
GO:0006939	Process	Smooth muscle contraction	TAS	12778124
GO:0007165	Process	Signal transduction	IEA
GO:0007266	Process	Rho protein signal transduction	IBA
GO:0007266	Process	Rho protein signal transduction	IDA	39106863
GO:0007266	Process	Rho protein signal transduction	IEA
GO:0007266	Process	Rho protein signal transduction	IMP	24065547
GO:0008270	Function	Zinc ion binding	IEA
GO:0010613	Process	Positive regulation of cardiac muscle hypertrophy	ISS
GO:0010628	Process	Positive regulation of gene expression	ISS
GO:0010629	Process	Negative regulation of gene expression	ISS
GO:0010825	Process	Positive regulation of centrosome duplication	IEA
GO:0016020	Component	Membrane	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016525	Process	Negative regulation of angiogenesis	IEA
GO:0016525	Process	Negative regulation of angiogenesis	IMP	19181962
GO:0016740	Function	Transferase activity	IEA
GO:0030036	Process	Actin cytoskeleton organization	IEA
GO:0030036	Process	Actin cytoskeleton organization	ISS
GO:0030155	Process	Regulation of cell adhesion	TAS	12778124
GO:0030335	Process	Positive regulation of cell migration	IMP	20232393
GO:0030866	Process	Cortical actin cytoskeleton organization	IBA
GO:0031032	Process	Actomyosin structure organization	IBA
GO:0031267	Function	Small GTPase binding	IEA
GO:0031644	Process	Regulation of nervous system process	ISS
GO:0032723	Process	Positive regulation of connective tissue growth factor production	ISS
GO:0032956	Process	Regulation of actin cytoskeleton organization	IBA
GO:0032956	Process	Regulation of actin cytoskeleton organization	IEA
GO:0032956	Process	Regulation of actin cytoskeleton organization	TAS	12778124
GO:0036464	Component	Cytoplasmic ribonucleoprotein granule	IDA	15121898
GO:0042752	Process	Regulation of circadian rhythm	ISS
GO:0043149	Process	Stress fiber assembly	IDA	39106863
GO:0043410	Process	Positive regulation of MAPK cascade	ISS
GO:0044788	Process	Host-mediated perturbation of viral process	IMP	19376974
GO:0045019	Process	Negative regulation of nitric oxide biosynthetic process	IMP	29353861
GO:0045019	Process	Negative regulation of nitric oxide biosynthetic process	ISS
GO:0045616	Process	Regulation of keratinocyte differentiation	IEA
GO:0045616	Process	Regulation of keratinocyte differentiation	IMP	19997641
GO:0045937	Process	Positive regulation of phosphate metabolic process	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0048156	Function	Tau protein binding	NAS	28386764
GO:0048511	Process	Rhythmic process	IEA
GO:0048598	Process	Embryonic morphogenesis	IBA
GO:0050321	Function	Tau-protein kinase activity	NAS	28386764
GO:0051298	Process	Centrosome duplication	IMP	17015463
GO:0051492	Process	Regulation of stress fiber assembly	IEA
GO:0051492	Process	Regulation of stress fiber assembly	TAS	12778124
GO:0051496	Process	Positive regulation of stress fiber assembly	IDA	39106863
GO:0051496	Process	Positive regulation of stress fiber assembly	IMP	20232393
GO:0051893	Process	Regulation of focal adhesion assembly	IEA
GO:0051893	Process	Regulation of focal adhesion assembly	TAS	12778124
GO:0061133	Function	Endopeptidase activator activity	IMP	24305806
GO:0061157	Process	MRNA destabilization	ISS
GO:0070168	Process	Negative regulation of biomineral tissue development	ISS
GO:0071559	Process	Response to transforming growth factor beta	ISS
GO:0072518	Function	Rho-dependent protein serine/threonine kinase activity	IBA
GO:0072518	Function	Rho-dependent protein serine/threonine kinase activity	IEA
GO:0072518	Function	Rho-dependent protein serine/threonine kinase activity	IMP	24065547
GO:0072518	Function	Rho-dependent protein serine/threonine kinase activity	TAS	28679962
GO:0072659	Process	Protein localization to plasma membrane	IEA
GO:0072659	Process	Protein localization to plasma membrane	IGI	25816133
GO:0072659	Process	Protein localization to plasma membrane	IMP	25816133
GO:0090271	Process	Positive regulation of fibroblast growth factor production	ISS
GO:0097746	Process	Blood vessel diameter maintenance	ISS
GO:0106310	Function	Protein serine kinase activity	IEA
GO:0110061	Process	Regulation of angiotensin-activated signaling pathway	ISS
GO:0150033	Process	Negative regulation of protein localization to lysosome	IMP	24305806
GO:1900037	Process	Regulation of cellular response to hypoxia	ISS
GO:1901888	Process	Regulation of cell junction assembly	IBA
GO:1902003	Process	Regulation of amyloid-beta formation	IEA
GO:1902004	Process	Positive regulation of amyloid-beta formation	IMP	24305806
GO:1902966	Process	Positive regulation of protein localization to early endosome	IMP	24305806
GO:1902993	Process	Positive regulation of amyloid precursor protein catabolic process	IMP	24305806
GO:1903140	Process	Regulation of establishment of endothelial barrier	IEA
GO:1903140	Process	Regulation of establishment of endothelial barrier	IGI	25816133
GO:1903140	Process	Regulation of establishment of endothelial barrier	IMP	25816133
GO:1903347	Process	Negative regulation of bicellular tight junction assembly	IEA
GO:1903347	Process	Negative regulation of bicellular tight junction assembly	IGI	25816133
GO:1905145	Process	Cellular response to acetylcholine	ISS
GO:1905205	Process	Positive regulation of connective tissue replacement	ISS
GO:1990776	Process	Response to angiotensin	ISS
GO:2000114	Process	Regulation of establishment of cell polarity	IEA
GO:2000114	Process	Regulation of establishment of cell polarity	TAS	20803696
GO:2000145	Process	Regulation of cell motility	TAS	12778124

MIM	HGNC	e!Ensembl
604002	10252	ENSG00000134318

O75116

Protein name

Rho-associated protein kinase 2 (EC 2.7.11.1) (Rho kinase 2) (Rho-associated, coiled-coil-containing protein kinase 2) (Rho-associated, coiled-coil-containing protein kinase II) (ROCK-II) (p164 ROCK-2)

Protein function

Protein kinase which is a key regulator of actin cytoskeleton and cell polarity. Involved in regulation of smooth muscle contraction, actin cytoskeleton organization, stress fiber and focal adhesion formation, neurite retraction, cell adhesion a

PDB

4L6Q , 4WOT , 5U7Q , 5U7R , 6ED6 , 6P5M , 6P5P , 7JNT , 7JOV , 7P6N , 8GDS , 8X8X , 8X8Y , 8X8Z , 8X92 , 9EP8

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	92 → 354	Protein kinase domain	Domain
PF08912	Rho_Binding	978 → 1046	Rho Binding	Coiled-coil

Tissue specificity

TISSUE SPECIFICITY: Expressed in the brain (at protein level). {ECO:0000269|PubMed:21147781}.

Sequence

MSRPPPTGKMPGAPETAPGDGAGASRQRKLEALIRDPRSPINVESLLDGLNSLVLDLDFP
ALRKNKNIDNFLNRYEKIVKKIRGLQMKAEDYDVVKVIGRGAFGEVQLVRHKASQKVYAM
KLLSKFEMIKRSDSAFFWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNL
MSNYDVPEKWAKFYTAEVVLALDAIHSMGLIHRDVKPDNMLLDKHGHLKLADFGTCMKMD
ETGMVHCDTAVGTPDYISPEVLKSQGGDGFYGRECDWWSVGVFLYEMLVGDTPFYADSLV
GTYSKIMDHKNSLCFPEDAEISKHAKNLICAFLTDREVRLGRNGVEEIRQHPFFKNDQWH
WDNIRETAAPVVPELSSDIDSSNFDDIEDDKGDVETFPIPKAFVGNQLPFIGFTYYRENL
LLSDSPSCRETDSIQSRKNEESQEIQKKLYTLEEHLSNEMQAKEELEQKCKSVNTRLEKT
AKELEEEITLRKSVESALRQLEREKALLQHKNAEYQRKADHEADKKRNLENDVNSLKDQL
EDLKKRNQNSQISTEKVNQLQRQLDETNALLRTESDTAARLRKTQAESSKQIQQLESNNR
DLQDKNCLLETAKLKLEKEFINLQSALESERRDRTHGSEIINDLQGRICGLEEDLKNGKI
LLAKVELEKRQLQERFTDLEKEKSNMEIDMTYQLKVIQQSLEQEEAEHKATKARLADKNK
IYESIEEAKSEAMKEMEKKLLEERTLKQKVENLLLEAEKRCSLLDCDLKQSQQKINELLK
QKDVLNEDVRNLTLKIEQETQKRCLTQNDLKMQTQQVNTLKMSEKQLKQENNHLMEMKMN
LEKQNAELRKERQDADGQMKELQDQLEAEQYFSTLYKTQVRELKEECEEKTKLGKELQQK
KQELQDERDSLAAQLEITLTKADSEQLARSIAEEQYSDLEKEKIMKELEIKEMMARHKQE
LTEKDATIASLEETNRTLTSDVANLANEKEELNNKLKDVQEQLSRLKDEEISAAAIKAQF
EKQLLTERTLKTQAVNKLAEIMNRKEPVKRGNDTDVRRKEKENRKLHMELKSEREKLTQQ
MIKYQKELNEMQAQIAEESQIRIELQMTLDSKDSDIEQLRSQLQALHIGLDSSSIGSGPG
DAEADDGFPESRLEGWLSLPVRNNTKKFGWVKKYVIVSSKKILFYDSEQDKEQSNPYMVL
DIDKLFHVRPVTQTDVYRADAKEIPRIFQILYANEGESKKEQEFPVEPVGEKSNYICHKG
HEFIPTLYHFPTNCEACMKPLWHMFKPPPALECRRCHIKCHKDHMDKKEEIIAPCKVYYD
ISTAKNLLLLANSTEEQQKWVSRLVKKIPKKPPAPDPFARSSPRTSMKIQQNQSIRRPSR
QLAPNKPS

Sequence length

1388

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (9)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CARDIOMEGALY	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL HEART DISEASE	—	ClinGen, Disgenet, GWAS catalog ClinGen, Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGESTIVE HEART FAILURE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dextrocardia	Uncertain significance	ClinVar Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
HEART FAILURE	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYDROPS FETALIS, NON-IMMUNE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Non-immune hydrops fetalis	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ROCK2-related disorder	Uncertain significance; Likely benign; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENTRICULAR REMODELING	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (153)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	BEFREE	31304629		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	26901778		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	18784435		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	36499116	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	30577465		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	28031255, 31783584		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	28430966, 30884801		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	25385601	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	28430966, 30884801		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	30884801	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	25385601	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	25649044, 28554330, 31778951		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	26136223, 26983850, 27436361		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	26901778		★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	22939913		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	28554330, 30475758, 31620199		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	18695890, 20939434, 29990315, 30771534		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	26626121, 29990315, 35100495	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchiolitis Obliterans	Bronchiolitis Obliterans	BEFREE	26983850		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	22942252, 26261605	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	25969175, 26846339, 30779947, 31117934, 32546442, 32647287	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	28554330, 30475758, 31620199		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	28052041	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	35593591	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	28653604, 30266988		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Alcoholic	Cardiomyopathy	BEFREE	31777538		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	16469861, 23326532, 29353861		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	23326532	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	27288754, 29353861, 30028327		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	29246448	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	29246448		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	25104222, 31488179		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	25104222, 31488179		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholesteatoma	Cholesteatoma	Pubtator	35177391	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	19578796		★★★★★ ★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	28770474		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	24036111		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	23328676, 27399334, 31304629		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	17876296, 24942287	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	CTD_human_DG	29394407		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congestive heart failure	Congestive Heart Failure	BEFREE	29987023		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Connective Tissue Diseases	Connective Tissue Disease	BEFREE	31778951		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	23326532		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	31068571		★★★★★ ★☆☆☆☆ Found in Text Mining only
Deuteranomaly	Deuteranomaly	BEFREE	26818518		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	20961215		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	20961215		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	29955616	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	29932921, 31364374		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	20961215		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	28721148		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eclampsia	Eclampsia	BEFREE	19435756		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	30387365	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	22225925	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Erectile dysfunction	Erectile Dysfunction	BEFREE	27763717, 28142121, 31636680		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	26261605	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	18496125, 26818475		★★★★★ ★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	Pubtator	26818475	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	28112365, 29434937		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastroesophageal Reflux	Gastroesophageal reflux disease	Pubtator	26901778	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Genitourinary Cancer	Genitourinary Cancer	BEFREE	28554330		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	30378487		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	24617500		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	24170433, 24704824		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	24170433, 24704824		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	24170433		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	24642531, 35145081, 37873881	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Defects Congenital	Congenital heart defect	Pubtator	28336264, 31941532	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	CTD_human_DG	29394407		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart failure	Heart Failure	BEFREE	29987023		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Failure, Right-Sided	Heart Failure	CTD_human_DG	29394407		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Septal Defects	Heart Septal Defects	BEFREE	24668682		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemangioma	Hemangioma	BEFREE	28709411		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemangioma, Cavernous	Hemangioma, Cavernous	BEFREE	31446620		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Hemangiosarcoma	BEFREE	28709411		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemorrhagic Stroke	Hemorrhagic stroke	Pubtator	29246448	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung Disease	BEFREE	26276426		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	18971541	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	18971541	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	LHGDN	16585408, 18971541		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	18971541, 19435756, 24135024, 29246448, 29921927		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	30475758	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	24135024, 31533472		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	24674677	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	29269245		★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	32100372	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	29246448, 29353861, 30747210		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	34974812	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Left-Sided Heart Failure	Heart Failure	CTD_human_DG	29394407		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	22705122, 25251472, 25693145, 25969175, 27213590, 29472430, 30779947, 31105794, 31363382		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	31778951		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	31137925	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	27436361, 28283529		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	25755711	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	18695890, 20939434, 29990315, 30771534		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	28653604, 30266988		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	31783584		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	31026254		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	27921230		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	28554330, 30475758, 31620199		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	27991921, 29434937, 29990315, 31363382, 31620199		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	25104222, 31488179		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	18695890		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	26464464		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	31068571		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	28470935		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	28470935	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	26004609	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	26004609		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	24608447		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Failure	Myocardial Infarction	CTD_human_DG	29394407		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	BEFREE	30029249		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	BEFREE	29382705		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	36767649	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15604264, 21665151, 28653604, 28721163, 29052912, 29990315		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	26818518		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	31658060		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	27229528		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	32100372	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	23644663, 25912304, 30864107, 31678169		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	28653604, 30266988		★★★★★ ★☆☆☆☆ Found in Text Mining only
PACHYONYCHIA CONGENITA 3	Pachyonychia Congenita	BEFREE	30209946		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	31783584		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	27824338		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	22232555, 35322742, 37164685	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	BEFREE	27991921		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	26748453	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	27842305, 28484287		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	30704840		★★★★★ ★☆☆☆☆ Found in Text Mining only
Progressive supranuclear palsy	Progressive Supranuclear Palsy	BEFREE	26818518		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	31026254		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	30816534		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis vulgaris	Psoriasis vulgaris	BEFREE	28389592		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	37753829	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary edema of mountaineers	Pulmonary edema	Pubtator	26818475	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	28225294, 29211497		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	29932921		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Newborn	Congenital alveolar dysplasia	BEFREE	27269648		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	28112365	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	38297223	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	29475915	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	29475915		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	29052912		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	20232393, 25755711	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	20232393		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	27921230		★★★★★ ★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	28698029, 30363018		★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	26615410		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thromboembolic stroke	Thromboembolic stroke	BEFREE	28430966		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	30475758	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	20429915, 31488179	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Varicosity	Vulval varices	BEFREE	26827791		★★★★★ ★☆☆☆☆ Found in Text Mining only

ROCK2 (Rho associated coiled-coil containing protein kinase 2)