Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	4881
Gene name	Natriuretic peptide receptor 1
Gene symbol	NPR1
Synonyms (NCBI Gene)	ANPRAANPaGUC2AGUCY2ANPRA
Chromosome	1
Chromosome location	1q21.3
Summary	Guanylyl cyclases, catalyzing the production of cGMP from GTP, are classified as soluble and membrane forms (Garbers and Lowe, 1994 [PubMed 7982997]). The membrane guanylyl cyclases, often termed guanylyl cyclases A through F, form a family of cell-surfac

244 Show/Hide all (244)

miRTarBase ID	miRNA	Experiments	Reference
MIRT006575	hsa-miR-320a	Luciferase reporter assayWestern blot	22134529
MIRT006575	hsa-miR-320a	Luciferase reporter assayWestern blot	22134529
MIRT006575	hsa-miR-320a	Luciferase reporter assayWestern blot	22134529
MIRT006575	hsa-miR-320a	Luciferase reporter assayWestern blot	22134529
MIRT022739	hsa-miR-124-3p	Microarray	18668037
MIRT693189	hsa-miR-590-3p	HITS-CLIP	23313552
MIRT693188	hsa-miR-1228-3p	HITS-CLIP	23313552
MIRT693187	hsa-miR-6765-3p	HITS-CLIP	23313552
MIRT693186	hsa-miR-4735-5p	HITS-CLIP	23313552
MIRT516396	hsa-miR-4794	HITS-CLIP	23313552
MIRT516395	hsa-miR-664a-5p	HITS-CLIP	23313552
MIRT693185	hsa-miR-4775	HITS-CLIP	23313552
MIRT693184	hsa-miR-3149	HITS-CLIP	23313552
MIRT693183	hsa-miR-4701-5p	HITS-CLIP	23313552
MIRT693182	hsa-miR-6808-5p	HITS-CLIP	23313552
MIRT693181	hsa-miR-6893-5p	HITS-CLIP	23313552
MIRT693180	hsa-miR-940	HITS-CLIP	23313552
MIRT674799	hsa-miR-3929	HITS-CLIP	23313552
MIRT674800	hsa-miR-4419b	HITS-CLIP	23313552
MIRT674798	hsa-miR-4478	HITS-CLIP	23313552
MIRT693179	hsa-miR-6890-5p	HITS-CLIP	23313552
MIRT693178	hsa-miR-665	HITS-CLIP	23313552
MIRT693177	hsa-miR-6840-3p	HITS-CLIP	23313552
MIRT693176	hsa-miR-6746-5p	HITS-CLIP	23313552
MIRT693175	hsa-miR-4649-3p	HITS-CLIP	23313552
MIRT693174	hsa-miR-1827	HITS-CLIP	23313552
MIRT674791	hsa-miR-485-5p	HITS-CLIP	23313552
MIRT674790	hsa-miR-6884-5p	HITS-CLIP	23313552
MIRT693173	hsa-miR-4722-5p	HITS-CLIP	23313552
MIRT693172	hsa-miR-7160-5p	HITS-CLIP	23313552
MIRT693171	hsa-miR-342-5p	HITS-CLIP	23313552
MIRT693170	hsa-miR-4664-5p	HITS-CLIP	23313552
MIRT693169	hsa-miR-4651	HITS-CLIP	23313552
MIRT693168	hsa-miR-608	HITS-CLIP	23313552
MIRT693167	hsa-miR-6747-5p	HITS-CLIP	23313552
MIRT693166	hsa-miR-6771-5p	HITS-CLIP	23313552
MIRT693165	hsa-miR-6737-5p	HITS-CLIP	23313552
MIRT693164	hsa-miR-6812-5p	HITS-CLIP	23313552
MIRT693163	hsa-miR-6819-5p	HITS-CLIP	23313552
MIRT674799	hsa-miR-3929	HITS-CLIP	23824327
MIRT674800	hsa-miR-4419b	HITS-CLIP	23824327
MIRT674798	hsa-miR-4478	HITS-CLIP	23824327
MIRT674797	hsa-miR-383-3p	HITS-CLIP	23824327
MIRT674796	hsa-miR-143-3p	HITS-CLIP	23824327
MIRT674795	hsa-miR-4770	HITS-CLIP	23824327
MIRT674794	hsa-miR-6088	HITS-CLIP	23824327
MIRT674793	hsa-miR-4708-5p	HITS-CLIP	23824327
MIRT674792	hsa-miR-1273f	HITS-CLIP	23824327
MIRT674791	hsa-miR-485-5p	HITS-CLIP	23824327
MIRT674790	hsa-miR-6884-5p	HITS-CLIP	23824327
MIRT674789	hsa-miR-7106-5p	HITS-CLIP	23824327
MIRT674788	hsa-miR-149-3p	HITS-CLIP	23824327
MIRT674787	hsa-miR-4728-5p	HITS-CLIP	23824327
MIRT674786	hsa-miR-6785-5p	HITS-CLIP	23824327
MIRT674785	hsa-miR-6883-5p	HITS-CLIP	23824327
MIRT674784	hsa-miR-6799-5p	HITS-CLIP	23824327
MIRT674783	hsa-miR-7977	HITS-CLIP	23824327
MIRT674782	hsa-miR-30c-1-3p	HITS-CLIP	23824327
MIRT674781	hsa-miR-30c-2-3p	HITS-CLIP	23824327
MIRT674780	hsa-miR-6788-5p	HITS-CLIP	23824327
MIRT674779	hsa-miR-1273h-5p	HITS-CLIP	23824327
MIRT674778	hsa-miR-30b-3p	HITS-CLIP	23824327
MIRT674777	hsa-miR-3689a-3p	HITS-CLIP	23824327
MIRT674776	hsa-miR-3689b-3p	HITS-CLIP	23824327
MIRT674775	hsa-miR-3689c	HITS-CLIP	23824327
MIRT674774	hsa-miR-6779-5p	HITS-CLIP	23824327
MIRT674773	hsa-miR-6780a-5p	HITS-CLIP	23824327
MIRT674772	hsa-miR-1228-5p	HITS-CLIP	23824327
MIRT674771	hsa-miR-450a-1-3p	HITS-CLIP	23824327
MIRT674770	hsa-miR-3122	HITS-CLIP	23824327
MIRT674769	hsa-miR-3913-5p	HITS-CLIP	23824327
MIRT674768	hsa-miR-887-5p	HITS-CLIP	23824327
MIRT674767	hsa-miR-6513-5p	HITS-CLIP	23824327
MIRT663111	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT663110	hsa-miR-3607-5p	HITS-CLIP	23824327
MIRT663108	hsa-miR-6072	HITS-CLIP	23824327
MIRT663109	hsa-miR-6891-3p	HITS-CLIP	23824327
MIRT663107	hsa-miR-3663-5p	HITS-CLIP	23824327
MIRT663106	hsa-miR-6131	HITS-CLIP	23824327
MIRT663105	hsa-miR-8070	HITS-CLIP	23824327
MIRT646050	hsa-miR-5571-5p	HITS-CLIP	23824327
MIRT646049	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT646048	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT646047	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT646046	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT646045	hsa-miR-939-3p	HITS-CLIP	23824327
MIRT646043	hsa-miR-6852-5p	HITS-CLIP	23824327
MIRT646044	hsa-miR-6742-3p	HITS-CLIP	23824327
MIRT646042	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT646041	hsa-miR-1976	HITS-CLIP	23824327
MIRT646040	hsa-miR-6861-5p	HITS-CLIP	23824327
MIRT646039	hsa-miR-6791-3p	HITS-CLIP	23824327
MIRT646038	hsa-miR-6829-3p	HITS-CLIP	23824327
MIRT646037	hsa-miR-197-5p	HITS-CLIP	23824327
MIRT646036	hsa-miR-3132	HITS-CLIP	23824327
MIRT646035	hsa-miR-1343-3p	HITS-CLIP	23824327
MIRT646034	hsa-miR-6783-3p	HITS-CLIP	23824327
MIRT646033	hsa-miR-1229-5p	HITS-CLIP	23824327
MIRT544284	hsa-miR-5692a	PAR-CLIP	21572407
MIRT544283	hsa-miR-541-5p	PAR-CLIP	21572407
MIRT516397	hsa-miR-944	PAR-CLIP	23446348
MIRT516396	hsa-miR-4794	PAR-CLIP	23446348
MIRT516395	hsa-miR-664a-5p	PAR-CLIP	23446348
MIRT516394	hsa-miR-1254	PAR-CLIP	23446348
MIRT516393	hsa-miR-3116	PAR-CLIP	23446348
MIRT516392	hsa-miR-661	PAR-CLIP	23446348
MIRT516391	hsa-miR-1271-3p	PAR-CLIP	23446348
MIRT516390	hsa-miR-550a-3-5p	PAR-CLIP	23446348
MIRT516389	hsa-miR-550a-5p	PAR-CLIP	23446348
MIRT516388	hsa-miR-6807-5p	PAR-CLIP	23446348
MIRT693178	hsa-miR-665	PAR-CLIP	26701625
MIRT693178	hsa-miR-665	PAR-CLIP	26701625
MIRT693177	hsa-miR-6840-3p	PAR-CLIP	26701625
MIRT693177	hsa-miR-6840-3p	PAR-CLIP	26701625
MIRT693189	hsa-miR-590-3p	HITS-CLIP	23313552
MIRT693188	hsa-miR-1228-3p	HITS-CLIP	23313552
MIRT693187	hsa-miR-6765-3p	HITS-CLIP	23313552
MIRT693186	hsa-miR-4735-5p	HITS-CLIP	23313552
MIRT516396	hsa-miR-4794	HITS-CLIP	23313552
MIRT516395	hsa-miR-664a-5p	HITS-CLIP	23313552
MIRT693185	hsa-miR-4775	HITS-CLIP	23313552
MIRT693184	hsa-miR-3149	HITS-CLIP	23313552
MIRT693183	hsa-miR-4701-5p	HITS-CLIP	23313552
MIRT693182	hsa-miR-6808-5p	HITS-CLIP	23313552
MIRT693181	hsa-miR-6893-5p	HITS-CLIP	23313552
MIRT693180	hsa-miR-940	HITS-CLIP	23313552
MIRT674799	hsa-miR-3929	HITS-CLIP	23313552
MIRT674800	hsa-miR-4419b	HITS-CLIP	23313552
MIRT674798	hsa-miR-4478	HITS-CLIP	23313552
MIRT693179	hsa-miR-6890-5p	HITS-CLIP	23313552
MIRT693178	hsa-miR-665	HITS-CLIP	23313552
MIRT693177	hsa-miR-6840-3p	HITS-CLIP	23313552
MIRT693176	hsa-miR-6746-5p	HITS-CLIP	23313552
MIRT693175	hsa-miR-4649-3p	HITS-CLIP	23313552
MIRT693174	hsa-miR-1827	HITS-CLIP	23313552
MIRT674791	hsa-miR-485-5p	HITS-CLIP	23313552
MIRT674790	hsa-miR-6884-5p	HITS-CLIP	23313552
MIRT693173	hsa-miR-4722-5p	HITS-CLIP	23313552
MIRT693172	hsa-miR-7160-5p	HITS-CLIP	23313552
MIRT693171	hsa-miR-342-5p	HITS-CLIP	23313552
MIRT693170	hsa-miR-4664-5p	HITS-CLIP	23313552
MIRT693169	hsa-miR-4651	HITS-CLIP	23313552
MIRT693168	hsa-miR-608	HITS-CLIP	23313552
MIRT693167	hsa-miR-6747-5p	HITS-CLIP	23313552
MIRT693166	hsa-miR-6771-5p	HITS-CLIP	23313552
MIRT693165	hsa-miR-6737-5p	HITS-CLIP	23313552
MIRT693164	hsa-miR-6812-5p	HITS-CLIP	23313552
MIRT693163	hsa-miR-6819-5p	HITS-CLIP	23313552
MIRT674799	hsa-miR-3929	HITS-CLIP	23824327
MIRT674800	hsa-miR-4419b	HITS-CLIP	23824327
MIRT674798	hsa-miR-4478	HITS-CLIP	23824327
MIRT674797	hsa-miR-383-3p	HITS-CLIP	23824327
MIRT674796	hsa-miR-143-3p	HITS-CLIP	23824327
MIRT674795	hsa-miR-4770	HITS-CLIP	23824327
MIRT674794	hsa-miR-6088	HITS-CLIP	23824327
MIRT674793	hsa-miR-4708-5p	HITS-CLIP	23824327
MIRT674792	hsa-miR-1273f	HITS-CLIP	23824327
MIRT674791	hsa-miR-485-5p	HITS-CLIP	23824327
MIRT674790	hsa-miR-6884-5p	HITS-CLIP	23824327
MIRT674789	hsa-miR-7106-5p	HITS-CLIP	23824327
MIRT674788	hsa-miR-149-3p	HITS-CLIP	23824327
MIRT674787	hsa-miR-4728-5p	HITS-CLIP	23824327
MIRT674786	hsa-miR-6785-5p	HITS-CLIP	23824327
MIRT674785	hsa-miR-6883-5p	HITS-CLIP	23824327
MIRT674784	hsa-miR-6799-5p	HITS-CLIP	23824327
MIRT674783	hsa-miR-7977	HITS-CLIP	23824327
MIRT674782	hsa-miR-30c-1-3p	HITS-CLIP	23824327
MIRT674781	hsa-miR-30c-2-3p	HITS-CLIP	23824327
MIRT674780	hsa-miR-6788-5p	HITS-CLIP	23824327
MIRT674779	hsa-miR-1273h-5p	HITS-CLIP	23824327
MIRT674778	hsa-miR-30b-3p	HITS-CLIP	23824327
MIRT674777	hsa-miR-3689a-3p	HITS-CLIP	23824327
MIRT674776	hsa-miR-3689b-3p	HITS-CLIP	23824327
MIRT674775	hsa-miR-3689c	HITS-CLIP	23824327
MIRT674774	hsa-miR-6779-5p	HITS-CLIP	23824327
MIRT674773	hsa-miR-6780a-5p	HITS-CLIP	23824327
MIRT674772	hsa-miR-1228-5p	HITS-CLIP	23824327
MIRT674771	hsa-miR-450a-1-3p	HITS-CLIP	23824327
MIRT674770	hsa-miR-3122	HITS-CLIP	23824327
MIRT674769	hsa-miR-3913-5p	HITS-CLIP	23824327
MIRT674768	hsa-miR-887-5p	HITS-CLIP	23824327
MIRT674767	hsa-miR-6513-5p	HITS-CLIP	23824327
MIRT663111	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT663110	hsa-miR-3607-5p	HITS-CLIP	23824327
MIRT663108	hsa-miR-6072	HITS-CLIP	23824327
MIRT663109	hsa-miR-6891-3p	HITS-CLIP	23824327
MIRT663107	hsa-miR-3663-5p	HITS-CLIP	23824327
MIRT663106	hsa-miR-6131	HITS-CLIP	23824327
MIRT663105	hsa-miR-8070	HITS-CLIP	23824327
MIRT646050	hsa-miR-5571-5p	HITS-CLIP	23824327
MIRT646049	hsa-miR-660-3p	HITS-CLIP	23824327
MIRT646048	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT646047	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT646046	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT646045	hsa-miR-939-3p	HITS-CLIP	23824327
MIRT646043	hsa-miR-6852-5p	HITS-CLIP	23824327
MIRT646044	hsa-miR-6742-3p	HITS-CLIP	23824327
MIRT646042	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT646041	hsa-miR-1976	HITS-CLIP	23824327
MIRT646040	hsa-miR-6861-5p	HITS-CLIP	23824327
MIRT646039	hsa-miR-6791-3p	HITS-CLIP	23824327
MIRT646038	hsa-miR-6829-3p	HITS-CLIP	23824327
MIRT646037	hsa-miR-197-5p	HITS-CLIP	23824327
MIRT646036	hsa-miR-3132	HITS-CLIP	23824327
MIRT646035	hsa-miR-1343-3p	HITS-CLIP	23824327
MIRT646034	hsa-miR-6783-3p	HITS-CLIP	23824327
MIRT646033	hsa-miR-1229-5p	HITS-CLIP	23824327
MIRT544284	hsa-miR-5692a	PAR-CLIP	21572407
MIRT544283	hsa-miR-541-5p	PAR-CLIP	21572407
MIRT516397	hsa-miR-944	PAR-CLIP	23446348
MIRT516396	hsa-miR-4794	PAR-CLIP	23446348
MIRT516395	hsa-miR-664a-5p	PAR-CLIP	23446348
MIRT516394	hsa-miR-1254	PAR-CLIP	23446348
MIRT516393	hsa-miR-3116	PAR-CLIP	23446348
MIRT516392	hsa-miR-661	PAR-CLIP	23446348
MIRT516391	hsa-miR-1271-3p	PAR-CLIP	23446348
MIRT516390	hsa-miR-550a-3-5p	PAR-CLIP	23446348
MIRT516389	hsa-miR-550a-5p	PAR-CLIP	23446348
MIRT516388	hsa-miR-6807-5p	PAR-CLIP	23446348
MIRT2582317	hsa-miR-1236	CLIP-seq
MIRT2582318	hsa-miR-299-3p	CLIP-seq
MIRT2582319	hsa-miR-3183	CLIP-seq
MIRT2582320	hsa-miR-331-3p	CLIP-seq
MIRT2582321	hsa-miR-412	CLIP-seq
MIRT2582322	hsa-miR-4265	CLIP-seq
MIRT2582323	hsa-miR-4290	CLIP-seq
MIRT2582324	hsa-miR-4296	CLIP-seq
MIRT2582325	hsa-miR-4322	CLIP-seq
MIRT2582326	hsa-miR-4417	CLIP-seq
MIRT2582327	hsa-miR-4437	CLIP-seq
MIRT2582328	hsa-miR-4674	CLIP-seq
MIRT2582329	hsa-miR-4723-3p	CLIP-seq
MIRT2582317	hsa-miR-1236	CLIP-seq
MIRT2582319	hsa-miR-3183	CLIP-seq
MIRT2582320	hsa-miR-331-3p	CLIP-seq
MIRT2582321	hsa-miR-412	CLIP-seq
MIRT2582322	hsa-miR-4265	CLIP-seq
MIRT2582323	hsa-miR-4290	CLIP-seq
MIRT2582324	hsa-miR-4296	CLIP-seq
MIRT2582325	hsa-miR-4322	CLIP-seq
MIRT2582326	hsa-miR-4417	CLIP-seq
MIRT2582327	hsa-miR-4437	CLIP-seq
MIRT2582328	hsa-miR-4674	CLIP-seq
MIRT2582329	hsa-miR-4723-3p	CLIP-seq

53 Show/Hide all (53)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001653	Function	Peptide receptor activity	IBA
GO:0004383	Function	Guanylate cyclase activity	IBA
GO:0004383	Function	Guanylate cyclase activity	IDA	1672777
GO:0004383	Function	Guanylate cyclase activity	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0005524	Function	ATP binding	IEA
GO:0005525	Function	GTP binding	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	TAS
GO:0006182	Process	CGMP biosynthetic process	IBA
GO:0006182	Process	CGMP biosynthetic process	IDA	1672777
GO:0006182	Process	CGMP biosynthetic process	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	IEA
GO:0007166	Process	Cell surface receptor signaling pathway	NAS	12547834
GO:0007168	Process	Receptor guanylyl cyclase signaling pathway	IBA
GO:0007168	Process	Receptor guanylyl cyclase signaling pathway	IDA	1672777
GO:0007168	Process	Receptor guanylyl cyclase signaling pathway	IEA
GO:0007168	Process	Receptor guanylyl cyclase signaling pathway	ISS
GO:0007168	Process	Receptor guanylyl cyclase signaling pathway	TAS	14737067
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007589	Process	Body fluid secretion	TAS	14960748
GO:0008015	Process	Blood circulation	IEA
GO:0008217	Process	Regulation of blood pressure	IDA	1672777
GO:0008217	Process	Regulation of blood pressure	IEA
GO:0008217	Process	Regulation of blood pressure	ISS
GO:0008217	Process	Regulation of blood pressure	NAS	12727915
GO:0008528	Function	G protein-coupled peptide receptor activity	NAS	12547834
GO:0009190	Process	Cyclic nucleotide biosynthetic process	IEA
GO:0010753	Process	Positive regulation of cGMP-mediated signaling	IEA
GO:0016020	Component	Membrane	IEA
GO:0016525	Process	Negative regulation of angiogenesis	TAS	14737067
GO:0016829	Function	Lyase activity	IEA
GO:0016849	Function	Phosphorus-oxygen lyase activity	IEA
GO:0016941	Function	Natriuretic peptide receptor activity	IDA	1660465, 1672777
GO:0016941	Function	Natriuretic peptide receptor activity	IEA
GO:0017046	Function	Peptide hormone binding	IEA
GO:0017046	Function	Peptide hormone binding	IPI	1660465
GO:0019934	Process	CGMP-mediated signaling	IEA
GO:0030308	Process	Negative regulation of cell growth	NAS	12727915
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0035810	Process	Positive regulation of urine volume	TAS	14737067
GO:0035815	Process	Positive regulation of renal sodium excretion	TAS	14960748
GO:0042417	Process	Dopamine metabolic process	IEA
GO:0042562	Function	Hormone binding	IPI	12547834
GO:0043114	Process	Regulation of vascular permeability	IDA	36016499
GO:0043114	Process	Regulation of vascular permeability	TAS	14737067
GO:0043235	Component	Receptor complex	IDA	23382219
GO:0048662	Process	Negative regulation of smooth muscle cell proliferation	IEA
GO:0097746	Process	Blood vessel diameter maintenance	IEA
GO:0097746	Process	Blood vessel diameter maintenance	NAS	7601467
GO:1990620	Component	ANPR-A receptor complex	IEA
GO:1990620	Component	ANPR-A receptor complex	ISS

MIM	HGNC	e!Ensembl
108960	7943	ENSG00000169418

P16066

Protein name

Atrial natriuretic peptide receptor 1 (EC 4.6.1.2) (Atrial natriuretic peptide receptor type A) (ANP-A) (ANPR-A) (NPR-A) (Guanylate cyclase A) (GC-A)

Protein function

Receptor for the atrial natriuretic peptide NPPA/ANP and the brain natriuretic peptide NPPB/BNP which are potent vasoactive hormones playing a key role in cardiovascular homeostasis (PubMed:39543315). Plays an essential role in the regulation of

PDB

8TG9 , 8TGA , 9BCL , 9BCN , 9BCO , 9BCP , 9BCQ , 9BCS , 9BCV

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00211	Guanylate_cyc	867 → 1053	Adenylate and Guanylate cyclase catalytic domain	Domain
PF01094	ANF_receptor	54 → 417	Receptor family ligand binding region	Family
PF07714	PK_Tyr_Ser-Thr	543 → 801	Protein tyrosine and serine/threonine kinase	Domain

Sequence

MPGPRRPAGSRLRLLLLLLLPPLLLLLRGSHAGNLTVAVVLPLANTSYPWSWARVGPAVE
LALAQVKARPDLLPGWTVRTVLGSSENALGVCSDTAAPLAAVDLKWEHNPAVFLGPGCVY
AAAPVGRFTAHWRVPLLTAGAPALGFGVKDEYALTTRAGPSYAKLGDFVAALHRRLGWER
QALMLYAYRPGDEEHCFFLVEGLFMRVRDRLNITVDHLEFAEDDLSHYTRLLRTMPRKGR
VIYICSSPDAFRTLMLLALEAGLCGEDYVFFHLDIFGQSLQGGQGPAPRRPWERGDGQDV
SARQAFQAAKIITYKDPDNPEYLEFLKQLKHLAYEQFNFTMEDGLVNTIPASFHDGLLLY
IQAVTETLAHGGTVTDGENITQRMWNRSFQGVTGYLKIDSSGDRETDFSLWDMDPENGAF
RVVLNYNGTSQELVAVSGRKLNWPLGYPPPDIPKCGFDNEDPACNQDHLSTLEVLALVGS
LSLLGILIVSFFIYRKMQLEKELASELWRVRWEDVEPSSLERHLRSAGSRLTLSGRGSNY
GSLLTTEGQFQVFAKTAYYKGNLVAVKRVNRKRIELTRKVLFELKHMRDVQNEHLTRFVG
ACTDPPNICILTEYCPRGSLQDILENESITLDWMFRYSLTNDIVKGMLFLHNGAICSHGN
LKSSNCVVDGRFVLKITDYGLESFRDLDPEQGHTVYAKKLWTAPELLRMASPPVRGSQAG
DVYSFGIILQEIALRSGVFHVEGLDLSPKEIIERVTRGEQPPFRPSLALQSHLEELGLLM
QRCWAEDPQERPPFQQIRLTLRKFNRENSSNILDNLLSRMEQYANNLEELVEERTQAYLE
EKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTL
LNDLYTCFDAVIDNFDVYKVETIGDAYMVVSGLPVRNGRLHACEVARMALALLDAVRSFR
IRHRPQEQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHLSSET
KAVLEEFGGFELELRGDVEMKGKGKVRTYWLLGERGSSTRG

Sequence length

1061

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Purine metabolism	Physiological factors
Metabolic pathways
cGMP-PKG signaling pathway
cAMP signaling pathway
Hormone signaling
Vascular smooth muscle contraction
Thermogenesis
Oxytocin signaling pathway
Regulation of lipolysis in adipocytes
Renin secretion
Aldosterone synthesis and secretion

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (8)
CARDIOMEGALY	—	CTD	20881240	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASE	—	GWAS catalog	30595370	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGESTIVE HEART FAILURE	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	CTD, Disgenet CTD, Disgenet	20881240	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	CTD, GWAS catalog CTD, GWAS catalog	20881240, 37947095, 39789286	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY DISEASES	—	CTD, Disgenet CTD, Disgenet	20881240	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (71)
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	31102956		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic valve calcification	Aortic valve calcification	BEFREE	17709640		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	39293435	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	28846808		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	31392078		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	20345479	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	24894887		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	30764827		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Hypertrophic	Hypertrophic cardiomyopathy	Pubtator	30764827	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Abnormalities	Cardiovascular Abnormalities	BEFREE	30032985		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	18436476		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	LHGDN	18436476		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	GWASCAT_DG	30595370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	CTD_human_DG	20881240		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	26530476	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	18306933		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	16778132, 30169131		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congestive heart failure	Congestive Heart Failure	CTD_human_DG	20881240		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	BEFREE	20529973		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	26530476	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	27797278		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	33788629	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	22419733		★★★★★ ★☆☆☆☆ Found in Text Mining only
Erectile dysfunction	Erectile Dysfunction	BEFREE	22133301		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	24885858	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	16875975, 18360023, 26782497		★★★★★ ★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	Pubtator	16875975, 26782497	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	16778132, 30169131		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart failure	Heart Failure	CTD_human_DG	20881240		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Failure, Right-Sided	Heart Failure	CTD_human_DG	20881240		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hermaphroditism	Hermaphroditism	BEFREE	29712787		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hydrops Fetalis	Hydrops Fetalis	BEFREE	26517044		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	26782497	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	LHGDN	12506509, 16875975		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	BEFREE	12872042, 15931395, 17672826, 18360023, 19126660, 26782497, 28566502, 9405681		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	CTD_human_DG	20881240		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	30764827		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophic obstructive cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	30764827		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	27797278		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	CTD_human_DG	20881240		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	25027872		★★★★★ ★☆☆☆☆ Found in Text Mining only
Left-Sided Heart Failure	Heart Failure	CTD_human_DG	20881240		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	27592451		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	31392078		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	24894887		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	23582032, 24894887		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	21586128, 23582032		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	27634171		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	23582032, 24885858, 24894887, 25955817		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Failure	Myocardial Infarction	CTD_human_DG	20881240		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	LHGDN	14646971		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial Infarction	BEFREE	14646971, 20529973		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial Ischemia	LHGDN	16778132		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	16778132		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	21586128, 24894887		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	19165164		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	21586128, 23582032		★★★★★ ★☆☆☆☆ Found in Text Mining only
prostatitis	Prostatitis	BEFREE	31777403		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	28566502		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	29021382		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Degeneration	Retinal degeneration	Pubtator	26100624	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	31619060		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	33276795	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	24885858		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	24885858		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	28521969		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	27634171		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	BEFREE	27634171		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	27797278		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular Dysfunction Left	Ventricular dysfunction	Pubtator	16875975	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular Remodeling	Ventricular remodeling	Pubtator	16875975	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
ADRA2C	2	["Cardiomegaly","Congestive heart failure"]	2	["cGMP-PKG signaling pathway","Hormone signaling"]	4	["CTD (Cardiomegaly)","Disgenet (Congestive heart failure)","CTD (Heart failure)","Disgenet (Heart failure)"]
BAMBI	2	["Cardiomegaly","Congestive heart failure"]	0	[]	4	["CTD (Cardiomegaly)","Disgenet (Congestive heart failure)","CTD (Heart failure)","Disgenet (Heart failure)"]
ROCK2	2	["Cardiomegaly","Congestive heart failure"]	4	["cGMP-PKG signaling pathway","cAMP signaling pathway","Vascular smooth muscle contraction","Oxytocin signaling pathway"]	4	["CTD (Cardiomegaly)","Disgenet (Congestive heart failure)","CTD (Heart failure)","Disgenet (Heart failure)"]
NPPA	2	["Cardiomegaly","Congestive heart failure"]	10	["cGMP-PKG signaling pathway","cAMP signaling pathway","Hormone signaling","Vascular smooth muscle contraction","Thermogenesis","Oxytocin signaling pathway","Regulation of lipolysis in adipocytes","Renin secretion","Aldosterone synthesis and secretion","Physiological factors"]	6	["CTD (Cardiomegaly)","Disgenet (Congestive heart failure)","CTD (Hypertension)","CTD (Heart failure)","Disgenet (Heart failure)","Disgenet (Myocardial infarction)"]
HTR2B	2	["Cardiomegaly","Congestive heart failure"]	0	[]	5	["CTD (Cardiomegaly)","Disgenet (Congestive heart failure)","CTD (Hypertension)","CTD (Heart failure)","Disgenet (Heart failure)"]

NPR1 (natriuretic peptide receptor 1)

Bookmark This Gene