NPPA (natriuretic peptide A)

Gene

• Entrez ID: 4878
• Gene name: Natriuretic peptide A
• Gene symbol: NPPA
• Synonyms (NCBI Gene): ANF, ANP, ATFB6, ATRST2, CDD, CDD-ANF, CDP, PND
• Chromosome: 1
• Chromosome location: 1p36.22
• Summary: The protein encoded by this gene belongs to the natriuretic peptide family. Natriuretic peptides are implicated in the control of extracellular fluid volume and electrolyte homeostasis. This protein is synthesized as a large precursor (containing a signal

Transcription factors

Transcription factor	Regulation	Reference
ANKRD1	Repression	18273862
FOS	Unknown	1530876
GATA4	Activation	14573514
HAND2	Activation	12392994
JARID2	Unknown	18805276
NKX2-2	Activation	14573514
TBX5	Activation	14573514;18451335
ZIC3	Unknown	17468179

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001666	Process	Response to hypoxia	IEA
GO:0003008	Process	System process	IEA
GO:0003085	Process	Negative regulation of systemic arterial blood pressure	IBA
GO:0003085	Process	Negative regulation of systemic arterial blood pressure	IEA
GO:0003161	Process	Cardiac conduction system development	NAS	26786210
GO:0003180	Process	Aortic valve morphogenesis	TAS	29325903
GO:0005102	Function	Signaling receptor binding	IDA	1672777
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005102	Function	Signaling receptor binding	IPI	16870210
GO:0005179	Function	Hormone activity	IBA
GO:0005179	Function	Hormone activity	IEA
GO:0005184	Function	Neuropeptide hormone activity	IMP	19646991
GO:0005515	Function	Protein binding	IPI	25416956, 32296183
GO:0005576	Component	Extracellular region	HDA	27559042
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	NAS	14718574
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005903	Component	Brush border	IEA
GO:0006182	Process	CGMP biosynthetic process	IBA
GO:0006182	Process	CGMP biosynthetic process	IDA	1672777
GO:0006182	Process	CGMP biosynthetic process	IEA
GO:0006457	Process	Protein folding	IDA	16870210
GO:0007168	Process	Receptor guanylyl cyclase signaling pathway	IBA
GO:0007168	Process	Receptor guanylyl cyclase signaling pathway	IDA	1672777
GO:0007168	Process	Receptor guanylyl cyclase signaling pathway	IEA
GO:0007168	Process	Receptor guanylyl cyclase signaling pathway	TAS	14737067
GO:0007218	Process	Neuropeptide signaling pathway	IBA
GO:0007218	Process	Neuropeptide signaling pathway	IDA	19646991
GO:0007565	Process	Female pregnancy	IEA
GO:0007565	Process	Female pregnancy	ISS
GO:0008217	Process	Regulation of blood pressure	IDA	6230082, 6547996
GO:0008217	Process	Regulation of blood pressure	IEA
GO:0010460	Process	Positive regulation of heart rate	IMP	19646991
GO:0010753	Process	Positive regulation of cGMP-mediated signaling	IEA
GO:0014898	Process	Cardiac muscle hypertrophy in response to stress	IEA
GO:0019934	Process	CGMP-mediated signaling	IBA
GO:0019934	Process	CGMP-mediated signaling	IEA
GO:0030250	Function	Guanylate cyclase activator activity	IMP	19646991
GO:0030308	Process	Negative regulation of cell growth	IEA
GO:0032868	Process	Response to insulin	IEA
GO:0032991	Component	Protein-containing complex	IDA	16870210
GO:0035994	Process	Response to muscle stretch	TAS	15276478
GO:0036376	Process	Sodium ion export across plasma membrane	IEA
GO:0042059	Process	Negative regulation of epidermal growth factor receptor signaling pathway	IDA	20353436
GO:0042311	Process	Vasodilation	IEA
GO:0042629	Component	Mast cell granule	IEA
GO:0042995	Component	Cell projection	IEA
GO:0043114	Process	Regulation of vascular permeability	IDA	36016499
GO:0043204	Component	Perikaryon	IEA
GO:0043508	Process	Negative regulation of JUN kinase activity	IDA	22399583
GO:0045776	Process	Negative regulation of blood pressure	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0051427	Function	Hormone receptor binding	IBA
GO:0051427	Function	Hormone receptor binding	IPI	1660465
GO:0060372	Process	Regulation of atrial cardiac muscle cell membrane repolarization	IMP	19646991
GO:0060452	Process	Positive regulation of cardiac muscle contraction	IMP	19646991
GO:0061049	Process	Cell growth involved in cardiac muscle cell development	IEA
GO:0070301	Process	Cellular response to hydrogen peroxide	IEA
GO:0071260	Process	Cellular response to mechanical stimulus	IEA
GO:0071855	Function	Neuropeptide receptor binding	IMP	19646991
GO:0090090	Process	Negative regulation of canonical Wnt signaling pathway	IDA	23749889
GO:0097746	Process	Blood vessel diameter maintenance	IEA
GO:0098690	Component	Glycinergic synapse	IEA
GO:0099538	Process	Synaptic signaling via neuropeptide	IEA
GO:1902514	Process	Regulation of calcium ion transmembrane transport via high voltage-gated calcium channel	IEA
GO:1902514	Process	Regulation of calcium ion transmembrane transport via high voltage-gated calcium channel	ISS	8301666
GO:1903766	Process	Positive regulation of potassium ion export across plasma membrane	IDA	8301666, 19646991
GO:1903766	Process	Positive regulation of potassium ion export across plasma membrane	IEA
GO:1903815	Process	Negative regulation of collecting lymphatic vessel constriction	IEA
GO:1904385	Process	Cellular response to angiotensin	IEA
GO:1904681	Process	Response to 3-methylcholanthrene	IEA

Other IDs

• MIM: 108780
• HGNC: 7939
• e!Ensembl: ENSG00000175206

Protein

• UniProt ID: P01160
• Protein name: Natriuretic peptides A (Atrial natriuretic factor prohormone) (proANF) (Atrial natriuretic peptide prohormone) (preproANP) (proANP) (Atriopeptigen) (Cardiodilatin) (CDD) (preproCDD-ANF) [Cleaved into: Long-acting natriuretic peptide (LANP) (Long-acting na
• Protein function: [Atrial natriuretic peptide]: Hormone that plays a key role in mediating cardio-renal homeostasis, and is involved in vascular remodeling and regulating energy metabolism (PubMed:15741263, PubMed:16875975, PubMed:18835931, PubMed:21672517, PubMe
• PDB: 1ANP, 1YK0, 3N57, 7BRH, 7BRJ, 7BRK, 8TG9, 9BCQ
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00212	ANP	116 → 146	Atrial natriuretic peptide	Family

• Tissue specificity: TISSUE SPECIFICITY: [Urodilatin]: Detected in the kidney distal tubular cells (at protein level) (PubMed:8384600, PubMed:9794555). Present in urine (at protein level) (PubMed:2972874, PubMed:8351194, PubMed:8779891, PubMed:9794555). {ECO:0000269|PubMed:29
• Sequence:

  MSSFSTTTVSFLLLLAFQLLGQTRANPMYNAVSNADLMDFKNLLDHLEEKMPLEDEVVPP
  QVLSEPNEEAGAALSPLPEVPPWTGEVSPAQRDGGALGRGPWDSSDRSALLKSKLRALLT
  APRSLRRSSCFGGRMDRIGAQSGLGCNSFRY

• Sequence length: 151

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Atrial fibrillation, familial, 6	Pathogenic	rs587776851	RCV000019366	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
AORTIC VALVE INSUFFICIENCY	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION, FAMILIAL 1	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION, FAMILIAL, 10	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION, FAMILIAL, 11	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION, FAMILIAL, 12	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION, FAMILIAL, 13	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION, FAMILIAL, 14	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION, FAMILIAL, 15	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION, FAMILIAL, 2	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION, FAMILIAL, 3	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION, FAMILIAL, 4	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION, FAMILIAL, 5	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION, FAMILIAL, 7	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION, FAMILIAL, 8	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION, FAMILIAL, 9	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL STANDSTILL	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL STANDSTILL 1	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial standstill 2	Likely benign; Conflicting classifications of pathogenicity; Benign; Uncertain significance	ClinVar ClinVar, Disgenet, HPO ClinVar, Disgenet, HPO ClinVar, Disgenet, HPO	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
CARCINOMA, SMALL CELL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiac arrhythmia	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMEGALY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHY, DILATED	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC ISCHEMIC HEART DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGESTIVE HEART FAILURE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERIOSCLEROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY HEART DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY STENOSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA, VASCULAR	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DUCTUS ARTERIOSUS, PATENT	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FAMILIAL ATRIAL FIBRILLATION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE, DIASTOLIC	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEREDITARY ATRIAL FIBRILLATION	—	Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERCAPNIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION, RENAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTROPHY, LEFT VENTRICULAR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTENSION	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOXIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE, ACUTE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEFT VENTRICULAR HYPERTROPHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MELANOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NPPA-related disorder	Likely benign; Benign; Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PATENT DUCTUS ARTERIOSUS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RENAL HYPERTENSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATIC AORTIC REGURGITATION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URETERAL OBSTRUCTION	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URINATION DISORDERS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveal melanoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Vascular dementia	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENTRICULAR REMODELING	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	25252038, 28630469		★☆☆☆☆ Found in Text Mining only
Acute Kidney Insufficiency	Acute Kidney Insufficiency	CTD_human_DG	1825077, 19298916, 2948068		★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	30623208		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	16297362		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	CTD_human_DG	18225537		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Basal Cell	Adenocarcinoma	CTD_human_DG	18225537		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Oxyphilic	Adenocarcinoma	CTD_human_DG	18225537		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Tubular	Adenocarcinoma	CTD_human_DG	18225537		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	25902149	Associate	★☆☆☆☆ Found in Text Mining only
Amyloid Neuropathies Familial	Amyloid neuropathy	Pubtator	16721833	Associate	★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	16721833		★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	Pubtator	16721833, 9525543	Associate	★☆☆☆☆ Found in Text Mining only
Aneurysm	Aneurysm	Pubtator	2521342	Associate	★☆☆☆☆ Found in Text Mining only
Angina Stable	Angina pectoris	Pubtator	22575314	Associate	★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	29926894		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	29926894		★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	17709640		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Aortic Valve Insufficiency	Aortic Valve Insufficiency	CTD_human_DG	21216836		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Arrhythmias Cardiac	Cardiac arrhythmias	Pubtator	26762269	Associate	★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	17709640, 30781751		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	29549113		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	18294255		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	LHGDN	18294255		★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia Telangiectasia	BEFREE	28816533		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	17709640, 30781751		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	26720342	Associate	★☆☆☆☆ Found in Text Mining only
Atrial cardiomyopathy	Atrial cardiomyopathy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	LHGDN	18614783		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	19646991, 20064500, 20543198, 26200358, 28507570, 28630469, 29457260, 31034774, 31077706, 31680326		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	19646991, 20543198, 26267381, 27567174, 35393944	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	HPO_DG			★☆☆☆☆ Found in Text Mining only
ATRIAL FIBRILLATION, FAMILIAL, 1 (disorder)	Atrial Fibrillation	ORPHANET_DG	18614783		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation, Familial, 6	Atrial Fibrillation	CTD_human_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Atrial Fibrillation, Familial, 6	Atrial Fibrillation	CLINVAR_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Atrial Septal Defects	Atrial Septal Defect	BEFREE	19764075		★☆☆☆☆ Found in Text Mining only
Atrial standstill	Atrial standstill	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL STANDSTILL 2	Atrial standstill	UNIPROT_DG	23275345		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
ATRIAL STANDSTILL 2	Atrial standstill	CLINVAR_DG			★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	28034801		★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Brain ischemia	Pubtator	24599027	Stimulate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	12438259		★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary dysplasia	Pubtator	35509863	Associate	★☆☆☆☆ Found in Text Mining only
Brugada Syndrome	Brugada syndrome	Pubtator	36303204	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	11448100		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	9155593	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	23896864		★☆☆☆☆ Found in Text Mining only
Carcinoma, Cribriform	Carcinoma	CTD_human_DG	18225537		★☆☆☆☆ Found in Text Mining only
Carcinoma, Granular Cell	Carcinoma	CTD_human_DG	18225537		★☆☆☆☆ Found in Text Mining only
Cardioembolic stroke	Cardioembolic Stroke	BEFREE	22400494		★☆☆☆☆ Found in Text Mining only
Cardiomegaly	Cardiomegaly	Pubtator	9525543	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathies	Cardiomyopathy	BEFREE	24599027, 31306370		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	34946895	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	2521342	Stimulate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	28500252, 34946895	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Hypertrophic	Hypertrophic cardiomyopathy	Pubtator	12796566, 16389460, 32533462	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Hypertrophic	Hypertrophic cardiomyopathy	Pubtator	26784941	Stimulate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	CTD_human_DG	11986409, 16762803		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathy, Dilated	Cardiomyopathy	LHGDN	18092954		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathy, Dilated	Cardiomyopathy	BEFREE	23275345		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathy, Dilated	Cardiomyopathy	GENOMICS_ENGLAND_DG	23275345		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	CTD_human_DG	11986409, 16762803		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	2521342, 27696308, 29240788		★☆☆☆☆ Found in Text Mining only
CARDIOMYOPATHY, FAMILIAL, WITH CONDUCTION DISTURBANCE	Atrial standstill	ORPHANET_DG	23275345		★☆☆☆☆ Found in Text Mining only
CARDIOMYOPATHY, FAMILIAL, WITH CONDUCTION DISTURBANCE	Atrial standstill	HPO_DG			★☆☆☆☆ Found in Text Mining only
CARDIOMYOPATHY, FAMILIAL, WITH CONDUCTION DISTURBANCE	Atrial standstill	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Cardiovascular Abnormalities	Cardiovascular abnormalities	Pubtator	19764075	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	18212314, 19146799, 24487939, 30027789		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	LHGDN	18212314		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	24041948	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Hemorrhage	Cerebral hemorrhage	Pubtator	25144711	Inhibit	★☆☆☆☆ Found in Text Mining only
Cerebral Hemorrhage	Cerebral hemorrhage	Pubtator	25144711	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	11409652, 22400494, 25144711	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	11706124		★☆☆☆☆ Found in Text Mining only
Cerebral Small Vessel Diseases	Cerebral microangiopathy	Pubtator	22400494	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	10525492, 11706124, 12052474, 19146799, 20543198, 22400494, 26720342, 28630469, 30829962, 9931108		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	LHGDN	15017020		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	HPO_DG			★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular Disorders	BEFREE	15485132, 9931108		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	25902149	Inhibit	★☆☆☆☆ Found in Text Mining only
Congenital Heart Defects	Congenital heart defects	LHGDN	16117728		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	CTD_human_DG	11136700, 16101196, 1647690, 8112904		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congestive heart failure	Congestive Heart Failure	BEFREE	1535030, 17890443, 20433683, 22752749, 23131304, 23152112, 24599027, 2521342, 25541130, 28453725, 29352508, 30148170, 31128228, 7616436, 8083346		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Conn Adenoma	Conn Adenoma	BEFREE	7575587, 7980610		★☆☆☆☆ Found in Text Mining only
Conn Syndrome	Conn Syndrome	BEFREE	7980610		★☆☆☆☆ Found in Text Mining only
Conotruncal defect	Conotruncal defect	BEFREE	16100725, 22868813		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	12514664, 16721833, 22575314, 24487939, 25400811		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	16721833, 22575314	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	22388798	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	29867541		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Stenosis	Coronary Stenosis	CTD_human_DG	12721106		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Craniodiaphyseal dysplasia	Craniodiaphyseal Dysplasia	BEFREE	28575517		★☆☆☆☆ Found in Text Mining only
CRANIODIAPHYSEAL DYSPLASIA, AUTOSOMAL DOMINANT (disorder)	Craniodiaphyseal dysplasia	BEFREE	28575517		★☆☆☆☆ Found in Text Mining only
Cryopyrin-Associated Periodic Syndromes	Cryopyrin-Associated Periodic Syndromes	BEFREE	29549113		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	23378603		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	17660224		★☆☆☆☆ Found in Text Mining only
Depression, Postpartum	Mental Depression	BEFREE	19651446		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	17045757, 30089466		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	11408388, 24586593		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	11408388, 24586593, 31336140		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	24586593, 29253899, 32171244	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	23288489, 24586593, 27413750	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	10405209		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	23288489, 24586593, 27413750		★☆☆☆☆ Found in Text Mining only
Diabetic Cardiomyopathies	Diabetic cardiomyopathy	BEFREE	26349963		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	15111511, 9681733		★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	11409652, 25917967, 27136577		★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	Pubtator	16875975, 25366732, 27413750, 32555714	Associate	★☆☆☆☆ Found in Text Mining only
Familial atrial fibrillation	Atrial Fibrillation	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial Atypical Mole Melanoma Syndrome	Atypical Mole Melanoma Syndrome	BEFREE	1531137		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	CTD_human_DG	15613622		★☆☆☆☆ Found in Text Mining only
Gastroschisis	Gastroschisis	BEFREE	17051589		★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	27723368, 8513321, 8670262		★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	27723368, 9171949		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	28861994		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	28861994		★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	6236919	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	LHGDN	18280250		★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	19158604		★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	30148170	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	CTD_human_DG	11136700, 16101196, 1647690, 8112904		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart failure	Heart Failure	BEFREE	1535030, 17890443, 20433683, 23152112, 24599027, 2521342, 25541130, 28453725, 29352508, 30148170, 31128228, 8083346		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Failure	Heart failure	Pubtator	21216831, 24599027, 25117468, 2521342, 26639357, 27185878, 28500252, 31548261	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Failure	Heart failure	Pubtator	30148170, 31521687	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Failure, Diastolic	Heart Failure	CTD_human_DG	29556499		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Failure, Right-Sided	Heart Failure	CTD_human_DG	11136700, 16101196, 1647690, 8112904		★☆☆☆☆ Found in Text Mining only
Heart Septal Defects Atrial	Congenital heart septal defect	Pubtator	19764075	Associate	★☆☆☆☆ Found in Text Mining only
Hematologic Diseases	Hematologic disease	Pubtator	19764075	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	28453725		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	28453725		★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia, Familial	Hypercholesterolemia	LHGDN	16721833		★☆☆☆☆ Found in Text Mining only
Hyperlipidemias	Hyperlipidemia	Pubtator	25400811	Associate	★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type II	Hyperlipoproteinemia	Pubtator	16721833	Associate	★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type IIa	Hyperlipoproteinemia	BEFREE	16721833		★☆☆☆☆ Found in Text Mining only
Hyperpepsinogenemia I	Hyperpepsinogenemia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	16875975, 19219041, 20543198, 23637347, 27185878, 27413750, 31548261, 32883357	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	CTD_human_DG	12940879, 19219041, 24039778, 2526952, 7839143, 8188982, 9869009		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	BEFREE	16368448, 17525707, 17672826, 17984371, 18212314, 18716601, 19146799, 19219041, 19330901, 20137368, 20433683, 20543198, 20798523, 21276798, 24611929, 26074089, 27413750, 27480094, 29253899, 30781751, 31341238, 9397252, 9681733, 9931108		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	LHGDN	16875975, 17525707, 17672826, 17901852, 17984371		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperthyroidism	Hyperthyroidism	Pubtator	17389707	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	LHGDN	15118286		★☆☆☆☆ Found in Text Mining only
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	20137368, 30714521		★☆☆☆☆ Found in Text Mining only
Hypertrophic obstructive cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	30714521		★☆☆☆☆ Found in Text Mining only
Hypertrophy	Hypertrophy	Pubtator	28500252	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypertrophy	Hypertrophy	Pubtator	32533462, 34854353	Associate	★☆☆☆☆ Found in Text Mining only
Hypertrophy Left Ventricular	Left ventricular disease	Pubtator	23799939, 28500252	Associate	★☆☆☆☆ Found in Text Mining only
Hypotension Orthostatic	Orthostatic hypotension	Pubtator	22504314	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	34365455	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Impaired cognition	Impaired Cognition	BEFREE	25902149		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	17660224		★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron overload	Pubtator	31521687	Associate	★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	11706124, 24654911		★☆☆☆☆ Found in Text Mining only
Juvenile Neuronal Ceroid Lipofuscinosis	Neuronal Ceroid Lipofuscinosis	BEFREE	9618513		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	10405209, 11408388		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	CTD_human_DG	1825077, 19298916, 2948068		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	10335726, 11882568, 20137368, 25027872		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	CTD_human_DG	10755198, 9455993		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	LHGDN	17672826, 17901852		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Left-Sided Heart Failure	Heart Failure	CTD_human_DG	11136700, 16101196, 1647690, 8112904		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	CTD_human_DG	15613622		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Long QT Syndrome	Long qt syndrome	Pubtator	36303204	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	CTD_human_DG	18717826		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	28816533		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	12438259, 17018605		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	CTD_human_DG	18717826		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	23896864		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	18225537		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	CTD_human_DG	18004088		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	31053405		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	CTD_human_DG	18004088		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	BEFREE	17045757, 30089466		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	24498028		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	21798427, 23637347, 29253899, 37417873	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	29253899	Inhibit	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	28552863, 29253899		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	35393944	Associate	★☆☆☆☆ Found in Text Mining only
Mood swings	Mood swings	BEFREE	30457060		★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy	Muscular dystrophy	BEFREE	27769579		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	17018605		★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	17018605		★☆☆☆☆ Found in Text Mining only
Myocardial Failure	Myocardial Infarction	CTD_human_DG	11136700, 16101196, 1647690, 8112904		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	CTD_human_DG	11743230, 9527094		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial Infarction	BEFREE	12514664, 22400494, 23131304, 26720342, 28855643, 29352508		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial Infarction	LHGDN	12514664, 17292492		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial infarction	Pubtator	14745141	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial infarction	Pubtator	22400494, 24041948, 26720342	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial infarction	Pubtator	2521342, 34365455	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial Ischemia	CTD_human_DG	1830552		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial Ischemia	BEFREE	25252038		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial necrosis	Myocardial necrosis	BEFREE	23131304		★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	25401746, 26720342	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	17682059, 7575587, 7980610		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	8668335		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	23286744		★☆☆☆☆ Found in Text Mining only
Nevus sebaceous	Epidermal nevus syndrome	BEFREE	22699864		★☆☆☆☆ Found in Text Mining only
Nevus Sebaceus of Jadassohn	Epidermal nevus syndrome	BEFREE	22699864		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	21798427, 29253899, 34875662, 37417873	Associate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	26074089, 29253899		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	29253899	Inhibit	★☆☆☆☆ Found in Text Mining only
Obesity Abdominal	Obesity	Pubtator	34875662	Associate	★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic Disorder	BEFREE	19651446		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	28651752		★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	CTD_human_DG	1421905		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Patent Ductus Arteriosus Familial	Patent ductus arteriosus	CTD_human_DG	1421905		★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	30740076		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	18225537		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	GWASCAT_DG	25854761		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Renal hypertension	Renal Hypertension	BEFREE	30359461		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Renal hypertension	Renal Hypertension	CTD_human_DG	8763405		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	29549113, 8356406		★☆☆☆☆ Found in Text Mining only
Right ventricular cardiomyopathy	Ventricular Cardiomyopathy	BEFREE	23131304		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	30790597		★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	CTD_human_DG	18004088		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sleep Apnea Central	Sleep apnea	Pubtator	24030529	Stimulate	★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	7539317, 8391389		★☆☆☆☆ Found in Text Mining only
Spastic Paraplegia, Hereditary	Spastic paraplegia	BEFREE	28052917		★☆☆☆☆ Found in Text Mining only
Spondylarthritis	Spondyloarthritis	BEFREE	17660224		★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	20543198, 22400494, 24041948, 25452597, 26720342	Associate	★☆☆☆☆ Found in Text Mining only
Urination Disorders	Urination Disorders	CTD_human_DG	8318687		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine Fibroids	Uterine Fibroids	BEFREE	12115525		★☆☆☆☆ Found in Text Mining only
Vascular System Injuries	Vascular system injury	Pubtator	26720342	Associate	★☆☆☆☆ Found in Text Mining only
Ventricular Dysfunction	Ventricular dysfunction	Pubtator	19326473	Inhibit	★☆☆☆☆ Found in Text Mining only
Ventricular Dysfunction Left	Ventricular dysfunction	Pubtator	16875975, 2521342, 25371308, 25400811	Associate	★☆☆☆☆ Found in Text Mining only
Ventricular Remodeling	Ventricular remodeling	Pubtator	16875975	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations