MYL9 (myosin light chain 9)

Gene

• Entrez ID: 10398
• Gene name: Myosin light chain 9
• Gene symbol: MYL9
• Synonyms (NCBI Gene): LC20, MLC-2C, MLC2, MMIHS4, MRLC1, MYRL2
• Chromosome: 20
• Chromosome location: 20q11.23
• Summary: Myosin, a structural component of muscle, consists of two heavy chains and four light chains. The protein encoded by this gene is a myosin light chain that may regulate muscle contraction by modulating the ATPase activity of myosin heads. The encoded prot

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT437478	hsa-miR-663a	Luciferase reporter assay, qRT-PCR, Western blot	24014830
MIRT490441	hsa-miR-3936	PAR-CLIP	23592263
MIRT490442	hsa-miR-6782-5p	PAR-CLIP	23592263
MIRT490440	hsa-miR-6840-3p	PAR-CLIP	23592263
MIRT490439	hsa-miR-1915-3p	PAR-CLIP	23592263
MIRT490438	hsa-miR-6764-5p	PAR-CLIP	23592263
MIRT490437	hsa-miR-4726-3p	PAR-CLIP	23592263
MIRT490436	hsa-miR-3151-3p	PAR-CLIP	23592263
MIRT490435	hsa-miR-7515	PAR-CLIP	23592263
MIRT490434	hsa-miR-3179	PAR-CLIP	23592263
MIRT490433	hsa-miR-6747-5p	PAR-CLIP	23592263
MIRT490432	hsa-miR-3192-3p	PAR-CLIP	23592263
MIRT490431	hsa-miR-6864-5p	PAR-CLIP	23592263
MIRT731661	hsa-miR-223-3p	Luciferase reporter assay	27121304
MIRT731661	hsa-miR-223-3p	Luciferase reporter assay	27121304
MIRT490441	hsa-miR-3936	PAR-CLIP	23592263
MIRT490442	hsa-miR-6782-5p	PAR-CLIP	23592263
MIRT490440	hsa-miR-6840-3p	PAR-CLIP	23592263
MIRT490439	hsa-miR-1915-3p	PAR-CLIP	23592263
MIRT490438	hsa-miR-6764-5p	PAR-CLIP	23592263
MIRT490437	hsa-miR-4726-3p	PAR-CLIP	23592263
MIRT490436	hsa-miR-3151-3p	PAR-CLIP	23592263
MIRT490435	hsa-miR-7515	PAR-CLIP	23592263
MIRT490434	hsa-miR-3179	PAR-CLIP	23592263
MIRT490433	hsa-miR-6747-5p	PAR-CLIP	23592263
MIRT490432	hsa-miR-3192-3p	PAR-CLIP	23592263
MIRT490431	hsa-miR-6864-5p	PAR-CLIP	23592263
MIRT1168635	hsa-miR-1270	CLIP-seq
MIRT1168636	hsa-miR-147	CLIP-seq
MIRT1168637	hsa-miR-1913	CLIP-seq
MIRT1168638	hsa-miR-3192	CLIP-seq
MIRT1168639	hsa-miR-324-3p	CLIP-seq
MIRT1168640	hsa-miR-326	CLIP-seq
MIRT1168641	hsa-miR-330-5p	CLIP-seq
MIRT1168642	hsa-miR-33a	CLIP-seq
MIRT1168643	hsa-miR-33b	CLIP-seq
MIRT1168644	hsa-miR-3911	CLIP-seq
MIRT1168645	hsa-miR-4313	CLIP-seq
MIRT1168646	hsa-miR-4314	CLIP-seq
MIRT1168647	hsa-miR-4327	CLIP-seq
MIRT1168648	hsa-miR-4531	CLIP-seq
MIRT1168649	hsa-miR-4646-5p	CLIP-seq
MIRT1168650	hsa-miR-4683	CLIP-seq
MIRT1168651	hsa-miR-4710	CLIP-seq
MIRT1168652	hsa-miR-4727-5p	CLIP-seq
MIRT1168653	hsa-miR-4792	CLIP-seq
MIRT1168654	hsa-miR-599	CLIP-seq
MIRT1168655	hsa-miR-620	CLIP-seq
MIRT1168656	hsa-miR-644	CLIP-seq
MIRT2277401	hsa-miR-1236	CLIP-seq
MIRT2277402	hsa-miR-1343	CLIP-seq
MIRT2277403	hsa-miR-4691-5p	CLIP-seq
MIRT2277404	hsa-miR-4757-5p	CLIP-seq
MIRT2277405	hsa-miR-637	CLIP-seq
MIRT2277405	hsa-miR-637	CLIP-seq
MIRT1168636	hsa-miR-147	CLIP-seq
MIRT2431319	hsa-miR-3144-5p	CLIP-seq
MIRT1168642	hsa-miR-33a	CLIP-seq
MIRT1168643	hsa-miR-33b	CLIP-seq
MIRT2431320	hsa-miR-3649	CLIP-seq
MIRT1168644	hsa-miR-3911	CLIP-seq
MIRT1168647	hsa-miR-4327	CLIP-seq
MIRT1168651	hsa-miR-4710	CLIP-seq
MIRT1168653	hsa-miR-4792	CLIP-seq
MIRT1168654	hsa-miR-599	CLIP-seq
MIRT1168656	hsa-miR-644	CLIP-seq
MIRT1168636	hsa-miR-147	CLIP-seq
MIRT2431319	hsa-miR-3144-5p	CLIP-seq
MIRT2576295	hsa-miR-3151	CLIP-seq
MIRT1168642	hsa-miR-33a	CLIP-seq
MIRT1168643	hsa-miR-33b	CLIP-seq
MIRT2431320	hsa-miR-3649	CLIP-seq
MIRT1168644	hsa-miR-3911	CLIP-seq
MIRT1168647	hsa-miR-4327	CLIP-seq
MIRT2576296	hsa-miR-4447	CLIP-seq
MIRT2576297	hsa-miR-4450	CLIP-seq
MIRT2576298	hsa-miR-4472	CLIP-seq
MIRT1168651	hsa-miR-4710	CLIP-seq
MIRT1168653	hsa-miR-4792	CLIP-seq
MIRT2576299	hsa-miR-491-5p	CLIP-seq
MIRT1168654	hsa-miR-599	CLIP-seq
MIRT1168656	hsa-miR-644	CLIP-seq
MIRT2685644	hsa-miR-1207-5p	CLIP-seq
MIRT2685645	hsa-miR-125a-5p	CLIP-seq
MIRT2685646	hsa-miR-125b	CLIP-seq
MIRT1168636	hsa-miR-147	CLIP-seq
MIRT2431319	hsa-miR-3144-5p	CLIP-seq
MIRT2576295	hsa-miR-3151	CLIP-seq
MIRT1168642	hsa-miR-33a	CLIP-seq
MIRT1168643	hsa-miR-33b	CLIP-seq
MIRT2431320	hsa-miR-3649	CLIP-seq
MIRT1168644	hsa-miR-3911	CLIP-seq
MIRT2685647	hsa-miR-4319	CLIP-seq
MIRT1168647	hsa-miR-4327	CLIP-seq
MIRT2576296	hsa-miR-4447	CLIP-seq
MIRT2576297	hsa-miR-4450	CLIP-seq
MIRT2576298	hsa-miR-4472	CLIP-seq
MIRT2685648	hsa-miR-4525	CLIP-seq
MIRT1168651	hsa-miR-4710	CLIP-seq
MIRT2685649	hsa-miR-4713-3p	CLIP-seq
MIRT2685650	hsa-miR-4716-3p	CLIP-seq
MIRT2685651	hsa-miR-4732-3p	CLIP-seq
MIRT2685652	hsa-miR-4763-3p	CLIP-seq
MIRT1168653	hsa-miR-4792	CLIP-seq
MIRT2576299	hsa-miR-491-5p	CLIP-seq
MIRT1168654	hsa-miR-599	CLIP-seq
MIRT1168656	hsa-miR-644	CLIP-seq
MIRT2685653	hsa-miR-670	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
MAL	Unknown	19724058
RUNX1	Unknown	20876458;22898599
SRF	Unknown	19724058

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001725	Component	Stress fiber	IBA
GO:0001725	Component	Stress fiber	IDA	39106863
GO:0001725	Component	Stress fiber	IEA
GO:0005200	Function	Structural constituent of cytoskeleton	IDA	39106863
GO:0005509	Function	Calcium ion binding	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005859	Component	Muscle myosin complex	TAS	2526655
GO:0005938	Component	Cell cortex	IEA
GO:0006937	Process	Regulation of muscle contraction	TAS	2526655
GO:0008307	Function	Structural constituent of muscle	TAS	2526655
GO:0016459	Component	Myosin complex	IEA
GO:0016460	Component	Myosin II complex	IBA
GO:0016460	Component	Myosin II complex	IEA
GO:0030016	Component	Myofibril	IBA
GO:0030018	Component	Z disc	IEA
GO:0030239	Process	Myofibril assembly	IBA
GO:0032036	Function	Myosin heavy chain binding	IBA
GO:0032036	Function	Myosin heavy chain binding	IEA
GO:0043149	Process	Stress fiber assembly	IDA	39106863
GO:0046872	Function	Metal ion binding	IEA
GO:0070527	Process	Platelet aggregation	HMP	23382103

Other IDs

• MIM: 609905
• HGNC: 15754
• e!Ensembl: ENSG00000101335

Protein

• UniProt ID: P24844
• Protein name: Myosin regulatory light polypeptide 9 (20 kDa myosin light chain) (LC20) (MLC-2C) (Myosin RLC) (Myosin regulatory light chain 2, smooth muscle isoform) (Myosin regulatory light chain 9) (Myosin regulatory light chain MRLC1)
• Protein function: Myosin regulatory subunit that plays an important role in regulation of both smooth muscle and nonmuscle cell contractile activity via its phosphorylation. Implicated in cytokinesis, receptor capping, and cell locomotion (PubMed:11942626, PubMed
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13405	EF-hand_6	33 → 62	EF-hand domain	Domain
  PF13833	EF-hand_8	114 → 166	EF-hand domain pair	Domain

• Tissue specificity: TISSUE SPECIFICITY: Smooth muscle tissues and in some, but not all, nonmuscle cells. {ECO:0000269|PubMed:2526655}.
• Sequence:

  MSSKRAKAKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLAS
  LGKNPTDEYLEGMMSEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEASGFIHE
  DHLRELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEFTRILKHGAKDKDD

• Sequence length: 172

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BRAIN EDEMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHY, HYPERTROPHIC, FAMILIAL	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MEGACYSTIS MICROCOLON INTESTINAL HYPOPERISTALSIS SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Megacystis-microcolon-intestinal hypoperistalsis syndrome 4	Conflicting classifications of pathogenicity	ClinVar ClinVar, Disgenet, GWAS catalog, HPO ClinVar, Disgenet, GWAS catalog, HPO ClinVar, Disgenet, GWAS catalog, HPO	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
VASCULAR DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Visceral myopathy 1	Conflicting classifications of pathogenicity	ClinVar Disgenet	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	34729929	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	34852854	Associate	★☆☆☆☆ Found in Text Mining only
Apraxia, Developmental Verbal	Apraxia	BEFREE	29378169		★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Platelet disorder	Pubtator	20876458	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	34729929, 34911847	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	34729929	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	25179839		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	34821071	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	34729929	Inhibit	★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	24374283		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Hypertrophic, Familial	Cardiomyopathy	BEFREE	16076902, 24374283, 31101927		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	34729929	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	28013338, 29246519, 31255531		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	34729929, 36910014	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	29246519, 30786729, 33096021, 37031206	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	34974798	Stimulate	★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	15824735		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	29955616	Associate	★☆☆☆☆ Found in Text Mining only
Edema	Edema	Pubtator	38013282	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	23670619		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	28388691	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Open angle glaucoma	Pubtator	24603425	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	31270134		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	35456975	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	31270134		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	33885248	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	BEFREE	20167632		★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	29846751		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	34729929	Associate	★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type IIa	Hyperlipoproteinemia	BEFREE	16837010, 24374283		★☆☆☆☆ Found in Text Mining only
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	30365366		★☆☆☆☆ Found in Text Mining only
Hypertrophic obstructive cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	30365366		★☆☆☆☆ Found in Text Mining only
Hypertrophy Left Ventricular	Left ventricular disease	Pubtator	29068603	Associate	★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial aneurysm	Pubtator	24615040	Associate	★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	29068603		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	22898599	Associate	★☆☆☆☆ Found in Text Mining only
Leukoencephalopathy	Leukoencephalopathy	BEFREE	26193381		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	30867848, 34729929, 34911847	Associate	★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	29846751		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	25179839		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	24338276		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	28013338, 29246519, 31255531		★☆☆☆☆ Found in Text Mining only
Megacystis microcolon intestinal hypoperistalsis syndrome	Berdon syndrome	BEFREE	29453416		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Megacystis microcolon intestinal hypoperistalsis syndrome	Megacystis microcolon intestinal hypoperistalsis syndrome	Pubtator	29453416, 33031641	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MEGALENCEPHALIC LEUKOENCEPHALOPATHY WITH SUBCORTICAL CYSTS	Megalencephalic Leukoencephalopathy With Subcortical Cysts	BEFREE	26193381		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	30583235		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	34911847	Associate	★☆☆☆☆ Found in Text Mining only
Myopathy	Myopathy	BEFREE	30365366		★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	38013282	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15824735, 25179839, 28388691		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	25179839		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	1599878		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	34729929	Associate	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	24338276		★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	37781794	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	34729929, 34911847, 37781794, 38179769	Associate	★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	15824735		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	1599878		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	28388691		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	34729929	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	31322220, 34729929	Associate	★☆☆☆☆ Found in Text Mining only
Thrombocytopenia	Thrombocytopenia	Pubtator	20876458	Associate	★☆☆☆☆ Found in Text Mining only
Turner Syndrome	Turner syndrome	Pubtator	32210915	Associate	★☆☆☆☆ Found in Text Mining only
Ureteral Obstruction	Urethral obstruction	Pubtator	38013282	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	38013282	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	CTD_human_DG	18511912		★★☆☆☆ Found in Text Mining + Unknown/Other Associations