Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	8786
Gene name	Regulator of G protein signaling 11
Gene symbol	RGS11
Synonyms (NCBI Gene)	RS11
Chromosome	16
Chromosome location	16p13.3
Summary	The protein encoded by this gene belongs to the RGS (regulator of G protein signaling) family. Members of the RGS family act as GTPase-activating proteins on the alpha subunits of heterotrimeric, signal-transducing G proteins. This protein inhibits signal

41 Show/Hide all (41)

miRTarBase ID	miRNA	Experiments	Reference
MIRT496700	hsa-miR-4732-3p	PAR-CLIP	22291592
MIRT496699	hsa-miR-4750-3p	PAR-CLIP	22291592
MIRT496698	hsa-miR-1199-5p	PAR-CLIP	22291592
MIRT496697	hsa-miR-6751-3p	PAR-CLIP	22291592
MIRT496696	hsa-miR-1180-5p	PAR-CLIP	22291592
MIRT496695	hsa-miR-7114-3p	PAR-CLIP	22291592
MIRT496694	hsa-miR-4663	PAR-CLIP	22291592
MIRT496693	hsa-miR-6807-5p	PAR-CLIP	22291592
MIRT496700	hsa-miR-4732-3p	PAR-CLIP	22291592
MIRT496699	hsa-miR-4750-3p	PAR-CLIP	22291592
MIRT496698	hsa-miR-1199-5p	PAR-CLIP	22291592
MIRT496697	hsa-miR-6751-3p	PAR-CLIP	22291592
MIRT496696	hsa-miR-1180-5p	PAR-CLIP	22291592
MIRT496695	hsa-miR-7114-3p	PAR-CLIP	22291592
MIRT496694	hsa-miR-4663	PAR-CLIP	22291592
MIRT496693	hsa-miR-6807-5p	PAR-CLIP	22291592
MIRT1304079	hsa-miR-1207-5p	CLIP-seq
MIRT1304080	hsa-miR-1237	CLIP-seq
MIRT1304081	hsa-miR-1248	CLIP-seq
MIRT1304082	hsa-miR-1285	CLIP-seq
MIRT1304083	hsa-miR-1321	CLIP-seq
MIRT1304084	hsa-miR-3187-5p	CLIP-seq
MIRT1304085	hsa-miR-342-5p	CLIP-seq
MIRT1304086	hsa-miR-378g	CLIP-seq
MIRT1304087	hsa-miR-4270	CLIP-seq
MIRT1304088	hsa-miR-4314	CLIP-seq
MIRT1304089	hsa-miR-4441	CLIP-seq
MIRT1304090	hsa-miR-4486	CLIP-seq
MIRT1304091	hsa-miR-4504	CLIP-seq
MIRT1304092	hsa-miR-4651	CLIP-seq
MIRT1304093	hsa-miR-4664-5p	CLIP-seq
MIRT1304094	hsa-miR-4697-3p	CLIP-seq
MIRT1304095	hsa-miR-4728-5p	CLIP-seq
MIRT1304096	hsa-miR-4739	CLIP-seq
MIRT1304097	hsa-miR-4756-5p	CLIP-seq
MIRT1304098	hsa-miR-4763-3p	CLIP-seq
MIRT1304099	hsa-miR-608	CLIP-seq
MIRT1304100	hsa-miR-612	CLIP-seq
MIRT1304101	hsa-miR-660	CLIP-seq
MIRT2314890	hsa-miR-3922-5p	CLIP-seq
MIRT2314891	hsa-miR-4753-5p	CLIP-seq

17 Show/Hide all (17)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003924	Function	GTPase activity	IEA
GO:0003924	Function	GTPase activity	TAS
GO:0005096	Function	GTPase activator activity	IBA
GO:0005096	Function	GTPase activator activity	TAS	9789084
GO:0005737	Component	Cytoplasm	IBA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	TAS
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0008277	Process	Regulation of G protein-coupled receptor signaling pathway	IEA
GO:0008277	Process	Regulation of G protein-coupled receptor signaling pathway	TAS	9789084
GO:0009968	Process	Negative regulation of signal transduction	IEA
GO:0031681	Function	G-protein beta-subunit binding	IPI	12606627
GO:0032991	Component	Protein-containing complex	IDA	18468998
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0043005	Component	Neuron projection	IBA

MIM	HGNC	e!Ensembl
603895	9993	ENSG00000076344

O94810

Protein name

Regulator of G-protein signaling 11 (RGS11)

Protein function

Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00610	DEP	35 → 105	Domain found in Dishevelled, Egl-10, and Pleckstrin (DEP)	Domain
PF00615	RGS	303 → 417	Regulator of G protein signaling domain	Domain
PF00631	G-gamma	222 → 284	GGL domain	Domain
PF18148	RGS_DHEX	108 → 207	Regulator of G-protein signalling DHEX domain	Domain

Sequence

MAAGPAPPPGRPRAQMPHLRKMERVVVSMQDPDQGVKMRSQRLLVTVIPHAVTGSDVVQW
LAQKFCVSEEEALHLGAVLVQHGYIYPLRDPRSLMLRPDETPYRFQTPYFWTSTLRPAAE
LDYAIYLAKKNIRKRGTLVDYEKDCYDRLHKKINHAWDLVLMQAREQLRAAKQRSKGDRL
VIACQEQTYWLVNRPPPGAPDVLEQGPGRGSCAASRVLMTKSADFHKREIEYFRKALGRT
RVKSSVCLEAYLSFCGQRGPHDPLVSGCLPSNPWISDNDAYWVMNAPTVAAPTKLRVERW
GFSFRELLEDPVGRAHFMDFLGKEFSGENLSFWEACEELRYGAQAQVPTLVDAVYEQFLA
PGAAHWVNIDSRTMEQTLEGLRQPHRYVLDDAQLHIYMLMKKDSYPRFLKSDMYKALLAE
AGIPLEMKRRVFPFTWRPRHSSPSPALLPTPVEPTAACGPGGGDGVA

Sequence length

467

Interactions

View interactions

Reactome Pathway
G alpha (i) signalling events
Cooperation of PDCL (PhLP1) and TRiC/CCT in G-protein beta folding

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Papillary renal cell carcinoma type 1	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Uncertain significance	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (9)
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	27105500		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	6334747		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	31019021		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	30701963		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	31019021		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	30701963		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	27105500		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10801882, 27105500, 28407247		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	33845140	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

RGS11 (regulator of G protein signaling 11)

Bookmark This Gene