Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	22913
Gene name	RALY heterogeneous nuclear ribonucleoprotein
Gene symbol	RALY
Synonyms (NCBI Gene)	HNRPCL2P542
Chromosome	20
Chromosome location	20q11.22
Summary	This gene encodes a member of the heterogeneous nuclear ribonucleoprotein (hnRNP) gene family. This protein may play a role in pre-mRNA splicing and in embryonic development. Alternate splicing results in multiple transcript variants. [provided by RefSeq,

167 Show/Hide all (167)

miRTarBase ID	miRNA	Experiments	Reference
MIRT044575	hsa-miR-320a	CLASH	23622248
MIRT666746	hsa-miR-3614-3p	HITS-CLIP	23824327
MIRT666747	hsa-miR-654-3p	HITS-CLIP	23824327
MIRT666744	hsa-miR-3183	HITS-CLIP	23824327
MIRT666745	hsa-miR-4723-3p	HITS-CLIP	23824327
MIRT666743	hsa-miR-6769b-3p	HITS-CLIP	23824327
MIRT666742	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT666741	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT666740	hsa-miR-6730-3p	HITS-CLIP	23824327
MIRT666739	hsa-miR-3660	HITS-CLIP	23824327
MIRT666738	hsa-miR-4526	HITS-CLIP	23824327
MIRT666737	hsa-miR-6719-3p	HITS-CLIP	23824327
MIRT666736	hsa-miR-4635	HITS-CLIP	23824327
MIRT666735	hsa-miR-4786-3p	HITS-CLIP	23824327
MIRT666734	hsa-miR-4297	HITS-CLIP	23824327
MIRT666733	hsa-miR-5581-5p	HITS-CLIP	23824327
MIRT666732	hsa-miR-7111-3p	HITS-CLIP	23824327
MIRT666731	hsa-miR-6780a-3p	HITS-CLIP	23824327
MIRT666730	hsa-miR-6881-3p	HITS-CLIP	23824327
MIRT666729	hsa-miR-7843-3p	HITS-CLIP	23824327
MIRT666728	hsa-miR-127-5p	HITS-CLIP	23824327
MIRT497396	hsa-miR-3622a-3p	PAR-CLIP	22291592
MIRT497395	hsa-miR-3622b-3p	PAR-CLIP	22291592
MIRT497394	hsa-miR-6765-3p	PAR-CLIP	22291592
MIRT497393	hsa-miR-412-3p	PAR-CLIP	22291592
MIRT497392	hsa-miR-6754-3p	PAR-CLIP	22291592
MIRT497391	hsa-miR-938	PAR-CLIP	22291592
MIRT497390	hsa-miR-6886-3p	PAR-CLIP	22291592
MIRT497389	hsa-miR-885-3p	PAR-CLIP	22291592
MIRT497388	hsa-miR-486-3p	PAR-CLIP	22291592
MIRT666746	hsa-miR-3614-3p	HITS-CLIP	23824327
MIRT666747	hsa-miR-654-3p	HITS-CLIP	23824327
MIRT666744	hsa-miR-3183	HITS-CLIP	23824327
MIRT666745	hsa-miR-4723-3p	HITS-CLIP	23824327
MIRT666743	hsa-miR-6769b-3p	HITS-CLIP	23824327
MIRT666742	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT666741	hsa-miR-7110-3p	HITS-CLIP	23824327
MIRT666740	hsa-miR-6730-3p	HITS-CLIP	23824327
MIRT666739	hsa-miR-3660	HITS-CLIP	23824327
MIRT666738	hsa-miR-4526	HITS-CLIP	23824327
MIRT666737	hsa-miR-6719-3p	HITS-CLIP	23824327
MIRT666736	hsa-miR-4635	HITS-CLIP	23824327
MIRT666735	hsa-miR-4786-3p	HITS-CLIP	23824327
MIRT666734	hsa-miR-4297	HITS-CLIP	23824327
MIRT666733	hsa-miR-5581-5p	HITS-CLIP	23824327
MIRT666732	hsa-miR-7111-3p	HITS-CLIP	23824327
MIRT666731	hsa-miR-6780a-3p	HITS-CLIP	23824327
MIRT666730	hsa-miR-6881-3p	HITS-CLIP	23824327
MIRT666729	hsa-miR-7843-3p	HITS-CLIP	23824327
MIRT666728	hsa-miR-127-5p	HITS-CLIP	23824327
MIRT497396	hsa-miR-3622a-3p	PAR-CLIP	22291592
MIRT497395	hsa-miR-3622b-3p	PAR-CLIP	22291592
MIRT497394	hsa-miR-6765-3p	PAR-CLIP	22291592
MIRT497393	hsa-miR-412-3p	PAR-CLIP	22291592
MIRT497392	hsa-miR-6754-3p	PAR-CLIP	22291592
MIRT497391	hsa-miR-938	PAR-CLIP	22291592
MIRT497390	hsa-miR-6886-3p	PAR-CLIP	22291592
MIRT497389	hsa-miR-885-3p	PAR-CLIP	22291592
MIRT497388	hsa-miR-486-3p	PAR-CLIP	22291592
MIRT2085925	hsa-miR-216b	CLIP-seq
MIRT2085926	hsa-miR-339-5p	CLIP-seq
MIRT2085927	hsa-miR-4258	CLIP-seq
MIRT2085928	hsa-miR-4753-3p	CLIP-seq
MIRT2085929	hsa-miR-663b	CLIP-seq
MIRT2311176	hsa-let-7a	CLIP-seq
MIRT2311177	hsa-let-7b	CLIP-seq
MIRT2311178	hsa-let-7c	CLIP-seq
MIRT2311179	hsa-let-7d	CLIP-seq
MIRT2311180	hsa-let-7e	CLIP-seq
MIRT2311181	hsa-let-7f	CLIP-seq
MIRT2311182	hsa-let-7g	CLIP-seq
MIRT2311183	hsa-let-7i	CLIP-seq
MIRT2311184	hsa-miR-122	CLIP-seq
MIRT2311185	hsa-miR-1304	CLIP-seq
MIRT2311186	hsa-miR-1343	CLIP-seq
MIRT2311187	hsa-miR-196a	CLIP-seq
MIRT2311188	hsa-miR-196b	CLIP-seq
MIRT2311189	hsa-miR-3150a-3p	CLIP-seq
MIRT2311190	hsa-miR-3175	CLIP-seq
MIRT2311191	hsa-miR-3192	CLIP-seq
MIRT2085926	hsa-miR-339-5p	CLIP-seq
MIRT2311192	hsa-miR-3675-5p	CLIP-seq
MIRT2085927	hsa-miR-4258	CLIP-seq
MIRT2311193	hsa-miR-4458	CLIP-seq
MIRT2311194	hsa-miR-4500	CLIP-seq
MIRT2311195	hsa-miR-4667-5p	CLIP-seq
MIRT2311196	hsa-miR-4700-5p	CLIP-seq
MIRT2311197	hsa-miR-548ac	CLIP-seq
MIRT2311198	hsa-miR-548d-3p	CLIP-seq
MIRT2311199	hsa-miR-548z	CLIP-seq
MIRT2311200	hsa-miR-661	CLIP-seq
MIRT2085929	hsa-miR-663b	CLIP-seq
MIRT2311201	hsa-miR-939	CLIP-seq
MIRT2311202	hsa-miR-98	CLIP-seq
MIRT2085925	hsa-miR-216b	CLIP-seq
MIRT2393455	hsa-miR-450b-3p	CLIP-seq
MIRT2393456	hsa-miR-4713-3p	CLIP-seq
MIRT2085928	hsa-miR-4753-3p	CLIP-seq
MIRT2393457	hsa-miR-638	CLIP-seq
MIRT2393458	hsa-miR-769-3p	CLIP-seq
MIRT2607516	hsa-miR-1202	CLIP-seq
MIRT2607517	hsa-miR-1238	CLIP-seq
MIRT2607518	hsa-miR-1262	CLIP-seq
MIRT2607519	hsa-miR-1263	CLIP-seq
MIRT2607520	hsa-miR-1275	CLIP-seq
MIRT2311185	hsa-miR-1304	CLIP-seq
MIRT2607521	hsa-miR-296-3p	CLIP-seq
MIRT2607522	hsa-miR-3064-5p	CLIP-seq
MIRT2607523	hsa-miR-3124-3p	CLIP-seq
MIRT2607524	hsa-miR-3194-5p	CLIP-seq
MIRT2607525	hsa-miR-3197	CLIP-seq
MIRT2607526	hsa-miR-3652	CLIP-seq
MIRT2607527	hsa-miR-370	CLIP-seq
MIRT2607528	hsa-miR-3972	CLIP-seq
MIRT2607529	hsa-miR-4430	CLIP-seq
MIRT2607530	hsa-miR-4490	CLIP-seq
MIRT2607531	hsa-miR-4505	CLIP-seq
MIRT2607532	hsa-miR-4525	CLIP-seq
MIRT2607533	hsa-miR-4642	CLIP-seq
MIRT2607534	hsa-miR-4651	CLIP-seq
MIRT2607535	hsa-miR-4665-5p	CLIP-seq
MIRT2607536	hsa-miR-4685-5p	CLIP-seq
MIRT2607537	hsa-miR-4695-5p	CLIP-seq
MIRT2607538	hsa-miR-4701-3p	CLIP-seq
MIRT2607539	hsa-miR-4723-5p	CLIP-seq
MIRT2607540	hsa-miR-4731-5p	CLIP-seq
MIRT2607541	hsa-miR-4774-5p	CLIP-seq
MIRT2607542	hsa-miR-566	CLIP-seq
MIRT2607543	hsa-miR-608	CLIP-seq
MIRT2607544	hsa-miR-625	CLIP-seq
MIRT2607545	hsa-miR-637	CLIP-seq
MIRT2311200	hsa-miR-661	CLIP-seq
MIRT2607546	hsa-miR-765	CLIP-seq
MIRT2607547	hsa-miR-892b	CLIP-seq
MIRT2607516	hsa-miR-1202	CLIP-seq
MIRT2607517	hsa-miR-1238	CLIP-seq
MIRT2607518	hsa-miR-1262	CLIP-seq
MIRT2607519	hsa-miR-1263	CLIP-seq
MIRT2607520	hsa-miR-1275	CLIP-seq
MIRT2311185	hsa-miR-1304	CLIP-seq
MIRT2607521	hsa-miR-296-3p	CLIP-seq
MIRT2607522	hsa-miR-3064-5p	CLIP-seq
MIRT2607523	hsa-miR-3124-3p	CLIP-seq
MIRT2607524	hsa-miR-3194-5p	CLIP-seq
MIRT2607525	hsa-miR-3197	CLIP-seq
MIRT2607526	hsa-miR-3652	CLIP-seq
MIRT2607527	hsa-miR-370	CLIP-seq
MIRT2607528	hsa-miR-3972	CLIP-seq
MIRT2607529	hsa-miR-4430	CLIP-seq
MIRT2607530	hsa-miR-4490	CLIP-seq
MIRT2607531	hsa-miR-4505	CLIP-seq
MIRT2607532	hsa-miR-4525	CLIP-seq
MIRT2607533	hsa-miR-4642	CLIP-seq
MIRT2607534	hsa-miR-4651	CLIP-seq
MIRT2607535	hsa-miR-4665-5p	CLIP-seq
MIRT2607536	hsa-miR-4685-5p	CLIP-seq
MIRT2607537	hsa-miR-4695-5p	CLIP-seq
MIRT2607538	hsa-miR-4701-3p	CLIP-seq
MIRT2607539	hsa-miR-4723-5p	CLIP-seq
MIRT2607540	hsa-miR-4731-5p	CLIP-seq
MIRT2607541	hsa-miR-4774-5p	CLIP-seq
MIRT2607542	hsa-miR-566	CLIP-seq
MIRT2607543	hsa-miR-608	CLIP-seq
MIRT2607544	hsa-miR-625	CLIP-seq
MIRT2607545	hsa-miR-637	CLIP-seq
MIRT2607546	hsa-miR-765	CLIP-seq
MIRT2607547	hsa-miR-892b	CLIP-seq

22 Show/Hide all (22)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	ISS
GO:0000398	Process	MRNA splicing, via spliceosome	IC	11991638
GO:0003676	Function	Nucleic acid binding	IEA
GO:0003712	Function	Transcription coregulator activity	IEA
GO:0003712	Function	Transcription coregulator activity	ISS
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0003723	Function	RNA binding	IBA
GO:0003723	Function	RNA binding	IEA
GO:0003723	Function	RNA binding	TAS	9376072
GO:0005515	Function	Protein binding	IPI	22365833, 22720776, 30021884, 30354839, 33961781, 35271311, 37207277, 39251607
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	22720776
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	9376072
GO:0005681	Component	Spliceosomal complex	IEA
GO:0006397	Process	MRNA processing	IEA
GO:0008380	Process	RNA splicing	IEA
GO:0042632	Process	Cholesterol homeostasis	IEA
GO:0042632	Process	Cholesterol homeostasis	ISS
GO:0071013	Component	Catalytic step 2 spliceosome	IDA	11991638
GO:1990904	Component	Ribonucleoprotein complex	IEA

MIM	HGNC	e!Ensembl
614663	15921	ENSG00000125970

Q9UKM9

Protein name

RNA-binding protein Raly (Autoantigen p542) (Heterogeneous nuclear ribonucleoprotein C-like 2) (hnRNP core protein C-like 2) (hnRNP associated with lethal yellow protein homolog)

Protein function

RNA-binding protein that acts as a transcriptional cofactor for cholesterol biosynthetic genes in the liver. Binds the lipid-responsive non-coding RNA LeXis and is required for LeXis-mediated effect on cholesterogenesis (By similarity). May be a

PDB

1WF1

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00076	RRM_1	23 → 86	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in heart, brain, lung, liver, skeletal muscle, kidney and pancreas. Weakly expressed in placenta. {ECO:0000269|PubMed:10500250}.

Sequence

MSLKLQASNVTNKNDPKSINSRVFIGNLNTALVKKSDVETIFSKYGRVAGCSVHKGYAFV
QYSNERHARAAVLGENGRVLAGQTLDINMAGEPKPDRPKGLKRAASAIYSGYIFDYDYYR
DDFYDRLFDYRGRLSPVPVPRAVPVKRPRVTVPLVRRVKTNVPVKLFARSTAVTTSSAKI
KLKSSELQAIKTELTQIKSNIDALLSRLEQIAAEQKANPDGKKKGDGGGAGGGGGGGGSG
GGGSGGGGGGGSSRPPAPQENTTSEAGLPQGEARTRDDGDEEGLLTHSEEELEHSQDTDA
DDGALQ

Sequence length

306

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (44)
AMPHETAMINE OR RELATED ACTING SYMPATHOMIMETIC ABUSE	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMPHETAMINE-RELATED DISORDERS	—	CTD	18316681	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	36738649	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BASAL CELL CARCINOMA	—	GWAS catalog	27539887, 31174203, 33549134, 38182794, 39024449, 39789286	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BILIARY TRACT CANCER	—	GWAS catalog	27197191, 33893285, 34290314	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	22976474	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	22976474, 27197191, 33893285, 34290314	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANCER	—	GWAS catalog	27197191, 33893285, 34290314	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CERVICAL CARCINOMA	—	GWAS catalog	27197191, 33893285, 34290314	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	27197191, 33893285, 34290314	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CUTANEOUS MELANOMA	—	GWAS catalog	32341527, 39024449	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CUTANEOUS SQUAMOUS CELL CARCINOMA	—	GWAS catalog	27424798, 32041948, 38182794	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DILATED CARDIOMYOPATHY	—	GWAS catalog	29495422	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL CANCER	—	GWAS catalog	27197191, 33893285, 34290314	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ERYTHEMATOSQUAMOUS DERMATOSIS	—	GWAS catalog	39024449	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL CANCER	—	GWAS catalog	27197191, 33893285, 34290314	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN-RECEPTOR NEGATIVE BREAST CANCER	—	GWAS catalog	27197191, 33893285, 34290314	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTRIC CANCER	—	GWAS catalog	27197191, 33893285, 34290314	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATOCELLULAR CARCINOMA	—	GWAS catalog	27197191, 33893285, 34290314	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IDIOPATHIC DILATED CARDIOMYOPATHY	—	GWAS catalog	29495422	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KERATINOCYTE CARCINOMA	—	GWAS catalog	31174203	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	27197191, 33893285, 34290314	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CANCER	—	GWAS catalog	27197191, 33893285, 34290314	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	27197191, 33893285, 34290314	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MELANOMA	—	GWAS catalog	28212542, 32887889, 34290314, 34813871, 39141363	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-HODGKINS LYMPHOMA	—	GWAS catalog	27197191, 33893285, 34290314	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-MELANOMA SKIN CARCINOMA	—	GWAS catalog	29739929, 34290314	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-SMALL CELL LUNG CARCINOMA	—	GWAS catalog	26829030	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CANCER	—	GWAS catalog	27197191, 33893285, 34290314	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	27197191, 33893285, 34290314	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN ENDOMETRIOID CARCINOMA	—	GWAS catalog	27197191, 33893285, 34290314	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN SEROUS CARCINOMA	—	GWAS catalog	27197191, 33893285, 34290314	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATIC CARCINOMA	—	GWAS catalog	27197191, 33893285, 34290314	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	27197191, 33893285, 34290314	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEBACEOUS GLAND DISEASE	—	GWAS catalog	39024449	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEBORRHEIC DERMATITIS	—	GWAS catalog	39024449	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEBORRHEIC KERATOSIS	—	GWAS catalog	39024449	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN CANCER	—	GWAS catalog	34594039, 39024449	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN DISEASE	—	GWAS catalog	39024449	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN NEOPLASM	—	GWAS catalog	34594039, 39024449	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL CARCINOMA	—	GWAS catalog	26829030	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	26829030, 27197191, 33893285, 34290314	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	30054458, 30297969, 32541925, 35551307, 36738649, 38374256, 38685053	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VITILIGO	—	GWAS catalog	27723757	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (43)
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	22118625		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	GWASCAT_DG	27197191		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	GWASCAT_DG	27197191		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	7533789	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	33491460	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Basal Cell Cancer	Basal Cell Neoplasm	GWASCAT_DG	27539887, 31174203		★★★★★ ★☆☆☆☆ Found in Text Mining only
Basal cell carcinoma	Carcinoma	GWASCAT_DG	27539887, 31174203		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Basal Cell Neoplasm	Basal Cell Neoplasm	GWASCAT_DG	27539887, 31174203		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	GWASCAT_DG	22976474, 27197191		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	BEFREE	24325915		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinogenesis	Carcinogenesis	Pubtator	36952348	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	GWASCAT_DG	27197191		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	7533789	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	22118625	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	22118625		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	GWASCAT_DG	27197191		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	22118625	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	GWASCAT_DG	27197191		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	GWASCAT_DG	30054458		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrioid carcinoma ovary	Ovarian endometrioid carcinoma	GWASCAT_DG	27197191		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	31781561		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	30519104		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	36952348	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	7533789	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	GWASDB_DG	22976474		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	24325915		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of large intestine	Colorectal Neoplasms	GWASCAT_DG	27197191		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	28972179		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	GWASCAT_DG	27197191		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	GWASCAT_DG	21983787, 28212542		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	16308470	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	30519104		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	34743649	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	GWASCAT_DG	27197191		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Serous Adenocarcinoma	Ovarian serous adenocarcinoma	GWASCAT_DG	27197191		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	GWASCAT_DG	27197191		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Scleroderma Systemic	Systemic sclerosis	Pubtator	7533789	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin neoplasm	Pubtator	25705849	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	GWASCAT_DG	26829030		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma of lung	Lung carcinoma	GWASCAT_DG	27197191		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	GWASCAT_DG	27424798		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	24325915	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	GWASCAT_DG	27723757		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
SLC45A2	21	["Skin neoplasms","Biliary tract cancer","Cancer","Cervical cancer","Cutaneous squamous cell carcinoma","Endometrial cancer","Erythematosquamous dermatosis","Esophageal cancer","Estrogen-receptor negative breast cancer","Pancreatic cancer","Gastric cancer","Keratinocyte carcinoma"]	[]	24	["GWAS catalog (Basal cell carcinoma)","GWAS catalog (Skin neoplasms)","GWAS catalog (Biliary tract cancer)","GWAS catalog (Cancer)","GWAS catalog (Cervical cancer)","GWAS catalog (Melanoma)","GWAS catalog (Cutaneous squamous cell carcinoma)","GWAS catalog (Endometrial cancer)","GWAS catalog (Erythematosquamous dermatosis)","GWAS catalog (Esophageal cancer)","GWAS catalog (Estrogen-receptor negative breast cancer)","GWAS catalog (Pancreatic cancer)"]
RGS22	14	["Skin neoplasms","Biliary tract cancer","Cancer","Cervical cancer","Endometrial cancer","Esophageal cancer","Estrogen-receptor negative breast cancer","Pancreatic cancer","Gastric cancer","Keratinocyte carcinoma","Non-hodgkins lymphoma","Non-melanoma skin carcinoma"]	[]	16	["GWAS catalog (Basal cell carcinoma)","GWAS catalog (Skin neoplasms)","GWAS catalog (Biliary tract cancer)","GWAS catalog (Cancer)","GWAS catalog (Cervical cancer)","GWAS catalog (Endometrial cancer)","GWAS catalog (Esophageal cancer)","GWAS catalog (Estrogen-receptor negative breast cancer)","GWAS catalog (Pancreatic cancer)","GWAS catalog (Gastric cancer)","GWAS catalog (Hepatocellular carcinoma)","GWAS catalog (Keratinocyte carcinoma)"]
RCC2	14	["Skin neoplasms","Biliary tract cancer","Cancer","Cervical cancer","Endometrial cancer","Esophageal cancer","Estrogen-receptor negative breast cancer","Pancreatic cancer","Gastric cancer","Keratinocyte carcinoma","Non-hodgkins lymphoma","Non-melanoma skin carcinoma"]	[]	17	["GWAS catalog (Basal cell carcinoma)","GWAS catalog (Skin neoplasms)","GWAS catalog (Biliary tract cancer)","GWAS catalog (Cancer)","GWAS catalog (Cervical cancer)","GWAS catalog (Melanoma)","GWAS catalog (Endometrial cancer)","GWAS catalog (Esophageal cancer)","GWAS catalog (Estrogen-receptor negative breast cancer)","GWAS catalog (Pancreatic cancer)","GWAS catalog (Gastric cancer)","GWAS catalog (Hepatocellular carcinoma)"]
BNC2	18	["Skin neoplasms","Biliary tract cancer","Cancer","Cervical cancer","Cutaneous squamous cell carcinoma","Endometrial cancer","Esophageal cancer","Estrogen-receptor negative breast cancer","Pancreatic cancer","Gastric cancer","Keratinocyte carcinoma","Non-hodgkins lymphoma"]	[]	21	["GWAS catalog (Basal cell carcinoma)","GWAS catalog (Skin neoplasms)","GWAS catalog (Biliary tract cancer)","GWAS catalog (Cancer)","GWAS catalog (Cervical cancer)","GWAS catalog (Melanoma)","GWAS catalog (Cutaneous squamous cell carcinoma)","GWAS catalog (Endometrial cancer)","GWAS catalog (Esophageal cancer)","GWAS catalog (Estrogen-receptor negative breast cancer)","GWAS catalog (Pancreatic cancer)","GWAS catalog (Gastric cancer)"]
RHOU	14	["Skin neoplasms","Biliary tract cancer","Cancer","Cervical cancer","Endometrial cancer","Esophageal cancer","Estrogen-receptor negative breast cancer","Pancreatic cancer","Gastric cancer","Keratinocyte carcinoma","Non-hodgkins lymphoma","Non-melanoma skin carcinoma"]	[]	17	["GWAS catalog (Basal cell carcinoma)","GWAS catalog (Skin neoplasms)","GWAS catalog (Biliary tract cancer)","GWAS catalog (Cancer)","GWAS catalog (Cervical cancer)","GWAS catalog (Melanoma)","GWAS catalog (Endometrial cancer)","GWAS catalog (Esophageal cancer)","GWAS catalog (Estrogen-receptor negative breast cancer)","GWAS catalog (Pancreatic cancer)","GWAS catalog (Gastric cancer)","GWAS catalog (Hepatocellular carcinoma)"]

RALY (RALY heterogeneous nuclear ribonucleoprotein)

Save This Analysis