Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	58480
Gene name	Ras homolog family member U
Gene symbol	RHOU
Synonyms (NCBI Gene)	ARHUCDC42L1G28KWRCH1hG28K
Chromosome	1
Chromosome location	1q42.13
Summary	This gene encodes a member of the Rho family of GTPases. This protein can activate PAK1 and JNK1, and can induce filopodium formation and stress fiber dissolution. It may also mediate the effects of WNT1 signaling in the regulation of cell morphology, cyt

166 Show/Hide all (166)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016073	hsa-miR-374b-5p	Sequencing	20371350
MIRT053454	hsa-miR-452-5p	Microarray	23807165
MIRT438574	hsa-miR-126-3p	Luciferase reporter assayqRT-PCRWestern blot	23811937
MIRT438574	hsa-miR-126-3p	Luciferase reporter assayqRT-PCRWestern blot	23811937
MIRT1306083	hsa-miR-1279	CLIP-seq
MIRT1306084	hsa-miR-129-5p	CLIP-seq
MIRT1306085	hsa-miR-1304	CLIP-seq
MIRT1306086	hsa-miR-134	CLIP-seq
MIRT1306087	hsa-miR-2467-3p	CLIP-seq
MIRT1306088	hsa-miR-2682	CLIP-seq
MIRT1306089	hsa-miR-3118	CLIP-seq
MIRT1306090	hsa-miR-3121-3p	CLIP-seq
MIRT1306091	hsa-miR-3164	CLIP-seq
MIRT1306092	hsa-miR-329	CLIP-seq
MIRT1306093	hsa-miR-330-3p	CLIP-seq
MIRT1306094	hsa-miR-337-3p	CLIP-seq
MIRT1306095	hsa-miR-3609	CLIP-seq
MIRT1306096	hsa-miR-362-3p	CLIP-seq
MIRT1306097	hsa-miR-3659	CLIP-seq
MIRT1306098	hsa-miR-3674	CLIP-seq
MIRT1306099	hsa-miR-3691-5p	CLIP-seq
MIRT1306100	hsa-miR-369-3p	CLIP-seq
MIRT1306101	hsa-miR-374a	CLIP-seq
MIRT1306102	hsa-miR-374b	CLIP-seq
MIRT1306103	hsa-miR-374c	CLIP-seq
MIRT1306104	hsa-miR-3908	CLIP-seq
MIRT1306105	hsa-miR-3941	CLIP-seq
MIRT1306106	hsa-miR-3942-5p	CLIP-seq
MIRT1306107	hsa-miR-4257	CLIP-seq
MIRT1306108	hsa-miR-4268	CLIP-seq
MIRT1306109	hsa-miR-4330	CLIP-seq
MIRT1306110	hsa-miR-4427	CLIP-seq
MIRT1306111	hsa-miR-4455	CLIP-seq
MIRT1306112	hsa-miR-449c	CLIP-seq
MIRT1306113	hsa-miR-4501	CLIP-seq
MIRT1306114	hsa-miR-4639-3p	CLIP-seq
MIRT1306115	hsa-miR-4653-3p	CLIP-seq
MIRT1306116	hsa-miR-4658	CLIP-seq
MIRT1306117	hsa-miR-4680-3p	CLIP-seq
MIRT1306118	hsa-miR-4703-5p	CLIP-seq
MIRT1306119	hsa-miR-4711-3p	CLIP-seq
MIRT1306120	hsa-miR-4752	CLIP-seq
MIRT1306121	hsa-miR-4764-5p	CLIP-seq
MIRT1306122	hsa-miR-4766-3p	CLIP-seq
MIRT1306123	hsa-miR-4778-3p	CLIP-seq
MIRT1306124	hsa-miR-4781-3p	CLIP-seq
MIRT1306125	hsa-miR-4789-5p	CLIP-seq
MIRT1306126	hsa-miR-4797-5p	CLIP-seq
MIRT1306127	hsa-miR-548ah	CLIP-seq
MIRT1306128	hsa-miR-548t	CLIP-seq
MIRT1306129	hsa-miR-574-5p	CLIP-seq
MIRT1306130	hsa-miR-576-5p	CLIP-seq
MIRT1306131	hsa-miR-603	CLIP-seq
MIRT1306132	hsa-miR-607	CLIP-seq
MIRT1306133	hsa-miR-609	CLIP-seq
MIRT1306134	hsa-miR-648	CLIP-seq
MIRT1306135	hsa-miR-655	CLIP-seq
MIRT1306136	hsa-miR-759	CLIP-seq
MIRT1306137	hsa-miR-877	CLIP-seq
MIRT1306138	hsa-miR-889	CLIP-seq
MIRT1306139	hsa-miR-9	CLIP-seq
MIRT1306140	hsa-miR-940	CLIP-seq
MIRT2090668	hsa-miR-1200	CLIP-seq
MIRT2090669	hsa-miR-1208	CLIP-seq
MIRT2090670	hsa-miR-1256	CLIP-seq
MIRT1306084	hsa-miR-129-5p	CLIP-seq
MIRT2090671	hsa-miR-1297	CLIP-seq
MIRT2090672	hsa-miR-1976	CLIP-seq
MIRT2090673	hsa-miR-26a	CLIP-seq
MIRT2090674	hsa-miR-26b	CLIP-seq
MIRT2090675	hsa-miR-3065-5p	CLIP-seq
MIRT2090676	hsa-miR-3157-5p	CLIP-seq
MIRT2090677	hsa-miR-3163	CLIP-seq
MIRT2090678	hsa-miR-3171	CLIP-seq
MIRT2090679	hsa-miR-335	CLIP-seq
MIRT2090680	hsa-miR-340	CLIP-seq
MIRT2090681	hsa-miR-3714	CLIP-seq
MIRT2090682	hsa-miR-3914	CLIP-seq
MIRT2090683	hsa-miR-3924	CLIP-seq
MIRT2090684	hsa-miR-421	CLIP-seq
MIRT2090685	hsa-miR-4279	CLIP-seq
MIRT2090686	hsa-miR-4324	CLIP-seq
MIRT2090687	hsa-miR-4420	CLIP-seq
MIRT1306110	hsa-miR-4427	CLIP-seq
MIRT2090688	hsa-miR-4465	CLIP-seq
MIRT1306117	hsa-miR-4680-3p	CLIP-seq
MIRT2090689	hsa-miR-4691-3p	CLIP-seq
MIRT2090690	hsa-miR-4695-3p	CLIP-seq
MIRT2090691	hsa-miR-4703-3p	CLIP-seq
MIRT2090692	hsa-miR-4709-5p	CLIP-seq
MIRT2090693	hsa-miR-4729	CLIP-seq
MIRT2090694	hsa-miR-4762-3p	CLIP-seq
MIRT2090695	hsa-miR-4796-3p	CLIP-seq
MIRT2090696	hsa-miR-498	CLIP-seq
MIRT2090697	hsa-miR-515-5p	CLIP-seq
MIRT2090698	hsa-miR-520g	CLIP-seq
MIRT2090699	hsa-miR-520h	CLIP-seq
MIRT2090700	hsa-miR-543	CLIP-seq
MIRT2090701	hsa-miR-544b	CLIP-seq
MIRT2090702	hsa-miR-548a-3p	CLIP-seq
MIRT2090703	hsa-miR-548an	CLIP-seq
MIRT2090704	hsa-miR-548e	CLIP-seq
MIRT2090705	hsa-miR-548f	CLIP-seq
MIRT2090706	hsa-miR-570	CLIP-seq
MIRT2090707	hsa-miR-582-3p	CLIP-seq
MIRT2090708	hsa-miR-668	CLIP-seq
MIRT2090709	hsa-miR-767-3p	CLIP-seq
MIRT2090710	hsa-miR-873	CLIP-seq
MIRT2315371	hsa-miR-1179	CLIP-seq
MIRT2090669	hsa-miR-1208	CLIP-seq
MIRT2090671	hsa-miR-1297	CLIP-seq
MIRT2315372	hsa-miR-1305	CLIP-seq
MIRT2315373	hsa-miR-2054	CLIP-seq
MIRT2090673	hsa-miR-26a	CLIP-seq
MIRT2090674	hsa-miR-26b	CLIP-seq
MIRT2090677	hsa-miR-3163	CLIP-seq
MIRT2090680	hsa-miR-340	CLIP-seq
MIRT2315374	hsa-miR-3647-3p	CLIP-seq
MIRT1306097	hsa-miR-3659	CLIP-seq
MIRT2315375	hsa-miR-3692	CLIP-seq
MIRT2090681	hsa-miR-3714	CLIP-seq
MIRT2315376	hsa-miR-3919	CLIP-seq
MIRT2090683	hsa-miR-3924	CLIP-seq
MIRT1306106	hsa-miR-3942-5p	CLIP-seq
MIRT2090687	hsa-miR-4420	CLIP-seq
MIRT1306111	hsa-miR-4455	CLIP-seq
MIRT2315377	hsa-miR-4459	CLIP-seq
MIRT2090688	hsa-miR-4465	CLIP-seq
MIRT2315378	hsa-miR-4484	CLIP-seq
MIRT2315379	hsa-miR-4509	CLIP-seq
MIRT1306116	hsa-miR-4658	CLIP-seq
MIRT2315380	hsa-miR-4668-3p	CLIP-seq
MIRT2315381	hsa-miR-4699-3p	CLIP-seq
MIRT1306118	hsa-miR-4703-5p	CLIP-seq
MIRT2315382	hsa-miR-4722-5p	CLIP-seq
MIRT2090693	hsa-miR-4729	CLIP-seq
MIRT2315383	hsa-miR-4766-5p	CLIP-seq
MIRT2090696	hsa-miR-498	CLIP-seq
MIRT2315384	hsa-miR-513a-5p	CLIP-seq
MIRT2090700	hsa-miR-543	CLIP-seq
MIRT2090703	hsa-miR-548an	CLIP-seq
MIRT1306129	hsa-miR-574-5p	CLIP-seq
MIRT2315385	hsa-miR-581	CLIP-seq
MIRT1306133	hsa-miR-609	CLIP-seq
MIRT1306134	hsa-miR-648	CLIP-seq
MIRT2090709	hsa-miR-767-3p	CLIP-seq
MIRT1306140	hsa-miR-940	CLIP-seq
MIRT2393740	hsa-miR-1238	CLIP-seq
MIRT2393741	hsa-miR-3124-3p	CLIP-seq
MIRT2393742	hsa-miR-3160-5p	CLIP-seq
MIRT2393743	hsa-miR-4304	CLIP-seq
MIRT2393744	hsa-miR-4449	CLIP-seq
MIRT1306111	hsa-miR-4455	CLIP-seq
MIRT2315378	hsa-miR-4484	CLIP-seq
MIRT2393745	hsa-miR-4691-5p	CLIP-seq
MIRT2090703	hsa-miR-548an	CLIP-seq
MIRT1306129	hsa-miR-574-5p	CLIP-seq
MIRT1306133	hsa-miR-609	CLIP-seq
MIRT1306134	hsa-miR-648	CLIP-seq
MIRT2458214	hsa-miR-1245b-5p	CLIP-seq
MIRT2458215	hsa-miR-185	CLIP-seq
MIRT2458216	hsa-miR-3142	CLIP-seq
MIRT2458217	hsa-miR-4306	CLIP-seq
MIRT2458218	hsa-miR-4493	CLIP-seq
MIRT2458219	hsa-miR-4644	CLIP-seq
MIRT2458220	hsa-miR-516b	CLIP-seq

39 Show/Hide all (39)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000082	Process	G1/S transition of mitotic cell cycle	IEA
GO:0000139	Component	Golgi membrane	IEA
GO:0000166	Function	Nucleotide binding	IEA
GO:0002102	Component	Podosome	IEA
GO:0003924	Function	GTPase activity	IBA
GO:0003924	Function	GTPase activity	IEA
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	TAS
GO:0005515	Function	Protein binding	IPI	14521508, 15350535, 16752908, 18086875, 21565175, 26598620
GO:0005525	Function	GTP binding	IBA
GO:0005525	Function	GTP binding	IEA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005925	Component	Focal adhesion	IDA	26598620
GO:0005925	Component	Focal adhesion	IEA
GO:0006897	Process	Endocytosis	IBA
GO:0007010	Process	Cytoskeleton organization	IEA
GO:0007010	Process	Cytoskeleton organization	IMP	21834987
GO:0007015	Process	Actin filament organization	IBA
GO:0007165	Process	Signal transduction	IBA
GO:0007264	Process	Small GTPase-mediated signal transduction	IEA
GO:0008360	Process	Regulation of cell shape	IEA
GO:0008360	Process	Regulation of cell shape	IEA
GO:0008360	Process	Regulation of cell shape	IMP	21834987
GO:0010008	Component	Endosome membrane	TAS
GO:0016020	Component	Membrane	IEA
GO:0016601	Process	Rac protein signal transduction	IEA
GO:0019901	Function	Protein kinase binding	IBA
GO:0030010	Process	Establishment of cell polarity	IBA
GO:0030036	Process	Actin cytoskeleton organization	IEA
GO:0030674	Function	Protein-macromolecule adaptor activity	IMP	26598620
GO:0042995	Component	Cell projection	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0051056	Process	Regulation of small GTPase mediated signal transduction	TAS
GO:0070161	Component	Anchoring junction	IEA
GO:0120183	Process	Positive regulation of focal adhesion disassembly	IMP	26598620
GO:1903955	Process	Positive regulation of protein targeting to mitochondrion	HMP	24270810

MIM	HGNC	e!Ensembl
606366	17794	ENSG00000116574

Q7L0Q8

Protein name

Rho-related GTP-binding protein RhoU (CDC42-like GTPase 1) (GTP-binding protein-like 1) (Rho GTPase-like protein ARHU) (Ryu GTPase) (Wnt-1 responsive Cdc42 homolog 1) (WRCH-1)

Protein function

Binds to and activates protein kinase PAK1 (PubMed:11459829). Plays a role in the regulation of cell morphology, cytoskeletal organization and focal adhesion assembly during cell migration (PubMed:11459829, PubMed:17620058, PubMed:18086875, PubM

PDB

2Q3H

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00071	Ras	51 → 223	Ras family	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitously expressed in all tissues examined. Expressed at high levels in the stomach, small intestine, brain, skeletal muscle and placenta. {ECO:0000269|PubMed:11459829, ECO:0000269|PubMed:14731133}.

Sequence

MPPQQGDPAFPDRCEAPPVPPRRERGGRGGRGPGEPGGRGRAGGAEGRGVKCVLVGDGAV
GKTSLVVSYTTNGYPTEYIPTAFDNFSAVVSVDGRPVRLQLCDTAGQDEFDKLRPLCYTN
TDIFLLCFSVVSPSSFQNVSEKWVPEIRCHCPKAPIILVGTQSDLREDVKVLIELDKCKE
KPVPEEAAKLCAEEIKAASYIECSALTQKNLKEVFDAAIVAGIQYSDTQQQPKKSKSRTP
DKMKNLSKSWWKKYCCFV

Sequence length

258

Interactions

View interactions

Reactome Pathway
Rho GTPase cycle
Interleukin-4 and Interleukin-13 signaling

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (34)
ALZHEIMER DISEASE	—	GWAS catalog	39998322	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTROCYTOMA	—	GWAS catalog	36810956	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BASAL CELL CARCINOMA	—	GWAS catalog	18849993, 24403052, 25855136, 27539887, 31174203, 33549134, 38182794, 39024449, 39789286	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BILIARY TRACT CANCER	—	GWAS catalog	34290314	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	34290314	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANCER	—	GWAS catalog	34290314	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CERVICAL CARCINOMA	—	GWAS catalog	34290314	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC LYMPHOCYTIC LEUKEMIA	—	GWAS catalog	28165464	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	34290314	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CUTANEOUS MELANOMA	—	GWAS catalog	39024449	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL CANCER	—	GWAS catalog	34290314	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	GWAS catalog	20844546	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EOSINOPHILIC ESOPHAGITIS	—	GWAS catalog	36400179	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL CANCER	—	GWAS catalog	34290314	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN-RECEPTOR NEGATIVE BREAST CANCER	—	GWAS catalog	34290314	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTRIC CANCER	—	GWAS catalog	34290314	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATOCELLULAR CARCINOMA	—	GWAS catalog	34290314	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	30804565	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KERATINOCYTE CARCINOMA	—	GWAS catalog	31174203	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	34290314	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CANCER	—	GWAS catalog	34290314	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	34290314	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-HODGKINS LYMPHOMA	—	GWAS catalog	34290314	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-MELANOMA SKIN CARCINOMA	—	GWAS catalog	29739929, 34290314	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CANCER	—	GWAS catalog	34290314	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	34290314	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN ENDOMETRIOID CARCINOMA	—	GWAS catalog	34290314	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN SEROUS CARCINOMA	—	GWAS catalog	34290314	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATIC CARCINOMA	—	GWAS catalog	34290314	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	34290314	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN CANCER	—	GWAS catalog	34594039, 39024449	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN NEOPLASM	—	GWAS catalog	34594039, 39024449	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	34290314	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	23300278	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (26)
Carcinogenesis	Carcinogenesis	Pubtator	19567454	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	25227856		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	24709777	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	25137373	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	24709777, 25137373	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	25137373		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	GWASCAT_DG	28165464		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congestive heart failure	Congestive Heart Failure	BEFREE	24709777		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	36221055	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	36221055	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	24709777		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic cardiomyopathy	Ischemic myocardial dysfunction	BEFREE	25137373		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	BEFREE	11894124		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	19567454	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	25428027	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	27196083		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11894124		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	11894124		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	28510328	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	29440639	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	29440639		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	21508312	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	27196083		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	27196083, 32139877	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Lymphocytic Lymphoma	Lymphocytic Leukemia	GWASCAT_DG	28165464		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cancer	Endometrial Cancer	BEFREE	11894124		★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
RGS22	14	["Skin neoplasms","Biliary tract cancer","Cancer","Cervical cancer","Endometrial cancer","Esophageal cancer","Estrogen-receptor negative breast cancer","Pancreatic cancer","Gastric cancer","Keratinocyte carcinoma","Non-hodgkins lymphoma","Non-melanoma skin carcinoma"]	[]	16	["GWAS catalog (Basal cell carcinoma)","GWAS catalog (Skin neoplasms)","GWAS catalog (Biliary tract cancer)","GWAS catalog (Cancer)","GWAS catalog (Cervical cancer)","GWAS catalog (Endometrial cancer)","GWAS catalog (Esophageal cancer)","GWAS catalog (Estrogen-receptor negative breast cancer)","GWAS catalog (Pancreatic cancer)","GWAS catalog (Gastric cancer)","GWAS catalog (Hepatocellular carcinoma)","GWAS catalog (Keratinocyte carcinoma)"]
RCC2	14	["Skin neoplasms","Biliary tract cancer","Cancer","Cervical cancer","Endometrial cancer","Esophageal cancer","Estrogen-receptor negative breast cancer","Pancreatic cancer","Gastric cancer","Keratinocyte carcinoma","Non-hodgkins lymphoma","Non-melanoma skin carcinoma"]	[]	17	["GWAS catalog (Basal cell carcinoma)","GWAS catalog (Skin neoplasms)","GWAS catalog (Biliary tract cancer)","GWAS catalog (Cancer)","GWAS catalog (Cervical cancer)","GWAS catalog (Melanoma)","GWAS catalog (Endometrial cancer)","GWAS catalog (Esophageal cancer)","GWAS catalog (Estrogen-receptor negative breast cancer)","GWAS catalog (Pancreatic cancer)","GWAS catalog (Gastric cancer)","GWAS catalog (Hepatocellular carcinoma)"]
SMC2	14	["Skin neoplasms","Biliary tract cancer","Cancer","Cervical cancer","Endometrial cancer","Esophageal cancer","Estrogen-receptor negative breast cancer","Pancreatic cancer","Gastric cancer","Keratinocyte carcinoma","Non-hodgkins lymphoma","Non-melanoma skin carcinoma"]	[]	16	["GWAS catalog (Basal cell carcinoma)","GWAS catalog (Skin neoplasms)","GWAS catalog (Biliary tract cancer)","GWAS catalog (Cancer)","GWAS catalog (Cervical cancer)","GWAS catalog (Endometrial cancer)","GWAS catalog (Esophageal cancer)","GWAS catalog (Estrogen-receptor negative breast cancer)","GWAS catalog (Pancreatic cancer)","GWAS catalog (Gastric cancer)","GWAS catalog (Hepatocellular carcinoma)","GWAS catalog (Keratinocyte carcinoma)"]
TGM3	14	["Skin neoplasms","Biliary tract cancer","Cancer","Cervical cancer","Endometrial cancer","Esophageal cancer","Estrogen-receptor negative breast cancer","Pancreatic cancer","Gastric cancer","Keratinocyte carcinoma","Non-hodgkins lymphoma","Non-melanoma skin carcinoma"]	[]	17	["GWAS catalog (Basal cell carcinoma)","GWAS catalog (Skin neoplasms)","GWAS catalog (Biliary tract cancer)","GWAS catalog (Cancer)","GWAS catalog (Cervical cancer)","GWAS catalog (Melanoma)","GWAS catalog (Endometrial cancer)","GWAS catalog (Esophageal cancer)","GWAS catalog (Estrogen-receptor negative breast cancer)","GWAS catalog (Pancreatic cancer)","GWAS catalog (Gastric cancer)","GWAS catalog (Hepatocellular carcinoma)"]
ZNF276	12	["Biliary tract cancer","Cancer","Cervical cancer","Endometrial cancer","Esophageal cancer","Estrogen-receptor negative breast cancer","Pancreatic cancer","Gastric cancer","Keratinocyte carcinoma","Non-hodgkins lymphoma","Non-melanoma skin carcinoma","Ovarian serous carcinoma"]	[]	15	["GWAS catalog (Basal cell carcinoma)","GWAS catalog (Biliary tract cancer)","GWAS catalog (Cancer)","GWAS catalog (Cervical cancer)","GWAS catalog (Melanoma)","GWAS catalog (Endometrial cancer)","GWAS catalog (Esophageal cancer)","GWAS catalog (Estrogen-receptor negative breast cancer)","GWAS catalog (Pancreatic cancer)","GWAS catalog (Gastric cancer)","GWAS catalog (Hepatocellular carcinoma)","GWAS catalog (Keratinocyte carcinoma)"]

RHOU (ras homolog family member U)

Bookmark This Gene