Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	10592
Gene name	Structural maintenance of chromosomes 2
Gene symbol	SMC2
Synonyms (NCBI Gene)	CAP-ECAPESMC-2SMC2L1
Chromosome	9
Chromosome location	9q31.1

174 Show/Hide all (174)

miRTarBase ID	miRNA	Experiments	Reference
MIRT024482	hsa-miR-215-5p	Microarray	19074876
MIRT026232	hsa-miR-192-5p	Microarray	19074876
MIRT046008	hsa-miR-125b-5p	CLASH	23622248
MIRT722085	hsa-miR-2681-3p	HITS-CLIP	19536157
MIRT722084	hsa-miR-96-3p	HITS-CLIP	19536157
MIRT722083	hsa-miR-5690	HITS-CLIP	19536157
MIRT722082	hsa-miR-4729	HITS-CLIP	19536157
MIRT722081	hsa-miR-4502	HITS-CLIP	19536157
MIRT722080	hsa-miR-383-5p	HITS-CLIP	19536157
MIRT722079	hsa-miR-4772-5p	HITS-CLIP	19536157
MIRT722078	hsa-miR-3682-3p	HITS-CLIP	19536157
MIRT722077	hsa-miR-221-3p	HITS-CLIP	19536157
MIRT722076	hsa-miR-222-3p	HITS-CLIP	19536157
MIRT722075	hsa-miR-374a-3p	HITS-CLIP	19536157
MIRT699146	hsa-miR-6865-3p	HITS-CLIP	23313552
MIRT699145	hsa-miR-3620-3p	HITS-CLIP	23313552
MIRT699144	hsa-miR-483-3p	HITS-CLIP	23313552
MIRT699143	hsa-miR-4732-3p	HITS-CLIP	23313552
MIRT699142	hsa-miR-125a-5p	HITS-CLIP	23313552
MIRT046008	hsa-miR-125b-5p	HITS-CLIP	23313552
MIRT699141	hsa-miR-4319	HITS-CLIP	23313552
MIRT699140	hsa-miR-6730-3p	HITS-CLIP	23313552
MIRT699139	hsa-miR-4742-3p	HITS-CLIP	23313552
MIRT699138	hsa-miR-3117-5p	HITS-CLIP	23313552
MIRT699137	hsa-miR-496	HITS-CLIP	23313552
MIRT699136	hsa-miR-3685	HITS-CLIP	23313552
MIRT439584	ebv-miR-BART4-5p	HITS-CLIP	22473208
MIRT439584	ebv-miR-BART4-5p	HITS-CLIP	22473208
MIRT722085	hsa-miR-2681-3p	HITS-CLIP	19536157
MIRT722084	hsa-miR-96-3p	HITS-CLIP	19536157
MIRT722083	hsa-miR-5690	HITS-CLIP	19536157
MIRT722082	hsa-miR-4729	HITS-CLIP	19536157
MIRT722081	hsa-miR-4502	HITS-CLIP	19536157
MIRT722080	hsa-miR-383-5p	HITS-CLIP	19536157
MIRT722079	hsa-miR-4772-5p	HITS-CLIP	19536157
MIRT722078	hsa-miR-3682-3p	HITS-CLIP	19536157
MIRT722077	hsa-miR-221-3p	HITS-CLIP	19536157
MIRT722076	hsa-miR-222-3p	HITS-CLIP	19536157
MIRT722075	hsa-miR-374a-3p	HITS-CLIP	19536157
MIRT699146	hsa-miR-6865-3p	HITS-CLIP	23313552
MIRT699145	hsa-miR-3620-3p	HITS-CLIP	23313552
MIRT699144	hsa-miR-483-3p	HITS-CLIP	23313552
MIRT699143	hsa-miR-4732-3p	HITS-CLIP	23313552
MIRT699142	hsa-miR-125a-5p	HITS-CLIP	23313552
MIRT046008	hsa-miR-125b-5p	HITS-CLIP	23313552
MIRT699141	hsa-miR-4319	HITS-CLIP	23313552
MIRT699140	hsa-miR-6730-3p	HITS-CLIP	23313552
MIRT699139	hsa-miR-4742-3p	HITS-CLIP	23313552
MIRT699138	hsa-miR-3117-5p	HITS-CLIP	23313552
MIRT699137	hsa-miR-496	HITS-CLIP	23313552
MIRT699136	hsa-miR-3685	HITS-CLIP	23313552
MIRT1372345	hsa-miR-103a	CLIP-seq
MIRT1372346	hsa-miR-107	CLIP-seq
MIRT1372347	hsa-miR-1228	CLIP-seq
MIRT1372348	hsa-miR-1299	CLIP-seq
MIRT1372349	hsa-miR-1301	CLIP-seq
MIRT1372350	hsa-miR-1915	CLIP-seq
MIRT1372351	hsa-miR-3153	CLIP-seq
MIRT1372352	hsa-miR-3179	CLIP-seq
MIRT1372353	hsa-miR-329	CLIP-seq
MIRT1372354	hsa-miR-362-3p	CLIP-seq
MIRT1372355	hsa-miR-3918	CLIP-seq
MIRT1372356	hsa-miR-3924	CLIP-seq
MIRT1372357	hsa-miR-3929	CLIP-seq
MIRT1372358	hsa-miR-3942-3p	CLIP-seq
MIRT1372359	hsa-miR-4419b	CLIP-seq
MIRT1372360	hsa-miR-4434	CLIP-seq
MIRT1372361	hsa-miR-4478	CLIP-seq
MIRT1372362	hsa-miR-4499	CLIP-seq
MIRT1372363	hsa-miR-4513	CLIP-seq
MIRT1372364	hsa-miR-4516	CLIP-seq
MIRT1372365	hsa-miR-4531	CLIP-seq
MIRT1372366	hsa-miR-4640-5p	CLIP-seq
MIRT1372367	hsa-miR-4668-5p	CLIP-seq
MIRT1372368	hsa-miR-4685-5p	CLIP-seq
MIRT1372369	hsa-miR-4726-5p	CLIP-seq
MIRT1372370	hsa-miR-4782-5p	CLIP-seq
MIRT1372371	hsa-miR-4802-5p	CLIP-seq
MIRT1372372	hsa-miR-495	CLIP-seq
MIRT1372373	hsa-miR-5047	CLIP-seq
MIRT1372374	hsa-miR-513a-3p	CLIP-seq
MIRT1372375	hsa-miR-516b	CLIP-seq
MIRT1372376	hsa-miR-548c-3p	CLIP-seq
MIRT1372377	hsa-miR-577	CLIP-seq
MIRT1372378	hsa-miR-922	CLIP-seq
MIRT1372379	hsa-miR-129-5p	CLIP-seq
MIRT1372348	hsa-miR-1299	CLIP-seq
MIRT1372380	hsa-miR-133a	CLIP-seq
MIRT1372381	hsa-miR-133b	CLIP-seq
MIRT1372382	hsa-miR-145	CLIP-seq
MIRT1372383	hsa-miR-3140-3p	CLIP-seq
MIRT1372384	hsa-miR-3140-5p	CLIP-seq
MIRT1372385	hsa-miR-3145-3p	CLIP-seq
MIRT1372386	hsa-miR-3149	CLIP-seq
MIRT1372387	hsa-miR-374a	CLIP-seq
MIRT1372388	hsa-miR-374b	CLIP-seq
MIRT1372362	hsa-miR-4499	CLIP-seq
MIRT1372363	hsa-miR-4513	CLIP-seq
MIRT1372389	hsa-miR-4686	CLIP-seq
MIRT1372370	hsa-miR-4782-5p	CLIP-seq
MIRT1372390	hsa-miR-513c	CLIP-seq
MIRT1372391	hsa-miR-514b-5p	CLIP-seq
MIRT1372375	hsa-miR-516b	CLIP-seq
MIRT1372392	hsa-miR-548ad	CLIP-seq
MIRT1372393	hsa-miR-548n	CLIP-seq
MIRT1372394	hsa-miR-548t	CLIP-seq
MIRT1372395	hsa-miR-561	CLIP-seq
MIRT1372396	hsa-miR-568	CLIP-seq
MIRT1372397	hsa-miR-664	CLIP-seq
MIRT1372398	hsa-miR-935	CLIP-seq
MIRT2110564	hsa-miR-1243	CLIP-seq
MIRT2110565	hsa-miR-1246	CLIP-seq
MIRT2110566	hsa-miR-125b	CLIP-seq
MIRT2110567	hsa-miR-144	CLIP-seq
MIRT2110568	hsa-miR-154	CLIP-seq
MIRT2110569	hsa-miR-181a	CLIP-seq
MIRT2110570	hsa-miR-181b	CLIP-seq
MIRT2110571	hsa-miR-181c	CLIP-seq
MIRT2110572	hsa-miR-181d	CLIP-seq
MIRT2110573	hsa-miR-2053	CLIP-seq
MIRT2110574	hsa-miR-223	CLIP-seq
MIRT2110575	hsa-miR-3074-3p	CLIP-seq
MIRT2110576	hsa-miR-3129-3p	CLIP-seq
MIRT2110577	hsa-miR-3134	CLIP-seq
MIRT1372385	hsa-miR-3145-3p	CLIP-seq
MIRT2110578	hsa-miR-3180-5p	CLIP-seq
MIRT2110579	hsa-miR-337-5p	CLIP-seq
MIRT2110580	hsa-miR-338-5p	CLIP-seq
MIRT2110581	hsa-miR-3620	CLIP-seq
MIRT2110582	hsa-miR-3657	CLIP-seq
MIRT2110583	hsa-miR-384	CLIP-seq
MIRT2110584	hsa-miR-3914	CLIP-seq
MIRT2110585	hsa-miR-410	CLIP-seq
MIRT2110586	hsa-miR-4262	CLIP-seq
MIRT2110587	hsa-miR-4275	CLIP-seq
MIRT2110588	hsa-miR-4276	CLIP-seq
MIRT2110589	hsa-miR-4424	CLIP-seq
MIRT2110590	hsa-miR-4477a	CLIP-seq
MIRT2110591	hsa-miR-4669	CLIP-seq
MIRT2110592	hsa-miR-4697-3p	CLIP-seq
MIRT2110593	hsa-miR-4699-3p	CLIP-seq
MIRT2110594	hsa-miR-4709-5p	CLIP-seq
MIRT2110595	hsa-miR-4777-3p	CLIP-seq
MIRT2110596	hsa-miR-498	CLIP-seq
MIRT2110597	hsa-miR-500a	CLIP-seq
MIRT2110598	hsa-miR-501-5p	CLIP-seq
MIRT2110599	hsa-miR-520a-5p	CLIP-seq
MIRT2110600	hsa-miR-525-5p	CLIP-seq
MIRT1372393	hsa-miR-548n	CLIP-seq
MIRT1372394	hsa-miR-548t	CLIP-seq
MIRT1372395	hsa-miR-561	CLIP-seq
MIRT2110601	hsa-miR-569	CLIP-seq
MIRT2110602	hsa-miR-578	CLIP-seq
MIRT1372397	hsa-miR-664	CLIP-seq
MIRT2110603	hsa-miR-889	CLIP-seq
MIRT2110604	hsa-miR-944	CLIP-seq
MIRT2110569	hsa-miR-181a	CLIP-seq
MIRT2110570	hsa-miR-181b	CLIP-seq
MIRT2110571	hsa-miR-181c	CLIP-seq
MIRT2110572	hsa-miR-181d	CLIP-seq
MIRT2110573	hsa-miR-2053	CLIP-seq
MIRT1372385	hsa-miR-3145-3p	CLIP-seq
MIRT2110583	hsa-miR-384	CLIP-seq
MIRT2110586	hsa-miR-4262	CLIP-seq
MIRT2110602	hsa-miR-578	CLIP-seq
MIRT2691449	hsa-miR-1276	CLIP-seq
MIRT2691450	hsa-miR-186	CLIP-seq
MIRT1372350	hsa-miR-1915	CLIP-seq
MIRT2691451	hsa-miR-3133	CLIP-seq
MIRT1372355	hsa-miR-3918	CLIP-seq
MIRT2691452	hsa-miR-4495	CLIP-seq
MIRT1372366	hsa-miR-4640-5p	CLIP-seq
MIRT1372368	hsa-miR-4685-5p	CLIP-seq
MIRT1372369	hsa-miR-4726-5p	CLIP-seq

46 Show/Hide all (46)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000228	Component	Nuclear chromosome	IDA	10958694
GO:0000228	Component	Nuclear chromosome	IEA
GO:0000280	Process	Nuclear division	IEA
GO:0000785	Component	Chromatin	IBA
GO:0000793	Component	Condensed chromosome	IBA
GO:0000793	Component	Condensed chromosome	IDA	12589063
GO:0000793	Component	Condensed chromosome	IEA
GO:0000794	Component	Condensed nuclear chromosome	IEA
GO:0000794	Component	Condensed nuclear chromosome	ISO
GO:0000796	Component	Condensin complex	IBA
GO:0000796	Component	Condensin complex	IDA	9789013, 10958694, 11136719
GO:0000796	Component	Condensin complex	IEA
GO:0000796	Component	Condensin complex	NAS	17268547
GO:0003682	Function	Chromatin binding	IBA
GO:0003682	Function	Chromatin binding	IEA
GO:0003697	Function	Single-stranded DNA binding	IEA
GO:0005515	Function	Protein binding	IPI	9789013, 12589063, 17113138, 17268547, 21633354, 23728299, 26496610, 30021884, 33961781, 35271311
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IDA	12589063
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005694	Component	Chromosome	IEA
GO:0005730	Component	Nucleolus	IDA
GO:0005737	Component	Cytoplasm	IDA	10958694, 12589063
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0007076	Process	Mitotic chromosome condensation	IBA
GO:0007076	Process	Mitotic chromosome condensation	IDA	11136719
GO:0007076	Process	Mitotic chromosome condensation	TAS	9789013
GO:0010032	Process	Meiotic chromosome condensation	IEA
GO:0016887	Function	ATP hydrolysis activity	IEA
GO:0030261	Process	Chromosome condensation	IEA
GO:0045132	Process	Meiotic chromosome segregation	IEA
GO:0051276	Process	Chromosome organization	IEA
GO:0051301	Process	Cell division	IEA
GO:0051383	Process	Kinetochore organization	IEA
GO:0051984	Process	Positive regulation of chromosome segregation	IEA
GO:0051984	Process	Positive regulation of chromosome segregation	ISO
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0098813	Process	Nuclear chromosome segregation	IEA
GO:1905820	Process	Positive regulation of chromosome separation	IEA
GO:1905820	Process	Positive regulation of chromosome separation	ISO
GO:1905821	Process	Positive regulation of chromosome condensation	IDA	17268547
GO:1905821	Process	Positive regulation of chromosome condensation	ISS

MIM	HGNC	e!Ensembl
605576	14011	ENSG00000136824

O95347

Protein name

Structural maintenance of chromosomes protein 2 (SMC protein 2) (SMC-2) (Chromosome-associated protein E) (hCAP-E) (XCAP-E homolog)

Protein function

Central component of the condensin complex, a complex required for conversion of interphase chromatin into mitotic-like condense chromosomes. The condensin complex probably introduces positive supercoils into relaxed DNA in the presence of type

PDB

4U4P

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02463	SMC_N	2 → 682	RecF/RecN/SMC N terminal domain	Domain
PF02463	SMC_N	721 → 1167	RecF/RecN/SMC N terminal domain	Domain
PF06470	SMC_hinge	519 → 640	SMC proteins Flexible Hinge Domain	Domain

Sequence

MHIKSIILEGFKSYAQRTEVNGFDPLFNAITGLNGSGKSNILDSICFLLGISNLSQVRAS
NLQDLVYKNGQAGITKASVSITFDNSDKKQSPLGFEVHDEITVTRQVVIGGRNKYLINGV
NANNTRVQDLFCSVGLNVNNPHFLIMQGRITKVLNMKPPEILSMIEEAAGTRMYEYKKIA
AQKTIEKKEAKLKEIKTILEEEITPTIQKLKEERSSYLEYQKVMREIEHLSRLYIAYQFL
LAEDTKVRSAEELKEMQDKVIKLQEELSENDKKIKALNHEIEELEKRKDKETGGILRSLE
DALAEAQRVNTKSQSAFDLKKKNLACEESKRKELEKNMVEDSKTLAAKEKEVKKITDGLH
ALQEASNKDAEALAAAQQHFNAVSAGLSSNEDGAEATLAGQMMACKNDISKAQTEAKQAQ
MKLKHAQQELKNKQAEVKKMDSGYRKDQEALEAVKRLKEKLEAEMKKLNYEENKEESLLE
KRRQLSRDIGRLKETYEALLARFPNLRFAYKDPEKNWNRNCVKGLVASLISVKDTSATTA
LELVAGERLYNVVVDTEVTGKKLLERGELKRRYTIIPLNKISARCIAPETLRVAQNLVGP
DNVHVALSLVEYKPELQKAMEFVFGTTFVCDNMDNAKKVAFDKRIMTRTVTLGGDVFDPH
GTLSGGARSQAASILTKFQELKDVQDELRIKENELRALEEELAGLKNTAEKYRQLKQQWE
MKTEEADLLQTKLQQSSYHKQQEELDALKKTIEESEETLKNTKEIQRKAEEKYEVLENKM
KNAEAERERELKDAQKKLDCAKTKADASSKKMKEKQQEVEAITLELEELKREHTSYKQQL
EAVNEAIKSYESQIEVMAAEVAKNKESVNKAQEEVTKQKEVITAQDTVIKAKYAEVAKHK
EQNNDSQLKIKELDHNISKHKREAEDGAAKVSKMLKDYDWINAERHLFGQPNSAYDFKTN
NPKEAGQRLQKLQEMKEKLGRNVNMRAMNVLTEAEERYNDLMKKKRIVENDKSKILTTIE
DLDQKKNQALNIAWQKVNKDFGSIFSTLLPGANAMLAPPEGQTVLDGLEFKVALGNTWKE
NLTELSGGQRSLVALSLILSMLLFKPAPIYILDEVDAALDLSHTQNIGQMLRTHFTHSQF
IVVSLKEGMFNNANVLFKTKFVDGVSTVARFTQCQNGKISKEAKSKAKPPKGAHVEV

Sequence length

1197

Interactions

View interactions

Reactome Pathway
Condensation of Prophase Chromosomes
Condensation of Prometaphase Chromosomes

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (37)
ALZHEIMER DISEASE	—	GWAS catalog	35589863	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AORTIC STENOSIS	—	GWAS catalog	37038246	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BASAL CELL CARCINOMA	—	GWAS catalog	31174203, 33549134, 36496446, 38182794	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BILIARY TRACT CANCER	—	GWAS catalog	34290314	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	29059683, 32424353, 36819030	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	29059683, 32424353, 34290314	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANCER	—	GWAS catalog	34290314	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CERVICAL CARCINOMA	—	GWAS catalog	34290314	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	34290314	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL CANCER	—	GWAS catalog	34290314	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL CANCER	—	GWAS catalog	34290314	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN-RECEPTOR NEGATIVE BREAST CANCER	—	GWAS catalog	34290314	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTRIC CANCER	—	GWAS catalog	34290314	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATOCELLULAR CARCINOMA	—	GWAS catalog	34290314	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KERATINOCYTE CARCINOMA	—	GWAS catalog	31174203	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	34290314	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CANCER	—	GWAS catalog	34290314	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	34290314	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG NEOPLASMS	—	CTD	27935865	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-HODGKINS LYMPHOMA	—	GWAS catalog	34290314	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-MELANOMA SKIN CARCINOMA	—	GWAS catalog	29739929, 34290314	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Uncertain significance	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CANCER	—	GWAS catalog	34290314	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	34290314, 36819030	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN ENDOMETRIOID CARCINOMA	—	GWAS catalog	34290314	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN SEROUS CARCINOMA	—	GWAS catalog	28346442, 34290314	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATIC CARCINOMA	—	GWAS catalog	29422604, 30541042, 34290314	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATIC DUCTAL ADENOCARCINOMA	—	GWAS catalog	30541042	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	34290314	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	30019117	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN CANCER	—	GWAS catalog	34594039	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN NEOPLASM	—	GWAS catalog	34594039	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	34290314	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STEVENS-JOHNSON SYNDROME	—	GWAS catalog	33574277	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Uncertain significance	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TOXIC EPIDERMAL NECROLYSIS	—	GWAS catalog	33574277	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Wiedemann-Rautenstrauch-like progeroid syndrome	Uncertain significance	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
RGS22	14	["Skin neoplasms","Biliary tract cancer","Cancer","Cervical cancer","Endometrial cancer","Esophageal cancer","Estrogen-receptor negative breast cancer","Pancreatic cancer","Gastric cancer","Keratinocyte carcinoma","Non-hodgkins lymphoma","Non-melanoma skin carcinoma"]	[]	16	["GWAS catalog (Basal cell carcinoma)","GWAS catalog (Skin neoplasms)","GWAS catalog (Biliary tract cancer)","GWAS catalog (Cancer)","GWAS catalog (Cervical cancer)","GWAS catalog (Endometrial cancer)","GWAS catalog (Esophageal cancer)","GWAS catalog (Estrogen-receptor negative breast cancer)","GWAS catalog (Pancreatic cancer)","GWAS catalog (Gastric cancer)","GWAS catalog (Hepatocellular carcinoma)","GWAS catalog (Keratinocyte carcinoma)"]
RCC2	14	["Skin neoplasms","Biliary tract cancer","Cancer","Cervical cancer","Endometrial cancer","Esophageal cancer","Estrogen-receptor negative breast cancer","Pancreatic cancer","Gastric cancer","Keratinocyte carcinoma","Non-hodgkins lymphoma","Non-melanoma skin carcinoma"]	[]	16	["GWAS catalog (Basal cell carcinoma)","GWAS catalog (Skin neoplasms)","GWAS catalog (Biliary tract cancer)","GWAS catalog (Cancer)","GWAS catalog (Cervical cancer)","GWAS catalog (Endometrial cancer)","GWAS catalog (Esophageal cancer)","GWAS catalog (Estrogen-receptor negative breast cancer)","GWAS catalog (Pancreatic cancer)","GWAS catalog (Gastric cancer)","GWAS catalog (Hepatocellular carcinoma)","GWAS catalog (Keratinocyte carcinoma)"]
RHOU	14	["Skin neoplasms","Biliary tract cancer","Cancer","Cervical cancer","Endometrial cancer","Esophageal cancer","Estrogen-receptor negative breast cancer","Pancreatic cancer","Gastric cancer","Keratinocyte carcinoma","Non-hodgkins lymphoma","Non-melanoma skin carcinoma"]	[]	16	["GWAS catalog (Basal cell carcinoma)","GWAS catalog (Skin neoplasms)","GWAS catalog (Biliary tract cancer)","GWAS catalog (Cancer)","GWAS catalog (Cervical cancer)","GWAS catalog (Endometrial cancer)","GWAS catalog (Esophageal cancer)","GWAS catalog (Estrogen-receptor negative breast cancer)","GWAS catalog (Pancreatic cancer)","GWAS catalog (Gastric cancer)","GWAS catalog (Hepatocellular carcinoma)","GWAS catalog (Keratinocyte carcinoma)"]
TRAK2	11	["Biliary tract cancer","Cancer","Cervical cancer","Endometrial cancer","Esophageal cancer","Estrogen-receptor negative breast cancer","Pancreatic cancer","Gastric cancer","Non-hodgkins lymphoma","Non-melanoma skin carcinoma","Ovarian serous carcinoma"]	[]	13	["GWAS catalog (Basal cell carcinoma)","GWAS catalog (Biliary tract cancer)","GWAS catalog (Cancer)","GWAS catalog (Cervical cancer)","GWAS catalog (Endometrial cancer)","GWAS catalog (Esophageal cancer)","GWAS catalog (Estrogen-receptor negative breast cancer)","GWAS catalog (Pancreatic cancer)","GWAS catalog (Gastric cancer)","GWAS catalog (Hepatocellular carcinoma)","GWAS catalog (Non-hodgkins lymphoma)","GWAS catalog (Non-melanoma skin carcinoma)"]
TGM3	14	["Skin neoplasms","Biliary tract cancer","Cancer","Cervical cancer","Endometrial cancer","Esophageal cancer","Estrogen-receptor negative breast cancer","Pancreatic cancer","Gastric cancer","Keratinocyte carcinoma","Non-hodgkins lymphoma","Non-melanoma skin carcinoma"]	[]	16	["GWAS catalog (Basal cell carcinoma)","GWAS catalog (Skin neoplasms)","GWAS catalog (Biliary tract cancer)","GWAS catalog (Cancer)","GWAS catalog (Cervical cancer)","GWAS catalog (Endometrial cancer)","GWAS catalog (Esophageal cancer)","GWAS catalog (Estrogen-receptor negative breast cancer)","GWAS catalog (Pancreatic cancer)","GWAS catalog (Gastric cancer)","GWAS catalog (Hepatocellular carcinoma)","GWAS catalog (Keratinocyte carcinoma)"]

SMC2 (structural maintenance of chromosomes 2)

Bookmark This Gene