Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	5715
Gene name	Proteasome 26S subunit, non-ATPase 9
Gene symbol	PSMD9
Synonyms (NCBI Gene)	Rpn4p27
Chromosome	12
Chromosome location	12q24.31
Summary	The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits a

270 Show/Hide all (270)

miRTarBase ID	miRNA	Experiments	Reference
MIRT020196	hsa-miR-130b-3p	Sequencing	20371350
MIRT021122	hsa-miR-186-5p	Sequencing	20371350
MIRT025995	hsa-miR-148a-3p	Sequencing	20371350
MIRT031151	hsa-miR-19b-3p	Sequencing	20371350
MIRT032262	hsa-let-7b-5p	Proteomics	18668040
MIRT682705	hsa-miR-508-5p	HITS-CLIP	23706177
MIRT682704	hsa-miR-6849-3p	HITS-CLIP	23706177
MIRT682703	hsa-miR-6742-3p	HITS-CLIP	23706177
MIRT682702	hsa-miR-766-3p	HITS-CLIP	23706177
MIRT682701	hsa-miR-4793-3p	HITS-CLIP	23706177
MIRT682700	hsa-miR-6776-5p	HITS-CLIP	23706177
MIRT682699	hsa-miR-661	HITS-CLIP	23706177
MIRT682698	hsa-miR-4504	HITS-CLIP	23706177
MIRT682696	hsa-miR-6512-3p	HITS-CLIP	23706177
MIRT682697	hsa-miR-6720-5p	HITS-CLIP	23706177
MIRT682695	hsa-miR-7703	HITS-CLIP	23706177
MIRT682694	hsa-miR-1262	HITS-CLIP	23706177
MIRT682693	hsa-miR-4701-3p	HITS-CLIP	23706177
MIRT682692	hsa-miR-6736-5p	HITS-CLIP	23706177
MIRT682691	hsa-miR-1273a	HITS-CLIP	23706177
MIRT682690	hsa-miR-1273g-3p	HITS-CLIP	23706177
MIRT682705	hsa-miR-508-5p	HITS-CLIP	23706177
MIRT682704	hsa-miR-6849-3p	HITS-CLIP	23706177
MIRT682703	hsa-miR-6742-3p	HITS-CLIP	23706177
MIRT682702	hsa-miR-766-3p	HITS-CLIP	23706177
MIRT682701	hsa-miR-4793-3p	HITS-CLIP	23706177
MIRT682700	hsa-miR-6776-5p	HITS-CLIP	23706177
MIRT682699	hsa-miR-661	HITS-CLIP	23706177
MIRT682698	hsa-miR-4504	HITS-CLIP	23706177
MIRT682696	hsa-miR-6512-3p	HITS-CLIP	23706177
MIRT682697	hsa-miR-6720-5p	HITS-CLIP	23706177
MIRT682695	hsa-miR-7703	HITS-CLIP	23706177
MIRT682694	hsa-miR-1262	HITS-CLIP	23706177
MIRT682693	hsa-miR-4701-3p	HITS-CLIP	23706177
MIRT682692	hsa-miR-6736-5p	HITS-CLIP	23706177
MIRT682691	hsa-miR-1273a	HITS-CLIP	23706177
MIRT682690	hsa-miR-1273g-3p	HITS-CLIP	23706177
MIRT1270695	hsa-miR-101	CLIP-seq
MIRT1270696	hsa-miR-10a	CLIP-seq
MIRT1270697	hsa-miR-10b	CLIP-seq
MIRT1270698	hsa-miR-1278	CLIP-seq
MIRT1270699	hsa-miR-1283	CLIP-seq
MIRT1270700	hsa-miR-1305	CLIP-seq
MIRT1270701	hsa-miR-141	CLIP-seq
MIRT1270702	hsa-miR-1587	CLIP-seq
MIRT1270703	hsa-miR-200a	CLIP-seq
MIRT1270704	hsa-miR-2110	CLIP-seq
MIRT1270705	hsa-miR-24	CLIP-seq
MIRT1270706	hsa-miR-3178	CLIP-seq
MIRT1270707	hsa-miR-330-3p	CLIP-seq
MIRT1270708	hsa-miR-335	CLIP-seq
MIRT1270709	hsa-miR-339-5p	CLIP-seq
MIRT1270710	hsa-miR-3611	CLIP-seq
MIRT1270711	hsa-miR-3613-3p	CLIP-seq
MIRT1270712	hsa-miR-3646	CLIP-seq
MIRT1270713	hsa-miR-3925-3p	CLIP-seq
MIRT1270714	hsa-miR-4270	CLIP-seq
MIRT1270715	hsa-miR-4271	CLIP-seq
MIRT1270716	hsa-miR-4284	CLIP-seq
MIRT1270717	hsa-miR-4421	CLIP-seq
MIRT1270718	hsa-miR-4441	CLIP-seq
MIRT1270719	hsa-miR-4486	CLIP-seq
MIRT1270720	hsa-miR-4492	CLIP-seq
MIRT1270721	hsa-miR-4498	CLIP-seq
MIRT1270722	hsa-miR-4505	CLIP-seq
MIRT1270723	hsa-miR-451b	CLIP-seq
MIRT1270724	hsa-miR-4656	CLIP-seq
MIRT1270725	hsa-miR-4667-5p	CLIP-seq
MIRT1270726	hsa-miR-4675	CLIP-seq
MIRT1270727	hsa-miR-4679	CLIP-seq
MIRT1270728	hsa-miR-4684-5p	CLIP-seq
MIRT1270729	hsa-miR-4696	CLIP-seq
MIRT1270730	hsa-miR-4700-5p	CLIP-seq
MIRT1270731	hsa-miR-4715-3p	CLIP-seq
MIRT1270732	hsa-miR-4725-3p	CLIP-seq
MIRT1270733	hsa-miR-4725-5p	CLIP-seq
MIRT1270734	hsa-miR-4741	CLIP-seq
MIRT1270735	hsa-miR-498	CLIP-seq
MIRT1270736	hsa-miR-504	CLIP-seq
MIRT1270737	hsa-miR-505	CLIP-seq
MIRT1270738	hsa-miR-570	CLIP-seq
MIRT1270739	hsa-miR-583	CLIP-seq
MIRT1270740	hsa-miR-593	CLIP-seq
MIRT1270741	hsa-miR-758	CLIP-seq
MIRT1270742	hsa-miR-762	CLIP-seq
MIRT1270743	hsa-miR-766	CLIP-seq
MIRT1270695	hsa-miR-101	CLIP-seq
MIRT2079581	hsa-miR-1225-3p	CLIP-seq
MIRT2079582	hsa-miR-1233	CLIP-seq
MIRT2079583	hsa-miR-1273e	CLIP-seq
MIRT2079584	hsa-miR-1288	CLIP-seq
MIRT2079585	hsa-miR-3074-3p	CLIP-seq
MIRT2079586	hsa-miR-3169	CLIP-seq
MIRT2079587	hsa-miR-3200-5p	CLIP-seq
MIRT2079588	hsa-miR-3714	CLIP-seq
MIRT2079589	hsa-miR-4266	CLIP-seq
MIRT2079590	hsa-miR-4281	CLIP-seq
MIRT2079591	hsa-miR-4303	CLIP-seq
MIRT2079592	hsa-miR-4433	CLIP-seq
MIRT2079593	hsa-miR-4459	CLIP-seq
MIRT1270727	hsa-miR-4679	CLIP-seq
MIRT2079594	hsa-miR-4695-5p	CLIP-seq
MIRT2079595	hsa-miR-4722-5p	CLIP-seq
MIRT2079596	hsa-miR-4779	CLIP-seq
MIRT2079597	hsa-miR-635	CLIP-seq
MIRT2079598	hsa-miR-651	CLIP-seq
MIRT2079599	hsa-miR-665	CLIP-seq
MIRT1270743	hsa-miR-766	CLIP-seq
MIRT2079600	hsa-miR-890	CLIP-seq
MIRT2079601	hsa-miR-940	CLIP-seq
MIRT1270695	hsa-miR-101	CLIP-seq
MIRT2079581	hsa-miR-1225-3p	CLIP-seq
MIRT2305907	hsa-miR-1228	CLIP-seq
MIRT2079582	hsa-miR-1233	CLIP-seq
MIRT2079583	hsa-miR-1273e	CLIP-seq
MIRT1270698	hsa-miR-1278	CLIP-seq
MIRT2079584	hsa-miR-1288	CLIP-seq
MIRT2305908	hsa-miR-130a	CLIP-seq
MIRT2305909	hsa-miR-130b	CLIP-seq
MIRT2305910	hsa-miR-140-3p	CLIP-seq
MIRT2305911	hsa-miR-148a	CLIP-seq
MIRT2305912	hsa-miR-148b	CLIP-seq
MIRT2305913	hsa-miR-152	CLIP-seq
MIRT1270702	hsa-miR-1587	CLIP-seq
MIRT2305914	hsa-miR-185	CLIP-seq
MIRT2305915	hsa-miR-19a	CLIP-seq
MIRT2305916	hsa-miR-19b	CLIP-seq
MIRT1270705	hsa-miR-24	CLIP-seq
MIRT2305917	hsa-miR-301a	CLIP-seq
MIRT2305918	hsa-miR-301b	CLIP-seq
MIRT2305919	hsa-miR-3120-3p	CLIP-seq
MIRT2079586	hsa-miR-3169	CLIP-seq
MIRT1270706	hsa-miR-3178	CLIP-seq
MIRT1270707	hsa-miR-330-3p	CLIP-seq
MIRT2305920	hsa-miR-34b	CLIP-seq
MIRT2305921	hsa-miR-3666	CLIP-seq
MIRT2305922	hsa-miR-3713	CLIP-seq
MIRT2079588	hsa-miR-3714	CLIP-seq
MIRT2079589	hsa-miR-4266	CLIP-seq
MIRT1270714	hsa-miR-4270	CLIP-seq
MIRT1270716	hsa-miR-4284	CLIP-seq
MIRT2305923	hsa-miR-4295	CLIP-seq
MIRT2305924	hsa-miR-4306	CLIP-seq
MIRT2305925	hsa-miR-4417	CLIP-seq
MIRT2079592	hsa-miR-4433	CLIP-seq
MIRT1270718	hsa-miR-4441	CLIP-seq
MIRT2079593	hsa-miR-4459	CLIP-seq
MIRT1270719	hsa-miR-4486	CLIP-seq
MIRT1270720	hsa-miR-4492	CLIP-seq
MIRT1270721	hsa-miR-4498	CLIP-seq
MIRT1270722	hsa-miR-4505	CLIP-seq
MIRT2305926	hsa-miR-454	CLIP-seq
MIRT2305927	hsa-miR-4644	CLIP-seq
MIRT1270724	hsa-miR-4656	CLIP-seq
MIRT1270726	hsa-miR-4675	CLIP-seq
MIRT1270727	hsa-miR-4679	CLIP-seq
MIRT2305928	hsa-miR-4685-5p	CLIP-seq
MIRT2079594	hsa-miR-4695-5p	CLIP-seq
MIRT2305929	hsa-miR-4712-5p	CLIP-seq
MIRT1270731	hsa-miR-4715-3p	CLIP-seq
MIRT2305930	hsa-miR-4722-3p	CLIP-seq
MIRT2079595	hsa-miR-4722-5p	CLIP-seq
MIRT1270734	hsa-miR-4741	CLIP-seq
MIRT2305931	hsa-miR-4742-3p	CLIP-seq
MIRT2079596	hsa-miR-4779	CLIP-seq
MIRT2305932	hsa-miR-4786-5p	CLIP-seq
MIRT2305933	hsa-miR-490-3p	CLIP-seq
MIRT1270737	hsa-miR-505	CLIP-seq
MIRT2305934	hsa-miR-518a-5p	CLIP-seq
MIRT2305935	hsa-miR-527	CLIP-seq
MIRT2305936	hsa-miR-545	CLIP-seq
MIRT2305937	hsa-miR-548aa	CLIP-seq
MIRT2305938	hsa-miR-548p	CLIP-seq
MIRT2079598	hsa-miR-651	CLIP-seq
MIRT2079599	hsa-miR-665	CLIP-seq
MIRT2305939	hsa-miR-718	CLIP-seq
MIRT1270742	hsa-miR-762	CLIP-seq
MIRT1270743	hsa-miR-766	CLIP-seq
MIRT2305940	hsa-miR-770-5p	CLIP-seq
MIRT2079601	hsa-miR-940	CLIP-seq
MIRT2079589	hsa-miR-4266	CLIP-seq
MIRT1270727	hsa-miR-4679	CLIP-seq
MIRT2079594	hsa-miR-4695-5p	CLIP-seq
MIRT2079596	hsa-miR-4779	CLIP-seq
MIRT2079598	hsa-miR-651	CLIP-seq
MIRT2079581	hsa-miR-1225-3p	CLIP-seq
MIRT2079582	hsa-miR-1233	CLIP-seq
MIRT2603161	hsa-miR-1236	CLIP-seq
MIRT2603162	hsa-miR-1253	CLIP-seq
MIRT2079583	hsa-miR-1273e	CLIP-seq
MIRT2079584	hsa-miR-1288	CLIP-seq
MIRT2305914	hsa-miR-185	CLIP-seq
MIRT2603163	hsa-miR-2355-5p	CLIP-seq
MIRT2603164	hsa-miR-3074-5p	CLIP-seq
MIRT2603165	hsa-miR-3124-3p	CLIP-seq
MIRT2603166	hsa-miR-3127-5p	CLIP-seq
MIRT2603167	hsa-miR-3160-5p	CLIP-seq
MIRT2079586	hsa-miR-3169	CLIP-seq
MIRT2603168	hsa-miR-3180-5p	CLIP-seq
MIRT1270707	hsa-miR-330-3p	CLIP-seq
MIRT2603169	hsa-miR-3691-3p	CLIP-seq
MIRT2079588	hsa-miR-3714	CLIP-seq
MIRT2603170	hsa-miR-3977	CLIP-seq
MIRT2603171	hsa-miR-3978	CLIP-seq
MIRT2079589	hsa-miR-4266	CLIP-seq
MIRT1270714	hsa-miR-4270	CLIP-seq
MIRT2305924	hsa-miR-4306	CLIP-seq
MIRT2079592	hsa-miR-4433	CLIP-seq
MIRT1270718	hsa-miR-4441	CLIP-seq
MIRT2079593	hsa-miR-4459	CLIP-seq
MIRT2603172	hsa-miR-452	CLIP-seq
MIRT2305927	hsa-miR-4644	CLIP-seq
MIRT2603173	hsa-miR-4676-3p	CLIP-seq
MIRT1270727	hsa-miR-4679	CLIP-seq
MIRT2305928	hsa-miR-4685-5p	CLIP-seq
MIRT2603174	hsa-miR-4693-5p	CLIP-seq
MIRT2079594	hsa-miR-4695-5p	CLIP-seq
MIRT1270731	hsa-miR-4715-3p	CLIP-seq
MIRT2079595	hsa-miR-4722-5p	CLIP-seq
MIRT2079596	hsa-miR-4779	CLIP-seq
MIRT2603175	hsa-miR-520a-5p	CLIP-seq
MIRT2603176	hsa-miR-525-5p	CLIP-seq
MIRT2603177	hsa-miR-605	CLIP-seq
MIRT2079598	hsa-miR-651	CLIP-seq
MIRT2079599	hsa-miR-665	CLIP-seq
MIRT2079601	hsa-miR-940	CLIP-seq
MIRT1270696	hsa-miR-10a	CLIP-seq
MIRT1270697	hsa-miR-10b	CLIP-seq
MIRT2079581	hsa-miR-1225-3p	CLIP-seq
MIRT2079582	hsa-miR-1233	CLIP-seq
MIRT2603161	hsa-miR-1236	CLIP-seq
MIRT2603162	hsa-miR-1253	CLIP-seq
MIRT2079583	hsa-miR-1273e	CLIP-seq
MIRT1270699	hsa-miR-1283	CLIP-seq
MIRT2079584	hsa-miR-1288	CLIP-seq
MIRT2305914	hsa-miR-185	CLIP-seq
MIRT2603163	hsa-miR-2355-5p	CLIP-seq
MIRT2603164	hsa-miR-3074-5p	CLIP-seq
MIRT2603165	hsa-miR-3124-3p	CLIP-seq
MIRT2603166	hsa-miR-3127-5p	CLIP-seq
MIRT2603167	hsa-miR-3160-5p	CLIP-seq
MIRT2079586	hsa-miR-3169	CLIP-seq
MIRT2603168	hsa-miR-3180-5p	CLIP-seq
MIRT1270709	hsa-miR-339-5p	CLIP-seq
MIRT1270711	hsa-miR-3613-3p	CLIP-seq
MIRT2603169	hsa-miR-3691-3p	CLIP-seq
MIRT2079588	hsa-miR-3714	CLIP-seq
MIRT2603170	hsa-miR-3977	CLIP-seq
MIRT2603171	hsa-miR-3978	CLIP-seq
MIRT1270714	hsa-miR-4270	CLIP-seq
MIRT2305924	hsa-miR-4306	CLIP-seq
MIRT1270717	hsa-miR-4421	CLIP-seq
MIRT1270718	hsa-miR-4441	CLIP-seq
MIRT2079593	hsa-miR-4459	CLIP-seq
MIRT2603172	hsa-miR-452	CLIP-seq
MIRT2305927	hsa-miR-4644	CLIP-seq
MIRT2603173	hsa-miR-4676-3p	CLIP-seq
MIRT1270728	hsa-miR-4684-5p	CLIP-seq
MIRT2305928	hsa-miR-4685-5p	CLIP-seq
MIRT2603174	hsa-miR-4693-5p	CLIP-seq
MIRT1270731	hsa-miR-4715-3p	CLIP-seq
MIRT2079595	hsa-miR-4722-5p	CLIP-seq
MIRT1270733	hsa-miR-4725-5p	CLIP-seq
MIRT1270736	hsa-miR-504	CLIP-seq
MIRT2603175	hsa-miR-520a-5p	CLIP-seq
MIRT2603176	hsa-miR-525-5p	CLIP-seq
MIRT1270740	hsa-miR-593	CLIP-seq
MIRT2603177	hsa-miR-605	CLIP-seq
MIRT2079599	hsa-miR-665	CLIP-seq
MIRT2079601	hsa-miR-940	CLIP-seq

16 Show/Hide all (16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003713	Function	Transcription coactivator activity	ISS	10567574
GO:0005515	Function	Protein binding	IPI	16189514, 19490896, 21516116, 25009770, 25416956, 31515488, 32296183, 32814053, 33961781, 35271311
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	ISS	10567574
GO:0005737	Component	Cytoplasm	IBA
GO:0005829	Component	Cytosol	TAS
GO:0005838	Component	Proteasome regulatory particle	NAS	9653651
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	NAS	9653651
GO:0008540	Component	Proteasome regulatory particle, base subcomplex	IDA	19490896
GO:0032024	Process	Positive regulation of insulin secretion	ISS	10567574
GO:0043425	Function	BHLH transcription factor binding	ISS	10567574
GO:0045893	Process	Positive regulation of DNA-templated transcription	ISS	10567574, 16293776
GO:0046676	Process	Negative regulation of insulin secretion	ISS	16099819
GO:0070682	Process	Proteasome regulatory particle assembly	IBA
GO:0070682	Process	Proteasome regulatory particle assembly	IEA
GO:0070682	Process	Proteasome regulatory particle assembly	IMP	19490896

MIM	HGNC	e!Ensembl
603146	9567	ENSG00000110801

O00233

Protein name

26S proteasome non-ATPase regulatory subunit 9 (26S proteasome regulatory subunit p27)

Protein function

Acts as a chaperone during the assembly of the 26S proteasome, specifically of the base subcomplex of the PA700/19S regulatory complex (RC). During the base subcomplex assembly is part of an intermediate PSMD9:PSMC6:PSMC3 module, also known as m

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF17820	PDZ_6	138 → 194	PDZ domain	Domain
PF18265	Nas2_N	23 → 102	Nas2 N_terminal domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in all tissues tested, highly expressed in liver and kidney.

Sequence

MSDEEARQSGGSSQAGVVTVSDVQELMRRKEEIEAQIKANYDVLESQKGIGMNEPLVDCE
GYPRSDVDLYQVRTARHNIICLQNDHKAVMKQVEEALHQLHARDKEKQARDMAEAHKEAM
SRKLGQSESQGPPRAFAKVNSISPGSPASIAGLQVDDEIVEFGSVNTQNFQSLHNIGSVV
QHSEGKPLNVTVIRRGEKHQLRLVPTRWAGKGLLGCNIIPLQR

Sequence length

223

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Proteasome	Activation of NF-kappaB in B cells
Alzheimer disease	Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha
Parkinson disease	Cross-presentation of soluble exogenous antigens (endosomes)
Amyotrophic lateral sclerosis	Autodegradation of Cdh1 by Cdh1:APC/C
Huntington disease	SCF-beta-TrCP mediated degradation of Emi1
Spinocerebellar ataxia	APC/C:Cdc20 mediated degradation of Securin
Prion disease	APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1
Pathways of neurodegeneration - multiple diseases	Cdc20:Phospho-APC/C mediated degradation of Cyclin A
	Vpu mediated degradation of CD4
	Vif-mediated degradation of APOBEC3G
	SCF(Skp2)-mediated degradation of p27/p21
	Degradation of beta-catenin by the destruction complex
	Downstream TCR signaling
	Separation of Sister Chromatids
	FCERI mediated NF-kB activation
	Autodegradation of the E3 ubiquitin ligase COP1
	Regulation of ornithine decarboxylase (ODC)
	ABC-family proteins mediated transport
	AUF1 (hnRNP D0) binds and destabilizes mRNA
	Asymmetric localization of PCP proteins
	Degradation of AXIN
	Degradation of DVL
	Hedgehog ligand biogenesis
	Hh mutants that don't undergo autocatalytic processing are degraded by ERAD
	Dectin-1 mediated noncanonical NF-kB signaling
	CLEC7A (Dectin-1) signaling
	Degradation of GLI1 by the proteasome
	GLI3 is processed to GLI3R by the proteasome
	Hedgehog 'on' state
	Regulation of RAS by GAPs
	TNFR2 non-canonical NF-kB pathway
	NIK-->noncanonical NF-kB signaling
	Defective CFTR causes cystic fibrosis
	MAPK6/MAPK4 signaling
	UCH proteinases
	Ub-specific processing proteases
	CDT1 association with the CDC6:ORC:origin complex
	Orc1 removal from chromatin
	CDK-mediated phosphorylation and removal of Cdc6
	G2/M Checkpoints
	Ubiquitin Mediated Degradation of Phosphorylated Cdc25A
	Ubiquitin-dependent degradation of Cyclin D
	The role of GTSE1 in G2/M progression after G2 checkpoint
	FBXL7 down-regulates AURKA during mitotic entry and in early mitosis
	RUNX1 regulates transcription of genes involved in differentiation of HSCs
	Regulation of RUNX2 expression and activity
	Regulation of RUNX3 expression and activity
	Regulation of PTEN stability and activity
	Neddylation
	Interleukin-1 signaling
	Antigen processing: Ubiquitination & Proteasome degradation

Related Gene	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Names
PSMA1	[]	54	["Proteasome","Parkinson disease","Spinocerebellar ataxia","Prion disease","Regulation of PTEN stability and activity","Ub-specific processing proteases","Neddylation","Separation of Sister Chromatids","ABC-family proteins mediated transport","Regulation of RAS by GAPs","SCF(Skp2)-mediated degradation of p27\/p21","Orc1 removal from chromatin"]	[]
PSMA2	[]	54	["Proteasome","Parkinson disease","Spinocerebellar ataxia","Prion disease","Regulation of PTEN stability and activity","Ub-specific processing proteases","Neddylation","Separation of Sister Chromatids","ABC-family proteins mediated transport","Regulation of RAS by GAPs","SCF(Skp2)-mediated degradation of p27\/p21","Orc1 removal from chromatin"]	[]
PSMA3	[]	54	["Proteasome","Parkinson disease","Spinocerebellar ataxia","Prion disease","Regulation of PTEN stability and activity","Ub-specific processing proteases","Neddylation","Separation of Sister Chromatids","ABC-family proteins mediated transport","Regulation of RAS by GAPs","SCF(Skp2)-mediated degradation of p27\/p21","Orc1 removal from chromatin"]	[]
PSMA4	[]	54	["Proteasome","Parkinson disease","Spinocerebellar ataxia","Prion disease","Regulation of PTEN stability and activity","Ub-specific processing proteases","Neddylation","Separation of Sister Chromatids","ABC-family proteins mediated transport","Regulation of RAS by GAPs","SCF(Skp2)-mediated degradation of p27\/p21","Orc1 removal from chromatin"]	[]
PSMA5	[]	54	["Proteasome","Parkinson disease","Spinocerebellar ataxia","Prion disease","Regulation of PTEN stability and activity","Ub-specific processing proteases","Neddylation","Separation of Sister Chromatids","ABC-family proteins mediated transport","Regulation of RAS by GAPs","SCF(Skp2)-mediated degradation of p27\/p21","Orc1 removal from chromatin"]	[]

PSMD9 (proteasome 26S subunit, non-ATPase 9)

Save This Analysis