Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	5683
Gene name	Proteasome 20S subunit alpha 2
Gene symbol	PSMA2
Synonyms (NCBI Gene)	HC3MUPMSA2PSC2
Chromosome	7
Chromosome location	7p14.1
Summary	The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta

184 Show/Hide all (184)

miRTarBase ID	miRNA	Experiments	Reference
MIRT021801	hsa-miR-132-3p	Microarray	17612493
MIRT052368	hsa-let-7a-5p	CLASH	23622248
MIRT048696	hsa-miR-99a-5p	CLASH	23622248
MIRT048439	hsa-miR-100-5p	CLASH	23622248
MIRT045788	hsa-miR-191-5p	CLASH	23622248
MIRT045072	hsa-miR-186-5p	CLASH	23622248
MIRT045072	hsa-miR-186-5p	CLASH	23622248
MIRT044238	hsa-miR-29c-3p	CLASH	23622248
MIRT521605	hsa-miR-212-3p	PAR-CLIP	20371350
MIRT021801	hsa-miR-132-3p	PAR-CLIP	20371350
MIRT521605	hsa-miR-212-3p	PAR-CLIP	20371350
MIRT021801	hsa-miR-132-3p	PAR-CLIP	20371350
MIRT521604	hsa-miR-548ac	PAR-CLIP	20371350
MIRT521603	hsa-miR-548bb-3p	PAR-CLIP	20371350
MIRT521602	hsa-miR-548d-3p	PAR-CLIP	20371350
MIRT521601	hsa-miR-548h-3p	PAR-CLIP	20371350
MIRT521600	hsa-miR-548z	PAR-CLIP	20371350
MIRT521599	hsa-miR-548ae-3p	PAR-CLIP	20371350
MIRT521598	hsa-miR-548ah-3p	PAR-CLIP	20371350
MIRT521597	hsa-miR-548aj-3p	PAR-CLIP	20371350
MIRT521596	hsa-miR-548am-3p	PAR-CLIP	20371350
MIRT521595	hsa-miR-548aq-3p	PAR-CLIP	20371350
MIRT521594	hsa-miR-548j-3p	PAR-CLIP	20371350
MIRT521593	hsa-miR-548x-3p	PAR-CLIP	20371350
MIRT521592	hsa-miR-595	PAR-CLIP	20371350
MIRT521591	hsa-miR-3159	PAR-CLIP	20371350
MIRT521590	hsa-miR-1250-3p	PAR-CLIP	20371350
MIRT521589	hsa-miR-153-5p	PAR-CLIP	20371350
MIRT521588	hsa-miR-616-3p	PAR-CLIP	20371350
MIRT521587	hsa-miR-302c-5p	PAR-CLIP	20371350
MIRT521586	hsa-miR-651-5p	PAR-CLIP	20371350
MIRT510919	hsa-miR-497-3p	PAR-CLIP	20371350
MIRT510918	hsa-miR-5680	PAR-CLIP	20371350
MIRT510916	hsa-miR-3668	PAR-CLIP	20371350
MIRT510917	hsa-miR-548aj-5p	PAR-CLIP	20371350
MIRT510915	hsa-miR-548f-5p	PAR-CLIP	20371350
MIRT510914	hsa-miR-548g-5p	PAR-CLIP	20371350
MIRT510913	hsa-miR-548x-5p	PAR-CLIP	20371350
MIRT510912	hsa-miR-1468-3p	PAR-CLIP	20371350
MIRT510911	hsa-miR-548aw	PAR-CLIP	20371350
MIRT521605	hsa-miR-212-3p	PAR-CLIP	23446348
MIRT021801	hsa-miR-132-3p	PAR-CLIP	23446348
MIRT521605	hsa-miR-212-3p	PAR-CLIP	23446348
MIRT021801	hsa-miR-132-3p	PAR-CLIP	23446348
MIRT521604	hsa-miR-548ac	PAR-CLIP	23446348
MIRT521603	hsa-miR-548bb-3p	PAR-CLIP	23446348
MIRT521602	hsa-miR-548d-3p	PAR-CLIP	23446348
MIRT521601	hsa-miR-548h-3p	PAR-CLIP	23446348
MIRT521600	hsa-miR-548z	PAR-CLIP	23446348
MIRT521599	hsa-miR-548ae-3p	PAR-CLIP	23446348
MIRT521598	hsa-miR-548ah-3p	PAR-CLIP	23446348
MIRT521597	hsa-miR-548aj-3p	PAR-CLIP	23446348
MIRT521596	hsa-miR-548am-3p	PAR-CLIP	23446348
MIRT521595	hsa-miR-548aq-3p	PAR-CLIP	23446348
MIRT521594	hsa-miR-548j-3p	PAR-CLIP	23446348
MIRT521593	hsa-miR-548x-3p	PAR-CLIP	23446348
MIRT521592	hsa-miR-595	PAR-CLIP	23446348
MIRT521591	hsa-miR-3159	PAR-CLIP	23446348
MIRT521590	hsa-miR-1250-3p	PAR-CLIP	23446348
MIRT521589	hsa-miR-153-5p	PAR-CLIP	23446348
MIRT521588	hsa-miR-616-3p	PAR-CLIP	23446348
MIRT521587	hsa-miR-302c-5p	PAR-CLIP	23446348
MIRT521586	hsa-miR-651-5p	PAR-CLIP	23446348
MIRT510919	hsa-miR-497-3p	PAR-CLIP	23446348
MIRT510918	hsa-miR-5680	PAR-CLIP	23446348
MIRT510916	hsa-miR-3668	PAR-CLIP	23446348
MIRT510917	hsa-miR-548aj-5p	PAR-CLIP	23446348
MIRT510915	hsa-miR-548f-5p	PAR-CLIP	23446348
MIRT510914	hsa-miR-548g-5p	PAR-CLIP	23446348
MIRT510913	hsa-miR-548x-5p	PAR-CLIP	23446348
MIRT510912	hsa-miR-1468-3p	PAR-CLIP	23446348
MIRT510911	hsa-miR-548aw	PAR-CLIP	23446348
MIRT521605	hsa-miR-212-3p	PAR-CLIP	20371350
MIRT021801	hsa-miR-132-3p	PAR-CLIP	20371350
MIRT521605	hsa-miR-212-3p	PAR-CLIP	20371350
MIRT021801	hsa-miR-132-3p	PAR-CLIP	20371350
MIRT521604	hsa-miR-548ac	PAR-CLIP	20371350
MIRT521603	hsa-miR-548bb-3p	PAR-CLIP	20371350
MIRT521602	hsa-miR-548d-3p	PAR-CLIP	20371350
MIRT521601	hsa-miR-548h-3p	PAR-CLIP	20371350
MIRT521600	hsa-miR-548z	PAR-CLIP	20371350
MIRT521599	hsa-miR-548ae-3p	PAR-CLIP	20371350
MIRT521598	hsa-miR-548ah-3p	PAR-CLIP	20371350
MIRT521597	hsa-miR-548aj-3p	PAR-CLIP	20371350
MIRT521596	hsa-miR-548am-3p	PAR-CLIP	20371350
MIRT521595	hsa-miR-548aq-3p	PAR-CLIP	20371350
MIRT521594	hsa-miR-548j-3p	PAR-CLIP	20371350
MIRT521593	hsa-miR-548x-3p	PAR-CLIP	20371350
MIRT521592	hsa-miR-595	PAR-CLIP	20371350
MIRT521591	hsa-miR-3159	PAR-CLIP	20371350
MIRT521590	hsa-miR-1250-3p	PAR-CLIP	20371350
MIRT521589	hsa-miR-153-5p	PAR-CLIP	20371350
MIRT521588	hsa-miR-616-3p	PAR-CLIP	20371350
MIRT521587	hsa-miR-302c-5p	PAR-CLIP	20371350
MIRT521586	hsa-miR-651-5p	PAR-CLIP	20371350
MIRT510919	hsa-miR-497-3p	PAR-CLIP	20371350
MIRT510918	hsa-miR-5680	PAR-CLIP	20371350
MIRT510916	hsa-miR-3668	PAR-CLIP	20371350
MIRT510917	hsa-miR-548aj-5p	PAR-CLIP	20371350
MIRT510915	hsa-miR-548f-5p	PAR-CLIP	20371350
MIRT510914	hsa-miR-548g-5p	PAR-CLIP	20371350
MIRT510913	hsa-miR-548x-5p	PAR-CLIP	20371350
MIRT510912	hsa-miR-1468-3p	PAR-CLIP	20371350
MIRT510911	hsa-miR-548aw	PAR-CLIP	20371350
MIRT521605	hsa-miR-212-3p	PAR-CLIP	23446348
MIRT021801	hsa-miR-132-3p	PAR-CLIP	23446348
MIRT521605	hsa-miR-212-3p	PAR-CLIP	23446348
MIRT021801	hsa-miR-132-3p	PAR-CLIP	23446348
MIRT521604	hsa-miR-548ac	PAR-CLIP	23446348
MIRT521603	hsa-miR-548bb-3p	PAR-CLIP	23446348
MIRT521602	hsa-miR-548d-3p	PAR-CLIP	23446348
MIRT521601	hsa-miR-548h-3p	PAR-CLIP	23446348
MIRT521600	hsa-miR-548z	PAR-CLIP	23446348
MIRT521599	hsa-miR-548ae-3p	PAR-CLIP	23446348
MIRT521598	hsa-miR-548ah-3p	PAR-CLIP	23446348
MIRT521597	hsa-miR-548aj-3p	PAR-CLIP	23446348
MIRT521596	hsa-miR-548am-3p	PAR-CLIP	23446348
MIRT521595	hsa-miR-548aq-3p	PAR-CLIP	23446348
MIRT521594	hsa-miR-548j-3p	PAR-CLIP	23446348
MIRT521593	hsa-miR-548x-3p	PAR-CLIP	23446348
MIRT521592	hsa-miR-595	PAR-CLIP	23446348
MIRT521591	hsa-miR-3159	PAR-CLIP	23446348
MIRT521590	hsa-miR-1250-3p	PAR-CLIP	23446348
MIRT521589	hsa-miR-153-5p	PAR-CLIP	23446348
MIRT521588	hsa-miR-616-3p	PAR-CLIP	23446348
MIRT521587	hsa-miR-302c-5p	PAR-CLIP	23446348
MIRT521586	hsa-miR-651-5p	PAR-CLIP	23446348
MIRT510919	hsa-miR-497-3p	PAR-CLIP	23446348
MIRT510918	hsa-miR-5680	PAR-CLIP	23446348
MIRT510916	hsa-miR-3668	PAR-CLIP	23446348
MIRT510917	hsa-miR-548aj-5p	PAR-CLIP	23446348
MIRT510915	hsa-miR-548f-5p	PAR-CLIP	23446348
MIRT510914	hsa-miR-548g-5p	PAR-CLIP	23446348
MIRT510913	hsa-miR-548x-5p	PAR-CLIP	23446348
MIRT510912	hsa-miR-1468-3p	PAR-CLIP	23446348
MIRT510911	hsa-miR-548aw	PAR-CLIP	23446348
MIRT1269965	hsa-miR-132	CLIP-seq
MIRT1269966	hsa-miR-212	CLIP-seq
MIRT1269967	hsa-miR-2276	CLIP-seq
MIRT1269968	hsa-miR-2278	CLIP-seq
MIRT1269969	hsa-miR-3167	CLIP-seq
MIRT1269970	hsa-miR-3663-3p	CLIP-seq
MIRT1269971	hsa-miR-376a	CLIP-seq
MIRT1269972	hsa-miR-376b	CLIP-seq
MIRT1269973	hsa-miR-4420	CLIP-seq
MIRT1269974	hsa-miR-4772-3p	CLIP-seq
MIRT1269975	hsa-miR-548ae	CLIP-seq
MIRT1269976	hsa-miR-548aj	CLIP-seq
MIRT1269977	hsa-miR-548am	CLIP-seq
MIRT1269978	hsa-miR-548x	CLIP-seq
MIRT1269979	hsa-miR-616	CLIP-seq
MIRT1269980	hsa-miR-629	CLIP-seq
MIRT1269981	hsa-miR-651	CLIP-seq
MIRT1269982	hsa-miR-876-5p	CLIP-seq
MIRT1269965	hsa-miR-132	CLIP-seq
MIRT2305655	hsa-miR-182	CLIP-seq
MIRT1269966	hsa-miR-212	CLIP-seq
MIRT2305656	hsa-miR-498	CLIP-seq
MIRT1269979	hsa-miR-616	CLIP-seq
MIRT2305655	hsa-miR-182	CLIP-seq
MIRT2602763	hsa-miR-3689a-5p	CLIP-seq
MIRT2602764	hsa-miR-3689b	CLIP-seq
MIRT2602765	hsa-miR-3689e	CLIP-seq
MIRT2602766	hsa-miR-3689f	CLIP-seq
MIRT2602767	hsa-miR-4282	CLIP-seq
MIRT2602768	hsa-miR-4679	CLIP-seq
MIRT2602769	hsa-miR-4766-3p	CLIP-seq
MIRT2602770	hsa-miR-548k	CLIP-seq
MIRT2602771	hsa-miR-548n	CLIP-seq
MIRT2602772	hsa-miR-548t	CLIP-seq
MIRT2602773	hsa-miR-549	CLIP-seq
MIRT2602774	hsa-miR-578	CLIP-seq
MIRT2602775	hsa-miR-590-3p	CLIP-seq
MIRT2305655	hsa-miR-182	CLIP-seq
MIRT2602763	hsa-miR-3689a-5p	CLIP-seq
MIRT2602764	hsa-miR-3689b	CLIP-seq
MIRT2602765	hsa-miR-3689e	CLIP-seq
MIRT2602766	hsa-miR-3689f	CLIP-seq
MIRT2602768	hsa-miR-4679	CLIP-seq
MIRT2602770	hsa-miR-548k	CLIP-seq
MIRT2602771	hsa-miR-548n	CLIP-seq
MIRT2602772	hsa-miR-548t	CLIP-seq
MIRT2602773	hsa-miR-549	CLIP-seq
MIRT2602774	hsa-miR-578	CLIP-seq

30 Show/Hide all (30)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000502	Component	Proteasome complex	IDA	17323924
GO:0000502	Component	Proteasome complex	IEA
GO:0000502	Component	Proteasome complex	NAS	29636472
GO:0000502	Component	Proteasome complex	TAS	8811196
GO:0000932	Component	P-body	IEA
GO:0000932	Component	P-body	ISS
GO:0005515	Function	Protein binding	IPI	12376572, 14733938, 15225636, 15887188, 16990800, 17189198, 17948026, 21900206, 21988832, 22046132, 25599644, 29568061, 29636472, 31473102, 32296183, 33961781, 34702852, 35271311, 35858375
GO:0005576	Component	Extracellular region	TAS
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005634	Component	Nucleus	IDA	34711951
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	34711951
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005839	Component	Proteasome core complex	IDA	34711951
GO:0005839	Component	Proteasome core complex	IEA
GO:0005839	Component	Proteasome core complex	ISS
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IEA
GO:0009615	Process	Response to virus	IEP	16548883
GO:0019773	Component	Proteasome core complex, alpha-subunit complex	IBA
GO:0019773	Component	Proteasome core complex, alpha-subunit complex	IEA
GO:0019773	Component	Proteasome core complex, alpha-subunit complex	ISS
GO:0034774	Component	Secretory granule lumen	TAS
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IBA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	ISS
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	NAS	19489727
GO:0051603	Process	Proteolysis involved in protein catabolic process	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867, 20458337, 23533145
GO:1904813	Component	Ficolin-1-rich granule lumen	TAS

MIM	HGNC	e!Ensembl
176842	9531	ENSG00000106588

P25787

Protein name

Proteasome subunit alpha type-2 (Macropain subunit C3) (Multicatalytic endopeptidase complex subunit C3) (Proteasome component C3) (Proteasome subunit alpha-2) (alpha-2)

Protein function

Component of the 20S core proteasome complex involved in the proteolytic degradation of most intracellular proteins. This complex plays numerous essential roles within the cell by associating with different regulatory particles. Associated with

PDB

4R3O , 4R67 , 5A0Q , 5GJQ , 5GJR , 5L4G , 5LE5 , 5LEX , 5LEY , 5LEZ , 5LF0 , 5LF1 , 5LF3 , 5LF4 , 5LF6 , 5LF7 , 5LN3 , 5M32 , 5T0C , 5T0G , 5T0H , 5T0I , 5T0J , 5VFO , 5VFP , 5VFQ , 5VFR , 5VFS , 5VFT , 5VFU , 6AVO , 6E5B , 6KWY , 6MSB , 6MSD , 6MSE , 6MSG , 6MSH , 6MSJ , 6MSK , 6R70 , 6REY , 6RGQ , 6WJD , 6WJN , 6XMJ , 7AWE , 7B12 , 7LXV , 7NAN , 7NAO

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00227	Proteasome	29 → 213	Proteasome subunit	Domain
PF10584	Proteasome_A_N	6 → 28	Proteasome subunit A N-terminal signature	Family

Sequence

MAERGYSFSLTTFSPSGKLVQIEYALAAVAGGAPSVGIKAANGVVLATEKKQKSILYDER
SVHKVEPITKHIGLVYSGMGPDYRVLVHRARKLAQQYYLVYQEPIPTAQLVQRVASVMQE
YTQSGGVRPFGVSLLICGWNEGRPYLFQSDPSGAYFAWKATAMGKNYVNGKTFLEKRYNE
DLELEDAIHTAILTLKESFEGQMTEDNIEVGICNEAGFRRLTPTEVKDYLAAIA

Sequence length

234

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Proteasome	Activation of NF-kappaB in B cells
Alzheimer disease	Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha
Parkinson disease	Cross-presentation of soluble exogenous antigens (endosomes)
Amyotrophic lateral sclerosis	Autodegradation of Cdh1 by Cdh1:APC/C
Huntington disease	SCF-beta-TrCP mediated degradation of Emi1
Spinocerebellar ataxia	APC/C:Cdc20 mediated degradation of Securin
Prion disease	APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1
Pathways of neurodegeneration - multiple diseases	Cdc20:Phospho-APC/C mediated degradation of Cyclin A
	Vpu mediated degradation of CD4
	Vif-mediated degradation of APOBEC3G
	SCF(Skp2)-mediated degradation of p27/p21
	Degradation of beta-catenin by the destruction complex
	Downstream TCR signaling
	Separation of Sister Chromatids
	FCERI mediated NF-kB activation
	Autodegradation of the E3 ubiquitin ligase COP1
	Regulation of ornithine decarboxylase (ODC)
	ABC-family proteins mediated transport
	AUF1 (hnRNP D0) binds and destabilizes mRNA
	Asymmetric localization of PCP proteins
	Degradation of AXIN
	Degradation of DVL
	Hedgehog ligand biogenesis
	Hh mutants that don't undergo autocatalytic processing are degraded by ERAD
	Dectin-1 mediated noncanonical NF-kB signaling
	CLEC7A (Dectin-1) signaling
	Degradation of GLI1 by the proteasome
	GLI3 is processed to GLI3R by the proteasome
	Hedgehog 'on' state
	Regulation of RAS by GAPs
	TNFR2 non-canonical NF-kB pathway
	NIK-->noncanonical NF-kB signaling
	Defective CFTR causes cystic fibrosis
	MAPK6/MAPK4 signaling
	UCH proteinases
	Ub-specific processing proteases
	Neutrophil degranulation
	CDT1 association with the CDC6:ORC:origin complex
	Orc1 removal from chromatin
	CDK-mediated phosphorylation and removal of Cdc6
	G2/M Checkpoints
	Ubiquitin Mediated Degradation of Phosphorylated Cdc25A
	Ubiquitin-dependent degradation of Cyclin D
	The role of GTSE1 in G2/M progression after G2 checkpoint
	FBXL7 down-regulates AURKA during mitotic entry and in early mitosis
	RUNX1 regulates transcription of genes involved in differentiation of HSCs
	Regulation of RUNX2 expression and activity
	Regulation of RUNX3 expression and activity
	Regulation of PTEN stability and activity
	Neddylation
	Interleukin-1 signaling
	Antigen processing: Ubiquitination & Proteasome degradation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
HEART DISEASES	—	CTD, Disgenet CTD, Disgenet	16844662	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOPOROSIS	—	CTD, Disgenet CTD, Disgenet	18924182	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (20)
Amyloidosis	Amyloidosis	Pubtator	15388584	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	39342401	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	11533053	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	33684886	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	39342401	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	CTD_human_DG	16844662		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	29781401	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	28375208		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	31150679		★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
PSMA5	1	["Osteoporosis"]	54	["Proteasome","Parkinson disease","Spinocerebellar ataxia","Prion disease","Regulation of PTEN stability and activity","Ub-specific processing proteases","Neddylation","Separation of Sister Chromatids","ABC-family proteins mediated transport","Regulation of RAS by GAPs","SCF(Skp2)-mediated degradation of p27\/p21","Orc1 removal from chromatin"]	2	["Disgenet (Osteoporosis)","CTD (Osteoporosis)"]
PSMA1	0	[]	54	["Proteasome","Parkinson disease","Spinocerebellar ataxia","Prion disease","Regulation of PTEN stability and activity","Ub-specific processing proteases","Neddylation","Separation of Sister Chromatids","ABC-family proteins mediated transport","Regulation of RAS by GAPs","SCF(Skp2)-mediated degradation of p27\/p21","Orc1 removal from chromatin"]	0	[]
PSMA3	0	[]	54	["Proteasome","Parkinson disease","Spinocerebellar ataxia","Prion disease","Regulation of PTEN stability and activity","Ub-specific processing proteases","Neddylation","Separation of Sister Chromatids","ABC-family proteins mediated transport","Regulation of RAS by GAPs","SCF(Skp2)-mediated degradation of p27\/p21","Orc1 removal from chromatin"]	0	[]
PSMA4	0	[]	54	["Proteasome","Parkinson disease","Spinocerebellar ataxia","Prion disease","Regulation of PTEN stability and activity","Ub-specific processing proteases","Neddylation","Separation of Sister Chromatids","ABC-family proteins mediated transport","Regulation of RAS by GAPs","SCF(Skp2)-mediated degradation of p27\/p21","Orc1 removal from chromatin"]	0	[]
PSMA6	0	[]	54	["Proteasome","Parkinson disease","Spinocerebellar ataxia","Prion disease","Regulation of PTEN stability and activity","Ub-specific processing proteases","Neddylation","Separation of Sister Chromatids","ABC-family proteins mediated transport","Regulation of RAS by GAPs","SCF(Skp2)-mediated degradation of p27\/p21","Orc1 removal from chromatin"]	0	[]

PSMA2 (proteasome 20S subunit alpha 2)

Bookmark This Gene