Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Other IDs Associated diseases
Entrez ID	5682
Gene name	Proteasome 20S subunit alpha 1
Gene symbol	PSMA1
Synonyms (NCBI Gene)	HC2HEL-S-275NUPROS30
Chromosome	11
Chromosome location	11p15.2
Summary	The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta

128

Show/Hide all (128)

miRTarBase ID	miRNA	Experiments	Reference
MIRT454272	hsa-miR-548l	PAR-CLIP	23592263
MIRT454270	hsa-miR-3973	PAR-CLIP	23592263
MIRT454271	hsa-miR-520g-3p	PAR-CLIP	23592263
MIRT454269	hsa-miR-520h	PAR-CLIP	23592263
MIRT454267	hsa-miR-4772-3p	PAR-CLIP	23592263
MIRT454268	hsa-miR-891b	PAR-CLIP	23592263
MIRT454266	hsa-miR-5701	PAR-CLIP	23592263
MIRT454265	hsa-miR-218-1-3p	PAR-CLIP	23592263
MIRT454263	hsa-miR-659-3p	PAR-CLIP	23592263
MIRT454272	hsa-miR-548l	PAR-CLIP	23592263
MIRT454270	hsa-miR-3973	PAR-CLIP	23592263
MIRT454271	hsa-miR-520g-3p	PAR-CLIP	23592263
MIRT454269	hsa-miR-520h	PAR-CLIP	23592263
MIRT454267	hsa-miR-4772-3p	PAR-CLIP	23592263
MIRT454268	hsa-miR-891b	PAR-CLIP	23592263
MIRT454266	hsa-miR-5701	PAR-CLIP	23592263
MIRT454265	hsa-miR-218-1-3p	PAR-CLIP	23592263
MIRT454263	hsa-miR-659-3p	PAR-CLIP	23592263
MIRT1269924	hsa-miR-1200	CLIP-seq
MIRT1269925	hsa-miR-3074-5p	CLIP-seq
MIRT1269926	hsa-miR-3140-5p	CLIP-seq
MIRT1269927	hsa-miR-4670-3p	CLIP-seq
MIRT1269928	hsa-miR-1179	CLIP-seq
MIRT1269929	hsa-miR-2276	CLIP-seq
MIRT1269930	hsa-miR-299-3p	CLIP-seq
MIRT1269931	hsa-miR-3161	CLIP-seq
MIRT1269932	hsa-miR-369-3p	CLIP-seq
MIRT1269933	hsa-miR-374c	CLIP-seq
MIRT1269934	hsa-miR-4491	CLIP-seq
MIRT1269935	hsa-miR-4657	CLIP-seq
MIRT1269936	hsa-miR-4742-3p	CLIP-seq
MIRT1269937	hsa-miR-520g	CLIP-seq
MIRT1269938	hsa-miR-550a	CLIP-seq
MIRT1269939	hsa-miR-600	CLIP-seq
MIRT1269940	hsa-miR-630	CLIP-seq
MIRT1269941	hsa-miR-655	CLIP-seq
MIRT1269942	hsa-miR-659	CLIP-seq
MIRT1269928	hsa-miR-1179	CLIP-seq
MIRT1269943	hsa-miR-1273e	CLIP-seq
MIRT1269944	hsa-miR-1294	CLIP-seq
MIRT1269929	hsa-miR-2276	CLIP-seq
MIRT1269930	hsa-miR-299-3p	CLIP-seq
MIRT1269945	hsa-miR-3148	CLIP-seq
MIRT1269946	hsa-miR-3662	CLIP-seq
MIRT1269947	hsa-miR-3978	CLIP-seq
MIRT1269948	hsa-miR-4276	CLIP-seq
MIRT1269949	hsa-miR-4464	CLIP-seq
MIRT1269934	hsa-miR-4491	CLIP-seq
MIRT1269950	hsa-miR-4528	CLIP-seq
MIRT1269935	hsa-miR-4657	CLIP-seq
MIRT1269936	hsa-miR-4742-3p	CLIP-seq
MIRT1269951	hsa-miR-4748	CLIP-seq
MIRT1269952	hsa-miR-4777-5p	CLIP-seq
MIRT1269953	hsa-miR-4789-5p	CLIP-seq
MIRT1269954	hsa-miR-518d-5p	CLIP-seq
MIRT1269955	hsa-miR-519b-5p	CLIP-seq
MIRT1269956	hsa-miR-519c-5p	CLIP-seq
MIRT1269957	hsa-miR-520c-5p	CLIP-seq
MIRT1269937	hsa-miR-520g	CLIP-seq
MIRT1269958	hsa-miR-526a	CLIP-seq
MIRT1269959	hsa-miR-548ae	CLIP-seq
MIRT1269960	hsa-miR-548aj	CLIP-seq
MIRT1269961	hsa-miR-548am	CLIP-seq
MIRT1269962	hsa-miR-548x	CLIP-seq
MIRT1269938	hsa-miR-550a	CLIP-seq
MIRT1269939	hsa-miR-600	CLIP-seq
MIRT1269940	hsa-miR-630	CLIP-seq
MIRT1269942	hsa-miR-659	CLIP-seq
MIRT1269963	hsa-miR-660	CLIP-seq
MIRT1269964	hsa-miR-885-5p	CLIP-seq
MIRT1269928	hsa-miR-1179	CLIP-seq
MIRT1269946	hsa-miR-3662	CLIP-seq
MIRT1269952	hsa-miR-4777-5p	CLIP-seq
MIRT1269953	hsa-miR-4789-5p	CLIP-seq
MIRT1269954	hsa-miR-518d-5p	CLIP-seq
MIRT1269955	hsa-miR-519b-5p	CLIP-seq
MIRT1269956	hsa-miR-519c-5p	CLIP-seq
MIRT1269957	hsa-miR-520c-5p	CLIP-seq
MIRT1269958	hsa-miR-526a	CLIP-seq
MIRT1269959	hsa-miR-548ae	CLIP-seq
MIRT1269960	hsa-miR-548aj	CLIP-seq
MIRT1269961	hsa-miR-548am	CLIP-seq
MIRT1269962	hsa-miR-548x	CLIP-seq
MIRT1269928	hsa-miR-1179	CLIP-seq
MIRT2602752	hsa-miR-128	CLIP-seq
MIRT2602753	hsa-miR-151-3p	CLIP-seq
MIRT1269929	hsa-miR-2276	CLIP-seq
MIRT2602754	hsa-miR-27a	CLIP-seq
MIRT2602755	hsa-miR-27b	CLIP-seq
MIRT1269930	hsa-miR-299-3p	CLIP-seq
MIRT1269931	hsa-miR-3161	CLIP-seq
MIRT1269932	hsa-miR-369-3p	CLIP-seq
MIRT1269933	hsa-miR-374c	CLIP-seq
MIRT2602756	hsa-miR-4463	CLIP-seq
MIRT1269934	hsa-miR-4491	CLIP-seq
MIRT2602757	hsa-miR-4499	CLIP-seq
MIRT1269935	hsa-miR-4657	CLIP-seq
MIRT1269936	hsa-miR-4742-3p	CLIP-seq
MIRT2602758	hsa-miR-494	CLIP-seq
MIRT2602759	hsa-miR-511	CLIP-seq
MIRT2602760	hsa-miR-513a-5p	CLIP-seq
MIRT1269937	hsa-miR-520g	CLIP-seq
MIRT1269938	hsa-miR-550a	CLIP-seq
MIRT2602761	hsa-miR-590-3p	CLIP-seq
MIRT1269939	hsa-miR-600	CLIP-seq
MIRT1269940	hsa-miR-630	CLIP-seq
MIRT1269941	hsa-miR-655	CLIP-seq
MIRT1269942	hsa-miR-659	CLIP-seq
MIRT2602762	hsa-miR-892b	CLIP-seq
MIRT1269928	hsa-miR-1179	CLIP-seq
MIRT2602753	hsa-miR-151-3p	CLIP-seq
MIRT1269929	hsa-miR-2276	CLIP-seq
MIRT1269930	hsa-miR-299-3p	CLIP-seq
MIRT1269931	hsa-miR-3161	CLIP-seq
MIRT1269932	hsa-miR-369-3p	CLIP-seq
MIRT1269933	hsa-miR-374c	CLIP-seq
MIRT2602756	hsa-miR-4463	CLIP-seq
MIRT1269934	hsa-miR-4491	CLIP-seq
MIRT2602757	hsa-miR-4499	CLIP-seq
MIRT1269935	hsa-miR-4657	CLIP-seq
MIRT1269936	hsa-miR-4742-3p	CLIP-seq
MIRT1269937	hsa-miR-520g	CLIP-seq
MIRT1269938	hsa-miR-550a	CLIP-seq
MIRT1269939	hsa-miR-600	CLIP-seq
MIRT1269940	hsa-miR-630	CLIP-seq
MIRT1269941	hsa-miR-655	CLIP-seq
MIRT1269942	hsa-miR-659	CLIP-seq
MIRT2602762	hsa-miR-892b	CLIP-seq

Show/Hide all (30)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000502	Component	Proteasome complex	IDA	17323924
GO:0000502	Component	Proteasome complex	IEA
GO:0000502	Component	Proteasome complex	NAS	29636472
GO:0000502	Component	Proteasome complex	TAS	8811196
GO:0001530	Function	Lipopolysaccharide binding	IEA
GO:0002376	Process	Immune system process	IEA
GO:0002862	Process	Negative regulation of inflammatory response to antigenic stimulus	IEA
GO:0005515	Function	Protein binding	IPI	12376572, 14733938, 15225636, 16189514, 17292860, 17948026, 19060904, 21516116, 21988832, 25416956, 25599644, 29568061, 29636472, 29804830, 29892012, 31473102, 31515488, 32296183, 32814053, 33961781, 34702852, 35271311, 35858375, 37776851
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	34711951
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	34711951
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IDA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005839	Component	Proteasome core complex	IDA	34711951
GO:0005839	Component	Proteasome core complex	IEA
GO:0005839	Component	Proteasome core complex	ISS
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IEA
GO:0019773	Component	Proteasome core complex, alpha-subunit complex	IBA
GO:0019773	Component	Proteasome core complex, alpha-subunit complex	IEA
GO:0019773	Component	Proteasome core complex, alpha-subunit complex	ISS
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IBA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	NAS	19489727
GO:0051603	Process	Proteolysis involved in protein catabolic process	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867, 20458337, 23533145

MIM	HGNC	e!Ensembl
602854	9530	ENSG00000129084

P25786

Protein name

Proteasome subunit alpha type-1 (30 kDa prosomal protein) (PROS-30) (Macropain subunit C2) (Multicatalytic endopeptidase complex subunit C2) (Proteasome component C2) (Proteasome nu chain) (Proteasome subunit alpha-6) (alpha-6)

Protein function

Component of the 20S core proteasome complex involved in the proteolytic degradation of most intracellular proteins. This complex plays numerous essential roles within the cell by associating with different regulatory particles. Associated with

PDB

4R3O , 4R67 , 5A0Q , 5GJQ , 5GJR , 5L4G , 5LE5 , 5LEX , 5LEY , 5LEZ , 5LF0 , 5LF1 , 5LF3 , 5LF4 , 5LF6 , 5LF7 , 5LN3 , 5M32 , 5T0C , 5T0G , 5T0H , 5T0I , 5T0J , 5VFO , 5VFP , 5VFQ , 5VFR , 5VFS , 5VFT , 5VFU , 6AVO , 6E5B , 6KWY , 6MSB , 6MSD , 6MSE , 6MSG , 6MSH , 6MSJ , 6MSK , 6R70 , 6REY , 6RGQ , 6WJD , 6WJN , 6XMJ , 7AWE , 7B12 , 7LXV , 7NAN , 7NAO

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF10584	Proteasome_A_N	6 → 28	Proteasome subunit A N-terminal signature	Family
PF00227	Proteasome	29 → 215	Proteasome subunit	Domain

Sequence

MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQ
KKILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPT
QRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMSIGARSQSARTYLERHMSEFM
ECNLNELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDLEFTIYDDDDVSPFLEGLEERP
QRKAQPAQPADEPAEKADEPMEH

Sequence length

263

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Colon adenocarcinoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (29)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Breast Neoplasms	Breast neoplasm	Pubtator	17127214	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	25206290	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	36776923	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	18021222, 28943170		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	17433827, 18021222		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	18021222, 28943170		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	25206290, 34120619	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	36076300	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	27966459		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	32664164	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	24069164	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	22685174	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	27966459		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	27635024, 27896369, 28280856, 28986509, 29572670, 31529265		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	27966459		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	16950021, 18847555, 30006752		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	18021222, 28943170		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	33615715	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	22685174	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	24156825, 24859841, 31214958		★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	27857231		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oral Submucous Fibrosis	Oral Submucous Fibrosis	BEFREE	20863370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	32210219	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	27635024, 27896369, 28280856, 28474140, 28986509, 29572670, 31529265		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatic Heart Disease	Rheumatic heart disease	Pubtator	24738046	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	27966459		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	27966459, 37222416	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	Pubtator	28390009	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular Remodeling	Ventricular remodeling	Pubtator	32664164	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only

PSMA1 (proteasome 20S subunit alpha 1)