PSMA1 (proteasome 20S subunit alpha 1)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 5682
• Gene name: Proteasome 20S subunit alpha 1
• Gene symbol: PSMA1
• Synonyms (NCBI Gene): HC2, HEL-S-275, NU, PROS30
• Chromosome: 11
• Chromosome location: 11p15.2
• Summary: The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta

miRNA Show/Hide all (128)

miRTarBase ID	miRNA	Experiments	Reference
MIRT454272	hsa-miR-548l	PAR-CLIP	23592263
MIRT454270	hsa-miR-3973	PAR-CLIP	23592263
MIRT454271	hsa-miR-520g-3p	PAR-CLIP	23592263
MIRT454269	hsa-miR-520h	PAR-CLIP	23592263
MIRT454267	hsa-miR-4772-3p	PAR-CLIP	23592263
MIRT454268	hsa-miR-891b	PAR-CLIP	23592263
MIRT454266	hsa-miR-5701	PAR-CLIP	23592263
MIRT454265	hsa-miR-218-1-3p	PAR-CLIP	23592263
MIRT454263	hsa-miR-659-3p	PAR-CLIP	23592263
MIRT454272	hsa-miR-548l	PAR-CLIP	23592263
MIRT454270	hsa-miR-3973	PAR-CLIP	23592263
MIRT454271	hsa-miR-520g-3p	PAR-CLIP	23592263
MIRT454269	hsa-miR-520h	PAR-CLIP	23592263
MIRT454267	hsa-miR-4772-3p	PAR-CLIP	23592263
MIRT454268	hsa-miR-891b	PAR-CLIP	23592263
MIRT454266	hsa-miR-5701	PAR-CLIP	23592263
MIRT454265	hsa-miR-218-1-3p	PAR-CLIP	23592263
MIRT454263	hsa-miR-659-3p	PAR-CLIP	23592263
MIRT1269924	hsa-miR-1200	CLIP-seq
MIRT1269925	hsa-miR-3074-5p	CLIP-seq
MIRT1269926	hsa-miR-3140-5p	CLIP-seq
MIRT1269927	hsa-miR-4670-3p	CLIP-seq
MIRT1269928	hsa-miR-1179	CLIP-seq
MIRT1269929	hsa-miR-2276	CLIP-seq
MIRT1269930	hsa-miR-299-3p	CLIP-seq
MIRT1269931	hsa-miR-3161	CLIP-seq
MIRT1269932	hsa-miR-369-3p	CLIP-seq
MIRT1269933	hsa-miR-374c	CLIP-seq
MIRT1269934	hsa-miR-4491	CLIP-seq
MIRT1269935	hsa-miR-4657	CLIP-seq
MIRT1269936	hsa-miR-4742-3p	CLIP-seq
MIRT1269937	hsa-miR-520g	CLIP-seq
MIRT1269938	hsa-miR-550a	CLIP-seq
MIRT1269939	hsa-miR-600	CLIP-seq
MIRT1269940	hsa-miR-630	CLIP-seq
MIRT1269941	hsa-miR-655	CLIP-seq
MIRT1269942	hsa-miR-659	CLIP-seq
MIRT1269928	hsa-miR-1179	CLIP-seq
MIRT1269943	hsa-miR-1273e	CLIP-seq
MIRT1269944	hsa-miR-1294	CLIP-seq
MIRT1269929	hsa-miR-2276	CLIP-seq
MIRT1269930	hsa-miR-299-3p	CLIP-seq
MIRT1269945	hsa-miR-3148	CLIP-seq
MIRT1269946	hsa-miR-3662	CLIP-seq
MIRT1269947	hsa-miR-3978	CLIP-seq
MIRT1269948	hsa-miR-4276	CLIP-seq
MIRT1269949	hsa-miR-4464	CLIP-seq
MIRT1269934	hsa-miR-4491	CLIP-seq
MIRT1269950	hsa-miR-4528	CLIP-seq
MIRT1269935	hsa-miR-4657	CLIP-seq
MIRT1269936	hsa-miR-4742-3p	CLIP-seq
MIRT1269951	hsa-miR-4748	CLIP-seq
MIRT1269952	hsa-miR-4777-5p	CLIP-seq
MIRT1269953	hsa-miR-4789-5p	CLIP-seq
MIRT1269954	hsa-miR-518d-5p	CLIP-seq
MIRT1269955	hsa-miR-519b-5p	CLIP-seq
MIRT1269956	hsa-miR-519c-5p	CLIP-seq
MIRT1269957	hsa-miR-520c-5p	CLIP-seq
MIRT1269937	hsa-miR-520g	CLIP-seq
MIRT1269958	hsa-miR-526a	CLIP-seq
MIRT1269959	hsa-miR-548ae	CLIP-seq
MIRT1269960	hsa-miR-548aj	CLIP-seq
MIRT1269961	hsa-miR-548am	CLIP-seq
MIRT1269962	hsa-miR-548x	CLIP-seq
MIRT1269938	hsa-miR-550a	CLIP-seq
MIRT1269939	hsa-miR-600	CLIP-seq
MIRT1269940	hsa-miR-630	CLIP-seq
MIRT1269942	hsa-miR-659	CLIP-seq
MIRT1269963	hsa-miR-660	CLIP-seq
MIRT1269964	hsa-miR-885-5p	CLIP-seq
MIRT1269928	hsa-miR-1179	CLIP-seq
MIRT1269946	hsa-miR-3662	CLIP-seq
MIRT1269952	hsa-miR-4777-5p	CLIP-seq
MIRT1269953	hsa-miR-4789-5p	CLIP-seq
MIRT1269954	hsa-miR-518d-5p	CLIP-seq
MIRT1269955	hsa-miR-519b-5p	CLIP-seq
MIRT1269956	hsa-miR-519c-5p	CLIP-seq
MIRT1269957	hsa-miR-520c-5p	CLIP-seq
MIRT1269958	hsa-miR-526a	CLIP-seq
MIRT1269959	hsa-miR-548ae	CLIP-seq
MIRT1269960	hsa-miR-548aj	CLIP-seq
MIRT1269961	hsa-miR-548am	CLIP-seq
MIRT1269962	hsa-miR-548x	CLIP-seq
MIRT1269928	hsa-miR-1179	CLIP-seq
MIRT2602752	hsa-miR-128	CLIP-seq
MIRT2602753	hsa-miR-151-3p	CLIP-seq
MIRT1269929	hsa-miR-2276	CLIP-seq
MIRT2602754	hsa-miR-27a	CLIP-seq
MIRT2602755	hsa-miR-27b	CLIP-seq
MIRT1269930	hsa-miR-299-3p	CLIP-seq
MIRT1269931	hsa-miR-3161	CLIP-seq
MIRT1269932	hsa-miR-369-3p	CLIP-seq
MIRT1269933	hsa-miR-374c	CLIP-seq
MIRT2602756	hsa-miR-4463	CLIP-seq
MIRT1269934	hsa-miR-4491	CLIP-seq
MIRT2602757	hsa-miR-4499	CLIP-seq
MIRT1269935	hsa-miR-4657	CLIP-seq
MIRT1269936	hsa-miR-4742-3p	CLIP-seq
MIRT2602758	hsa-miR-494	CLIP-seq
MIRT2602759	hsa-miR-511	CLIP-seq
MIRT2602760	hsa-miR-513a-5p	CLIP-seq
MIRT1269937	hsa-miR-520g	CLIP-seq
MIRT1269938	hsa-miR-550a	CLIP-seq
MIRT2602761	hsa-miR-590-3p	CLIP-seq
MIRT1269939	hsa-miR-600	CLIP-seq
MIRT1269940	hsa-miR-630	CLIP-seq
MIRT1269941	hsa-miR-655	CLIP-seq
MIRT1269942	hsa-miR-659	CLIP-seq
MIRT2602762	hsa-miR-892b	CLIP-seq
MIRT1269928	hsa-miR-1179	CLIP-seq
MIRT2602753	hsa-miR-151-3p	CLIP-seq
MIRT1269929	hsa-miR-2276	CLIP-seq
MIRT1269930	hsa-miR-299-3p	CLIP-seq
MIRT1269931	hsa-miR-3161	CLIP-seq
MIRT1269932	hsa-miR-369-3p	CLIP-seq
MIRT1269933	hsa-miR-374c	CLIP-seq
MIRT2602756	hsa-miR-4463	CLIP-seq
MIRT1269934	hsa-miR-4491	CLIP-seq
MIRT2602757	hsa-miR-4499	CLIP-seq
MIRT1269935	hsa-miR-4657	CLIP-seq
MIRT1269936	hsa-miR-4742-3p	CLIP-seq
MIRT1269937	hsa-miR-520g	CLIP-seq
MIRT1269938	hsa-miR-550a	CLIP-seq
MIRT1269939	hsa-miR-600	CLIP-seq
MIRT1269940	hsa-miR-630	CLIP-seq
MIRT1269941	hsa-miR-655	CLIP-seq
MIRT1269942	hsa-miR-659	CLIP-seq
MIRT2602762	hsa-miR-892b	CLIP-seq

Gene ontology (GO) Show/Hide all (30)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000502	Component	Proteasome complex	IDA	17323924
GO:0000502	Component	Proteasome complex	IEA
GO:0000502	Component	Proteasome complex	NAS	29636472
GO:0000502	Component	Proteasome complex	TAS	8811196
GO:0001530	Function	Lipopolysaccharide binding	IEA
GO:0002376	Process	Immune system process	IEA
GO:0002862	Process	Negative regulation of inflammatory response to antigenic stimulus	IEA
GO:0005515	Function	Protein binding	IPI	12376572, 14733938, 15225636, 16189514, 17292860, 17948026, 19060904, 21516116, 21988832, 25416956, 25599644, 29568061, 29636472, 29804830, 29892012, 31473102, 31515488, 32296183, 32814053, 33961781, 34702852, 35271311, 35858375, 37776851
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	34711951
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	34711951
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IDA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005839	Component	Proteasome core complex	IDA	34711951
GO:0005839	Component	Proteasome core complex	IEA
GO:0005839	Component	Proteasome core complex	ISS
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IEA
GO:0019773	Component	Proteasome core complex, alpha-subunit complex	IBA
GO:0019773	Component	Proteasome core complex, alpha-subunit complex	IEA
GO:0019773	Component	Proteasome core complex, alpha-subunit complex	ISS
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IBA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	NAS	19489727
GO:0051603	Process	Proteolysis involved in protein catabolic process	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867, 20458337, 23533145

Other IDs

• MIM: 602854
• HGNC: 9530
• e!Ensembl: ENSG00000129084

Protein

• UniProt ID: P25786
• Protein name: Proteasome subunit alpha type-1 (30 kDa prosomal protein) (PROS-30) (Macropain subunit C2) (Multicatalytic endopeptidase complex subunit C2) (Proteasome component C2) (Proteasome nu chain) (Proteasome subunit alpha-6) (alpha-6)
• Protein function: Component of the 20S core proteasome complex involved in the proteolytic degradation of most intracellular proteins. This complex plays numerous essential roles within the cell by associating with different regulatory particles. Associated with
• PDB: 4R3O , 4R67 , 5A0Q , 5GJQ , 5GJR , 5L4G , 5LE5 , 5LEX , 5LEY , 5LEZ , 5LF0 , 5LF1 , 5LF3 , 5LF4 , 5LF6 , 5LF7 , 5LN3 , 5M32 , 5T0C , 5T0G , 5T0H , 5T0I , 5T0J , 5VFO , 5VFP , 5VFQ , 5VFR , 5VFS , 5VFT , 5VFU , 6AVO , 6E5B , 6KWY , 6MSB , 6MSD , 6MSE , 6MSG , 6MSH , 6MSJ , 6MSK , 6R70 , 6REY , 6RGQ , 6WJD , 6WJN , 6XMJ , 7AWE , 7B12 , 7LXV , 7NAN , 7NAO
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00227	Proteasome	29 → 215	Proteasome subunit	Domain
  PF10584	Proteasome_A_N	6 → 28	Proteasome subunit A N-terminal signature	Family

• Sequence:

  MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQ
  KKILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPT
  QRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMSIGARSQSARTYLERHMSEFM
  ECNLNELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDLEFTIYDDDDVSPFLEGLEERP
  QRKAQPAQPADEPAEKADEPMEH

• Sequence length: 263

Pathways

KEGG Pathway	Reactome Pathway
Proteasome	Activation of NF-kappaB in B cells
Alzheimer disease	Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha
Parkinson disease	Cross-presentation of soluble exogenous antigens (endosomes)
Amyotrophic lateral sclerosis	Autodegradation of Cdh1 by Cdh1:APC/C
Huntington disease	SCF-beta-TrCP mediated degradation of Emi1
Spinocerebellar ataxia	APC/C:Cdc20 mediated degradation of Securin
Prion disease	APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1
Pathways of neurodegeneration - multiple diseases	Cdc20:Phospho-APC/C mediated degradation of Cyclin A
	Vpu mediated degradation of CD4
	Vif-mediated degradation of APOBEC3G
	SCF(Skp2)-mediated degradation of p27/p21
	Degradation of beta-catenin by the destruction complex
	Downstream TCR signaling
	Separation of Sister Chromatids
	FCERI mediated NF-kB activation
	Autodegradation of the E3 ubiquitin ligase COP1
	Regulation of ornithine decarboxylase (ODC)
	ABC-family proteins mediated transport
	AUF1 (hnRNP D0) binds and destabilizes mRNA
	Asymmetric localization of PCP proteins
	Degradation of AXIN
	Degradation of DVL
	Hedgehog ligand biogenesis
	Hh mutants that don't undergo autocatalytic processing are degraded by ERAD
	Dectin-1 mediated noncanonical NF-kB signaling
	CLEC7A (Dectin-1) signaling
	Degradation of GLI1 by the proteasome
	GLI3 is processed to GLI3R by the proteasome
	Hedgehog 'on' state
	Regulation of RAS by GAPs
	TNFR2 non-canonical NF-kB pathway
	NIK-->noncanonical NF-kB signaling
	Defective CFTR causes cystic fibrosis
	MAPK6/MAPK4 signaling
	UCH proteinases
	Ub-specific processing proteases
	CDT1 association with the CDC6:ORC:origin complex
	Orc1 removal from chromatin
	CDK-mediated phosphorylation and removal of Cdc6
	G2/M Checkpoints
	Ubiquitin Mediated Degradation of Phosphorylated Cdc25A
	Ubiquitin-dependent degradation of Cyclin D
	The role of GTSE1 in G2/M progression after G2 checkpoint
	FBXL7 down-regulates AURKA during mitotic entry and in early mitosis
	RUNX1 regulates transcription of genes involved in differentiation of HSCs
	Regulation of RUNX2 expression and activity
	Regulation of RUNX3 expression and activity
	Regulation of PTEN stability and activity
	Neddylation
	Interleukin-1 signaling
	Antigen processing: Ubiquitination & Proteasome degradation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Colon adenocarcinoma	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (29)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Breast Neoplasms	Breast neoplasm	Pubtator	17127214	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	25206290	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	36776923	Associate	★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	18021222, 28943170		★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	17433827, 18021222		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	18021222, 28943170		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	25206290, 34120619	Associate	★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	36076300	Associate	★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	27966459		★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	32664164	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

PSMA2 54 shared pathwaysProteasome, Parkinson disease, Spinocerebellar ataxia, Prion disease, Regulation of PTEN stability and activity, Ub-specific processing proteases, Neddylation, Separation of Sister Chromatids, ABC-family proteins mediated transport, Regulation of RAS by GAPs, SCF(Skp2)-mediated degradation of p27/p21, Orc1 removal from chromatin +42 more Related via 54 shared pathways including Proteasome, Parkinson disease. PSMA3 54 shared pathwaysProteasome, Parkinson disease, Spinocerebellar ataxia, Prion disease, Regulation of PTEN stability and activity, Ub-specific processing proteases, Neddylation, Separation of Sister Chromatids, ABC-family proteins mediated transport, Regulation of RAS by GAPs, SCF(Skp2)-mediated degradation of p27/p21, Orc1 removal from chromatin +42 more Related via 54 shared pathways including Proteasome, Parkinson disease. PSMA4 54 shared pathwaysProteasome, Parkinson disease, Spinocerebellar ataxia, Prion disease, Regulation of PTEN stability and activity, Ub-specific processing proteases, Neddylation, Separation of Sister Chromatids, ABC-family proteins mediated transport, Regulation of RAS by GAPs, SCF(Skp2)-mediated degradation of p27/p21, Orc1 removal from chromatin +42 more Related via 54 shared pathways including Proteasome, Parkinson disease. PSMA5 54 shared pathwaysProteasome, Parkinson disease, Spinocerebellar ataxia, Prion disease, Regulation of PTEN stability and activity, Ub-specific processing proteases, Neddylation, Separation of Sister Chromatids, ABC-family proteins mediated transport, Regulation of RAS by GAPs, SCF(Skp2)-mediated degradation of p27/p21, Orc1 removal from chromatin +42 more Related via 54 shared pathways including Proteasome, Parkinson disease. PSMA6 54 shared pathwaysProteasome, Parkinson disease, Spinocerebellar ataxia, Prion disease, Regulation of PTEN stability and activity, Ub-specific processing proteases, Neddylation, Separation of Sister Chromatids, ABC-family proteins mediated transport, Regulation of RAS by GAPs, SCF(Skp2)-mediated degradation of p27/p21, Orc1 removal from chromatin +42 more Related via 54 shared pathways including Proteasome, Parkinson disease.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
PSMA2	0	[]	54	["Proteasome","Parkinson disease","Spinocerebellar ataxia","Prion disease","Regulation of PTEN stability and activity","Ub-specific processing proteases","Neddylation","Separation of Sister Chromatids","ABC-family proteins mediated transport","Regulation of RAS by GAPs","SCF(Skp2)-mediated degradation of p27\/p21","Orc1 removal from chromatin"]	0	[]
PSMA3	0	[]	54	["Proteasome","Parkinson disease","Spinocerebellar ataxia","Prion disease","Regulation of PTEN stability and activity","Ub-specific processing proteases","Neddylation","Separation of Sister Chromatids","ABC-family proteins mediated transport","Regulation of RAS by GAPs","SCF(Skp2)-mediated degradation of p27\/p21","Orc1 removal from chromatin"]	0	[]
PSMA4	0	[]	54	["Proteasome","Parkinson disease","Spinocerebellar ataxia","Prion disease","Regulation of PTEN stability and activity","Ub-specific processing proteases","Neddylation","Separation of Sister Chromatids","ABC-family proteins mediated transport","Regulation of RAS by GAPs","SCF(Skp2)-mediated degradation of p27\/p21","Orc1 removal from chromatin"]	0	[]
PSMA5	0	[]	54	["Proteasome","Parkinson disease","Spinocerebellar ataxia","Prion disease","Regulation of PTEN stability and activity","Ub-specific processing proteases","Neddylation","Separation of Sister Chromatids","ABC-family proteins mediated transport","Regulation of RAS by GAPs","SCF(Skp2)-mediated degradation of p27\/p21","Orc1 removal from chromatin"]	0	[]
PSMA6	0	[]	54	["Proteasome","Parkinson disease","Spinocerebellar ataxia","Prion disease","Regulation of PTEN stability and activity","Ub-specific processing proteases","Neddylation","Separation of Sister Chromatids","ABC-family proteins mediated transport","Regulation of RAS by GAPs","SCF(Skp2)-mediated degradation of p27\/p21","Orc1 removal from chromatin"]	0	[]

Diseases Linked via Similar Genes

Osteoporosis Linked via 2 of 5 related genesPSMA2, PSMA5 Heart disease Linked via 1 of 5 related genesPSMA2 Proteasome associated autoinflammatory syndrome Linked via 1 of 5 related genesPSMA3 Atherosclerosis Linked via 1 of 5 related genesPSMA4 Carcinoma Linked via 1 of 5 related genesPSMA4

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Osteoporosis	2	["PSMA2","PSMA5"]
Heart disease	1	["PSMA2"]
Proteasome associated autoinflammatory syndrome	1	["PSMA3"]
Atherosclerosis	1	["PSMA4"]
Carcinoma	1	["PSMA4"]