Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	5685
Gene name	Proteasome 20S subunit alpha 4
Gene symbol	PSMA4
Synonyms (NCBI Gene)	HC9HsT17706PSC9
Chromosome	15
Chromosome location	15q25.1
Summary	This gene encodes a core alpha subunit of the 20S proteosome, which is a highly ordered ring-shaped structure composed of four rings of 28 non-identical subunits. Proteasomes cleave peptides in an ATP- and ubiquitin-dependent manner. [provided by RefSeq,

133 Show/Hide all (133)

miRTarBase ID	miRNA	Experiments	Reference
MIRT049531	hsa-miR-92a-3p	CLASH	23622248
MIRT043029	hsa-miR-324-5p	CLASH	23622248
MIRT1270002	hsa-miR-142-5p	CLIP-seq
MIRT1270003	hsa-miR-208a	CLIP-seq
MIRT1270004	hsa-miR-208b	CLIP-seq
MIRT1270005	hsa-miR-3179	CLIP-seq
MIRT1270006	hsa-miR-338-5p	CLIP-seq
MIRT1270007	hsa-miR-4272	CLIP-seq
MIRT1270008	hsa-miR-4520a-3p	CLIP-seq
MIRT1270009	hsa-miR-4520b-3p	CLIP-seq
MIRT1270010	hsa-miR-4699-5p	CLIP-seq
MIRT1270011	hsa-miR-499-5p	CLIP-seq
MIRT1270012	hsa-miR-548a-5p	CLIP-seq
MIRT1270013	hsa-miR-548ab	CLIP-seq
MIRT1270014	hsa-miR-548ak	CLIP-seq
MIRT1270015	hsa-miR-548b-5p	CLIP-seq
MIRT1270016	hsa-miR-548c-5p	CLIP-seq
MIRT1270017	hsa-miR-548d-5p	CLIP-seq
MIRT1270018	hsa-miR-548h	CLIP-seq
MIRT1270019	hsa-miR-548i	CLIP-seq
MIRT1270020	hsa-miR-548j	CLIP-seq
MIRT1270021	hsa-miR-548k	CLIP-seq
MIRT1270022	hsa-miR-548l	CLIP-seq
MIRT1270023	hsa-miR-548w	CLIP-seq
MIRT1270024	hsa-miR-548y	CLIP-seq
MIRT1270025	hsa-miR-559	CLIP-seq
MIRT1270007	hsa-miR-4272	CLIP-seq
MIRT1270012	hsa-miR-548a-5p	CLIP-seq
MIRT1270013	hsa-miR-548ab	CLIP-seq
MIRT1270014	hsa-miR-548ak	CLIP-seq
MIRT1270015	hsa-miR-548b-5p	CLIP-seq
MIRT1270016	hsa-miR-548c-5p	CLIP-seq
MIRT1270017	hsa-miR-548d-5p	CLIP-seq
MIRT1270018	hsa-miR-548h	CLIP-seq
MIRT1270019	hsa-miR-548i	CLIP-seq
MIRT1270020	hsa-miR-548j	CLIP-seq
MIRT1270021	hsa-miR-548k	CLIP-seq
MIRT1270022	hsa-miR-548l	CLIP-seq
MIRT1270023	hsa-miR-548w	CLIP-seq
MIRT1270024	hsa-miR-548y	CLIP-seq
MIRT1270025	hsa-miR-559	CLIP-seq
MIRT2602776	hsa-miR-1260	CLIP-seq
MIRT2602777	hsa-miR-1260b	CLIP-seq
MIRT2602778	hsa-miR-188-3p	CLIP-seq
MIRT2602779	hsa-miR-203	CLIP-seq
MIRT2602780	hsa-miR-216b	CLIP-seq
MIRT2602781	hsa-miR-3117-3p	CLIP-seq
MIRT2602782	hsa-miR-3130-3p	CLIP-seq
MIRT2602783	hsa-miR-3156-3p	CLIP-seq
MIRT2602784	hsa-miR-3163	CLIP-seq
MIRT2602785	hsa-miR-3169	CLIP-seq
MIRT2602786	hsa-miR-3189-5p	CLIP-seq
MIRT2602787	hsa-miR-3190	CLIP-seq
MIRT2602788	hsa-miR-3614-3p	CLIP-seq
MIRT2602789	hsa-miR-3667-3p	CLIP-seq
MIRT2602790	hsa-miR-380	CLIP-seq
MIRT2602791	hsa-miR-384	CLIP-seq
MIRT2602792	hsa-miR-3911	CLIP-seq
MIRT2602793	hsa-miR-3920	CLIP-seq
MIRT2602794	hsa-miR-3921	CLIP-seq
MIRT2602795	hsa-miR-4297	CLIP-seq
MIRT2602796	hsa-miR-4301	CLIP-seq
MIRT2602797	hsa-miR-4446-5p	CLIP-seq
MIRT2602798	hsa-miR-4495	CLIP-seq
MIRT2602799	hsa-miR-4653-5p	CLIP-seq
MIRT2602800	hsa-miR-4668-3p	CLIP-seq
MIRT2602801	hsa-miR-4758-3p	CLIP-seq
MIRT2602802	hsa-miR-4759	CLIP-seq
MIRT2602803	hsa-miR-522	CLIP-seq
MIRT1270012	hsa-miR-548a-5p	CLIP-seq
MIRT1270013	hsa-miR-548ab	CLIP-seq
MIRT1270014	hsa-miR-548ak	CLIP-seq
MIRT1270015	hsa-miR-548b-5p	CLIP-seq
MIRT1270016	hsa-miR-548c-5p	CLIP-seq
MIRT1270017	hsa-miR-548d-5p	CLIP-seq
MIRT1270018	hsa-miR-548h	CLIP-seq
MIRT1270019	hsa-miR-548i	CLIP-seq
MIRT1270020	hsa-miR-548j	CLIP-seq
MIRT2602804	hsa-miR-548n	CLIP-seq
MIRT1270023	hsa-miR-548w	CLIP-seq
MIRT1270024	hsa-miR-548y	CLIP-seq
MIRT1270025	hsa-miR-559	CLIP-seq
MIRT2602805	hsa-miR-648	CLIP-seq
MIRT2602806	hsa-miR-676	CLIP-seq
MIRT2602807	hsa-miR-7	CLIP-seq
MIRT2602808	hsa-miR-711	CLIP-seq
MIRT2602809	hsa-miR-767-5p	CLIP-seq
MIRT2602776	hsa-miR-1260	CLIP-seq
MIRT2602777	hsa-miR-1260b	CLIP-seq
MIRT2602778	hsa-miR-188-3p	CLIP-seq
MIRT2602779	hsa-miR-203	CLIP-seq
MIRT2602780	hsa-miR-216b	CLIP-seq
MIRT2602781	hsa-miR-3117-3p	CLIP-seq
MIRT2602782	hsa-miR-3130-3p	CLIP-seq
MIRT2602783	hsa-miR-3156-3p	CLIP-seq
MIRT2602784	hsa-miR-3163	CLIP-seq
MIRT2602785	hsa-miR-3169	CLIP-seq
MIRT2602786	hsa-miR-3189-5p	CLIP-seq
MIRT2602787	hsa-miR-3190	CLIP-seq
MIRT2602788	hsa-miR-3614-3p	CLIP-seq
MIRT2602789	hsa-miR-3667-3p	CLIP-seq
MIRT2602790	hsa-miR-380	CLIP-seq
MIRT2602791	hsa-miR-384	CLIP-seq
MIRT2602792	hsa-miR-3911	CLIP-seq
MIRT2602793	hsa-miR-3920	CLIP-seq
MIRT2602794	hsa-miR-3921	CLIP-seq
MIRT2602795	hsa-miR-4297	CLIP-seq
MIRT2602796	hsa-miR-4301	CLIP-seq
MIRT2602797	hsa-miR-4446-5p	CLIP-seq
MIRT2602798	hsa-miR-4495	CLIP-seq
MIRT2602799	hsa-miR-4653-5p	CLIP-seq
MIRT2602800	hsa-miR-4668-3p	CLIP-seq
MIRT2602801	hsa-miR-4758-3p	CLIP-seq
MIRT2602802	hsa-miR-4759	CLIP-seq
MIRT2602803	hsa-miR-522	CLIP-seq
MIRT1270012	hsa-miR-548a-5p	CLIP-seq
MIRT1270013	hsa-miR-548ab	CLIP-seq
MIRT1270014	hsa-miR-548ak	CLIP-seq
MIRT1270015	hsa-miR-548b-5p	CLIP-seq
MIRT1270016	hsa-miR-548c-5p	CLIP-seq
MIRT1270017	hsa-miR-548d-5p	CLIP-seq
MIRT1270018	hsa-miR-548h	CLIP-seq
MIRT1270019	hsa-miR-548i	CLIP-seq
MIRT1270020	hsa-miR-548j	CLIP-seq
MIRT2602804	hsa-miR-548n	CLIP-seq
MIRT1270023	hsa-miR-548w	CLIP-seq
MIRT1270024	hsa-miR-548y	CLIP-seq
MIRT1270025	hsa-miR-559	CLIP-seq
MIRT2602805	hsa-miR-648	CLIP-seq
MIRT2602806	hsa-miR-676	CLIP-seq
MIRT2602807	hsa-miR-7	CLIP-seq
MIRT2602808	hsa-miR-711	CLIP-seq
MIRT2602809	hsa-miR-767-5p	CLIP-seq

30 Show/Hide all (30)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000502	Component	Proteasome complex	IDA	17323924
GO:0000502	Component	Proteasome complex	IEA
GO:0000502	Component	Proteasome complex	NAS	29636472
GO:0000502	Component	Proteasome complex	TAS	8811196
GO:0000932	Component	P-body	IEA
GO:0000932	Component	P-body	ISS
GO:0005515	Function	Protein binding	IPI	12376572, 14733938, 15225636, 15887188, 17948026, 19581590, 22801492, 25416956, 25599644, 25959826, 29568061, 29636472, 31473102, 32296183, 32814053, 33961781, 34702852, 35271311, 35858375
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	34711951
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	34711951
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005839	Component	Proteasome core complex	IDA	34711951
GO:0005839	Component	Proteasome core complex	IEA
GO:0005839	Component	Proteasome core complex	ISS
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IEA
GO:0019773	Component	Proteasome core complex, alpha-subunit complex	IBA
GO:0019773	Component	Proteasome core complex, alpha-subunit complex	IDA	30133132
GO:0019773	Component	Proteasome core complex, alpha-subunit complex	IEA
GO:0019773	Component	Proteasome core complex, alpha-subunit complex	ISS
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IBA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	NAS	19489727
GO:0051603	Process	Proteolysis involved in protein catabolic process	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867, 20458337

MIM	HGNC	e!Ensembl
176846	9533	ENSG00000041357

P25789

Protein name

Proteasome subunit alpha type-4 (Macropain subunit C9) (Multicatalytic endopeptidase complex subunit C9) (Proteasome component C9) (Proteasome subunit L) (Proteasome subunit alpha-3) (alpha-3)

Protein function

Component of the 20S core proteasome complex involved in the proteolytic degradation of most intracellular proteins. This complex plays numerous essential roles within the cell by associating with different regulatory particles. Associated with

PDB

4R3O , 4R67 , 5A0Q , 5GJQ , 5GJR , 5L4G , 5LE5 , 5LEX , 5LEY , 5LEZ , 5LF0 , 5LF1 , 5LF3 , 5LF4 , 5LF6 , 5LF7 , 5LN3 , 5M32 , 5T0C , 5T0G , 5T0H , 5T0I , 5T0J , 5VFO , 5VFP , 5VFQ , 5VFR , 5VFS , 5VFT , 5VFU , 6AVO , 6E5B , 6KWY , 6MSB , 6MSD , 6MSE , 6MSG , 6MSH , 6MSJ , 6MSK , 6R70 , 6REY , 6RGQ , 6WJD , 6WJN , 6XMJ , 7AWE , 7B12 , 7LXV , 7NAN , 7NAO

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00227	Proteasome	28 → 216	Proteasome subunit	Domain
PF10584	Proteasome_A_N	5 → 27	Proteasome subunit A N-terminal signature	Family

Sequence

MSRRYDSRTTIFSPEGRLYQVEYAMEAIGHAGTCLGILANDGVLLAAERRNIHKLLDEVF
FSEKIYKLNEDMACSVAGITSDANVLTNELRLIAQRYLLQYQEPIPCEQLVTALCDIKQA
YTQFGGKRPFGVSLLYIGWDKHYGFQLYQSDPSGNYGGWKATCIGNNSAAAVSMLKQDYK
EGEMTLKSALALAIKVLNKTMDVSKLSAEKVEIATLTRENGKTVIRVLKQKEVEQLIKKH
EEEEAKAEREKKEKEQKEKDK

Sequence length

261

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Proteasome	Activation of NF-kappaB in B cells
Alzheimer disease	Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha
Parkinson disease	Cross-presentation of soluble exogenous antigens (endosomes)
Amyotrophic lateral sclerosis	Autodegradation of Cdh1 by Cdh1:APC/C
Huntington disease	SCF-beta-TrCP mediated degradation of Emi1
Spinocerebellar ataxia	APC/C:Cdc20 mediated degradation of Securin
Prion disease	APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1
Pathways of neurodegeneration - multiple diseases	Cdc20:Phospho-APC/C mediated degradation of Cyclin A
	Vpu mediated degradation of CD4
	Vif-mediated degradation of APOBEC3G
	SCF(Skp2)-mediated degradation of p27/p21
	Degradation of beta-catenin by the destruction complex
	Downstream TCR signaling
	Separation of Sister Chromatids
	FCERI mediated NF-kB activation
	Autodegradation of the E3 ubiquitin ligase COP1
	Regulation of ornithine decarboxylase (ODC)
	ABC-family proteins mediated transport
	AUF1 (hnRNP D0) binds and destabilizes mRNA
	Asymmetric localization of PCP proteins
	Degradation of AXIN
	Degradation of DVL
	Hedgehog ligand biogenesis
	Hh mutants that don't undergo autocatalytic processing are degraded by ERAD
	Dectin-1 mediated noncanonical NF-kB signaling
	CLEC7A (Dectin-1) signaling
	Degradation of GLI1 by the proteasome
	GLI3 is processed to GLI3R by the proteasome
	Hedgehog 'on' state
	Regulation of RAS by GAPs
	TNFR2 non-canonical NF-kB pathway
	NIK-->noncanonical NF-kB signaling
	Defective CFTR causes cystic fibrosis
	MAPK6/MAPK4 signaling
	UCH proteinases
	Ub-specific processing proteases
	CDT1 association with the CDC6:ORC:origin complex
	Orc1 removal from chromatin
	CDK-mediated phosphorylation and removal of Cdc6
	G2/M Checkpoints
	Ubiquitin Mediated Degradation of Phosphorylated Cdc25A
	Ubiquitin-dependent degradation of Cyclin D
	The role of GTSE1 in G2/M progression after G2 checkpoint
	FBXL7 down-regulates AURKA during mitotic entry and in early mitosis
	RUNX1 regulates transcription of genes involved in differentiation of HSCs
	Regulation of RUNX2 expression and activity
	Regulation of RUNX3 expression and activity
	Regulation of PTEN stability and activity
	Neddylation
	Interleukin-1 signaling
	Antigen processing: Ubiquitination & Proteasome degradation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (13)
ATHEROSCLEROSIS	—	GWAS catalog	39024449	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA	—	CTD	16316942	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC BRONCHITIS	—	GWAS catalog	39024449	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC LUNG DISEASE	—	GWAS catalog	39024449	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	39024449	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DENTAL CARIES	—	GWAS catalog	39192244	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER NEOPLASMS	—	CTD	20195826	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	39366959	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CANCER	—	GWAS catalog	39366959	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	39366959, 40829600	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG DISEASE	—	GWAS catalog	39024449	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESPIRATORY SYSTEM DISEASE	—	GWAS catalog	39024449	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL CARCINOMA	—	GWAS catalog	39366959	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (31)
Alveolar Soft Part Sarcoma	Alveolar Sarcoma	BEFREE	23980094		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic carcinoma	Anaplastic Carcinoma	CTD_human_DG	16316942		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm	Aortic aneurysm	Pubtator	35952493	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	35952493	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	CTD_human_DG	16316942		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma of lung	Lung carcinoma	BEFREE	19789337, 20587604, 25744645, 29486777		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	29486777	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Spindle-Cell	Carcinoma	CTD_human_DG	16316942		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	25206290	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	23637351	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
ANXA4	3	["Carcinoma","Dental caries","Liver neoplasms"]	0	[]	3	["CTD (Carcinoma)","GWAS catalog (Dental caries)","CTD (Liver neoplasms)"]
C17orf58	2	["Lung disease","Respiratory system disease"]	0	[]	2	["GWAS catalog (Lung disease)","GWAS catalog (Respiratory system disease)"]
PSMB7	1	["Respiratory system disease"]	54	["Proteasome","Parkinson disease","Spinocerebellar ataxia","Prion disease","Regulation of PTEN stability and activity","Ub-specific processing proteases","Neddylation","Separation of Sister Chromatids","ABC-family proteins mediated transport","Regulation of RAS by GAPs","SCF(Skp2)-mediated degradation of p27\/p21","Orc1 removal from chromatin"]	1	["GWAS catalog (Respiratory system disease)"]
PSMA1	0	[]	54	["Proteasome","Parkinson disease","Spinocerebellar ataxia","Prion disease","Regulation of PTEN stability and activity","Ub-specific processing proteases","Neddylation","Separation of Sister Chromatids","ABC-family proteins mediated transport","Regulation of RAS by GAPs","SCF(Skp2)-mediated degradation of p27\/p21","Orc1 removal from chromatin"]	0	[]
PSMA2	0	[]	54	["Proteasome","Parkinson disease","Spinocerebellar ataxia","Prion disease","Regulation of PTEN stability and activity","Ub-specific processing proteases","Neddylation","Separation of Sister Chromatids","ABC-family proteins mediated transport","Regulation of RAS by GAPs","SCF(Skp2)-mediated degradation of p27\/p21","Orc1 removal from chromatin"]	0	[]

PSMA4 (proteasome 20S subunit alpha 4)

Bookmark This Gene