PSMD4 (proteasome 26S subunit ubiquitin receptor, non-ATPase 4)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 5710
• Gene name: Proteasome 26S subunit ubiquitin receptor, non-ATPase 4
• Gene symbol: PSMD4
• Synonyms (NCBI Gene): AF, AF-1, ASF, MCB1, Rpn10, S5A, pUB-R5
• Chromosome: 1
• Chromosome location: 1q21.3
• Summary: The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits a

miRNA Show/Hide all (27)

miRTarBase ID	miRNA	Experiments	Reference
MIRT048850	hsa-miR-93-5p	CLASH	23622248
MIRT046856	hsa-miR-221-3p	CLASH	23622248
MIRT044963	hsa-miR-186-5p	CLASH	23622248
MIRT043083	hsa-miR-324-5p	CLASH	23622248
MIRT043083	hsa-miR-324-5p	CLASH	23622248
MIRT037698	hsa-miR-744-5p	CLASH	23622248
MIRT1270537	hsa-miR-1470	CLIP-seq
MIRT1270538	hsa-miR-1973	CLIP-seq
MIRT1270539	hsa-miR-2115	CLIP-seq
MIRT1270540	hsa-miR-3925-3p	CLIP-seq
MIRT1270541	hsa-miR-409-5p	CLIP-seq
MIRT1270542	hsa-miR-4446-5p	CLIP-seq
MIRT1270543	hsa-miR-4667-3p	CLIP-seq
MIRT1270544	hsa-miR-4755-5p	CLIP-seq
MIRT1270545	hsa-miR-4771	CLIP-seq
MIRT1270546	hsa-miR-512-5p	CLIP-seq
MIRT1270547	hsa-miR-516a-3p	CLIP-seq
MIRT1270548	hsa-miR-642a	CLIP-seq
MIRT2079505	hsa-miR-3929	CLIP-seq
MIRT1270541	hsa-miR-409-5p	CLIP-seq
MIRT2079506	hsa-miR-4419b	CLIP-seq
MIRT2079507	hsa-miR-4478	CLIP-seq
MIRT2079508	hsa-miR-4480	CLIP-seq
MIRT2079505	hsa-miR-3929	CLIP-seq
MIRT1270541	hsa-miR-409-5p	CLIP-seq
MIRT2079506	hsa-miR-4419b	CLIP-seq
MIRT2079507	hsa-miR-4478	CLIP-seq

Gene ontology (GO) Show/Hide all (19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000502	Component	Proteasome complex	IDA	17323924
GO:0000502	Component	Proteasome complex	IEA
GO:0000502	Component	Proteasome complex	NAS	29636472
GO:0000502	Component	Proteasome complex	TAS	8811196
GO:0003723	Function	RNA binding	HDA	22658674
GO:0005515	Function	Protein binding	IPI	10488153, 11146632, 15147878, 16990800, 17082820, 17139257, 17500595, 17662948, 18922472, 19490896, 19615732, 19796170, 19798103, 20059542, 20195357, 21653829, 24811749, 25036637, 26496610, 26618866, 27342858, 28514442, 29290612, 29426014, 29636472, 29997244, 31467278, 32157086, 322
GO:0005634	Component	Nucleus	IBA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0008540	Component	Proteasome regulatory particle, base subcomplex	IBA
GO:0022624	Component	Proteasome accessory complex	IEA
GO:0022624	Component	Proteasome accessory complex	ISS
GO:0031593	Function	Polyubiquitin modification-dependent protein binding	IBA
GO:0042802	Function	Identical protein binding	IPI	16990800, 19931242
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IBA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	NAS	19489727
GO:0060090	Function	Molecular adaptor activity	EXP	32157086

Other IDs

• MIM: 601648
• HGNC: 9561
• e!Ensembl: ENSG00000159352

Protein

• UniProt ID: P55036
• Protein name: 26S proteasome non-ATPase regulatory subunit 4 (26S proteasome regulatory subunit RPN10) (26S proteasome regulatory subunit S5A) (Antisecretory factor 1) (AF) (ASF) (Multiubiquitin chain-binding protein)
• Protein function: Component of the 26S proteasome, a multiprotein complex involved in the ATP-dependent degradation of ubiquitinated proteins. This complex plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins, which
• PDB: 1P9C , 1P9D , 1UEL , 1YX4 , 1YX5 , 1YX6 , 2KDE , 2KDF , 5GJQ , 5GJR , 5L4K , 5LN3 , 5M32 , 5T0C , 5T0G , 5T0H , 5T0I , 5T0J , 5VFP , 5VFQ , 5VFR , 5VFS , 5VFT , 5VFU , 5VGZ , 5VHF , 5VHH , 5VHI , 5VHS , 6MSB , 6MSD , 6MSE , 6MSG , 6MSH , 6MSJ , 6MSK , 6MUN , 6U19 , 6WJD , 6WJN , 7QXN , 7QXP , 7QXU , 7QXW , 7QXX , 7QY7 , 7QYA , 7QYB , 7W37 , 7W38 , 7W39
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02809	UIM	282 → 298	Ubiquitin interaction motif	Motif
  PF02809	UIM	211 → 227	Ubiquitin interaction motif	Motif
  PF13519	VWA_2	6 → 116	von Willebrand factor type A domain	Domain

• Sequence:

  MVLESTMVCVDNSEYMRNGDFLPTRLQAQQDAVNIVCHSKTRSNPENNVGLITLANDCEV
  LTTLTPDTGRILSKLHTVQPKGKITFCTGIRVAHLALKHRQGKNHKMRIIAFVGSPVEDN
  EKDLVKLAKRLKKEKVNVDIINFGEEEVNTEKLTAFVNTLNGKDGTGSHLVTVPPGPSLA
  DALISSPILAGEGGAMLGLGASDFEFGVDPSADPELALALRVSMEEQRQRQEEEARRAAA
  ASAAEAGIATTGTEDSDDALLKMTISQQEFGRTGLPDLSSMTEEEQIAYAMQMSLQGAEF
  GQAESADIDASSAMDTSEPAKEEDDYDVMQDPEFLQSVLENLPGVDPNNEAIRNAMGSLA
  SQATKDGKKDKKEEDKK

• Sequence length: 377

Pathways

KEGG Pathway	Reactome Pathway
Proteasome	Activation of NF-kappaB in B cells
Alzheimer disease	Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha
Parkinson disease	Cross-presentation of soluble exogenous antigens (endosomes)
Amyotrophic lateral sclerosis	Autodegradation of Cdh1 by Cdh1:APC/C
Huntington disease	SCF-beta-TrCP mediated degradation of Emi1
Spinocerebellar ataxia	APC/C:Cdc20 mediated degradation of Securin
Prion disease	APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1
Pathways of neurodegeneration - multiple diseases	Cdc20:Phospho-APC/C mediated degradation of Cyclin A
Epstein-Barr virus infection	Vpu mediated degradation of CD4
	Vif-mediated degradation of APOBEC3G
	SCF(Skp2)-mediated degradation of p27/p21
	Degradation of beta-catenin by the destruction complex
	Downstream TCR signaling
	Separation of Sister Chromatids
	FCERI mediated NF-kB activation
	Autodegradation of the E3 ubiquitin ligase COP1
	Regulation of ornithine decarboxylase (ODC)
	ABC-family proteins mediated transport
	AUF1 (hnRNP D0) binds and destabilizes mRNA
	Asymmetric localization of PCP proteins
	Degradation of AXIN
	Degradation of DVL
	Hedgehog ligand biogenesis
	Hh mutants that don't undergo autocatalytic processing are degraded by ERAD
	Dectin-1 mediated noncanonical NF-kB signaling
	CLEC7A (Dectin-1) signaling
	Degradation of GLI1 by the proteasome
	GLI3 is processed to GLI3R by the proteasome
	Hedgehog 'on' state
	Regulation of RAS by GAPs
	TNFR2 non-canonical NF-kB pathway
	NIK-->noncanonical NF-kB signaling
	Defective CFTR causes cystic fibrosis
	MAPK6/MAPK4 signaling
	UCH proteinases
	Ub-specific processing proteases
	CDT1 association with the CDC6:ORC:origin complex
	Orc1 removal from chromatin
	CDK-mediated phosphorylation and removal of Cdc6
	G2/M Checkpoints
	Ubiquitin Mediated Degradation of Phosphorylated Cdc25A
	Ubiquitin-dependent degradation of Cyclin D
	The role of GTSE1 in G2/M progression after G2 checkpoint
	FBXL7 down-regulates AURKA during mitotic entry and in early mitosis
	RUNX1 regulates transcription of genes involved in differentiation of HSCs
	Regulation of RUNX2 expression and activity
	Regulation of RUNX3 expression and activity
	Regulation of PTEN stability and activity
	Neddylation
	Interleukin-1 signaling
	Antigen processing: Ubiquitination & Proteasome degradation

Related Genes

Sort by: Blended Diseases Pathways Evidence source

PSMC2 55 shared pathwaysProteasome, Parkinson disease, Spinocerebellar ataxia, Prion disease, Epstein-Barr virus infection, Regulation of PTEN stability and activity, Ub-specific processing proteases, Neddylation, Separation of Sister Chromatids, ABC-family proteins mediated transport, Regulation of RAS by GAPs, SCF(Skp2)-mediated degradation of p27/p21 +43 more Related via 55 shared pathways including Proteasome, Parkinson disease. PSMC3 55 shared pathwaysProteasome, Parkinson disease, Spinocerebellar ataxia, Prion disease, Epstein-Barr virus infection, Regulation of PTEN stability and activity, Ub-specific processing proteases, Neddylation, Separation of Sister Chromatids, ABC-family proteins mediated transport, Regulation of RAS by GAPs, SCF(Skp2)-mediated degradation of p27/p21 +43 more Related via 55 shared pathways including Proteasome, Parkinson disease. PSMC4 55 shared pathwaysProteasome, Parkinson disease, Spinocerebellar ataxia, Prion disease, Epstein-Barr virus infection, Regulation of PTEN stability and activity, Ub-specific processing proteases, Neddylation, Separation of Sister Chromatids, ABC-family proteins mediated transport, Regulation of RAS by GAPs, SCF(Skp2)-mediated degradation of p27/p21 +43 more Related via 55 shared pathways including Proteasome, Parkinson disease. PSMC5 55 shared pathwaysProteasome, Parkinson disease, Spinocerebellar ataxia, Prion disease, Epstein-Barr virus infection, Regulation of PTEN stability and activity, Ub-specific processing proteases, Neddylation, Separation of Sister Chromatids, ABC-family proteins mediated transport, Regulation of RAS by GAPs, SCF(Skp2)-mediated degradation of p27/p21 +43 more Related via 55 shared pathways including Proteasome, Parkinson disease. PSMC6 55 shared pathwaysProteasome, Parkinson disease, Spinocerebellar ataxia, Prion disease, Epstein-Barr virus infection, Regulation of PTEN stability and activity, Ub-specific processing proteases, Neddylation, Separation of Sister Chromatids, ABC-family proteins mediated transport, Regulation of RAS by GAPs, SCF(Skp2)-mediated degradation of p27/p21 +43 more Related via 55 shared pathways including Proteasome, Parkinson disease.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
PSMC2	0	[]	55	["Proteasome","Parkinson disease","Spinocerebellar ataxia","Prion disease","Epstein-Barr virus infection","Regulation of PTEN stability and activity","Ub-specific processing proteases","Neddylation","Separation of Sister Chromatids","ABC-family proteins mediated transport","Regulation of RAS by GAPs","SCF(Skp2)-mediated degradation of p27\/p21"]	0	[]
PSMC3	0	[]	55	["Proteasome","Parkinson disease","Spinocerebellar ataxia","Prion disease","Epstein-Barr virus infection","Regulation of PTEN stability and activity","Ub-specific processing proteases","Neddylation","Separation of Sister Chromatids","ABC-family proteins mediated transport","Regulation of RAS by GAPs","SCF(Skp2)-mediated degradation of p27\/p21"]	0	[]
PSMC4	0	[]	55	["Proteasome","Parkinson disease","Spinocerebellar ataxia","Prion disease","Epstein-Barr virus infection","Regulation of PTEN stability and activity","Ub-specific processing proteases","Neddylation","Separation of Sister Chromatids","ABC-family proteins mediated transport","Regulation of RAS by GAPs","SCF(Skp2)-mediated degradation of p27\/p21"]	0	[]
PSMC5	0	[]	55	["Proteasome","Parkinson disease","Spinocerebellar ataxia","Prion disease","Epstein-Barr virus infection","Regulation of PTEN stability and activity","Ub-specific processing proteases","Neddylation","Separation of Sister Chromatids","ABC-family proteins mediated transport","Regulation of RAS by GAPs","SCF(Skp2)-mediated degradation of p27\/p21"]	0	[]
PSMC6	0	[]	55	["Proteasome","Parkinson disease","Spinocerebellar ataxia","Prion disease","Epstein-Barr virus infection","Regulation of PTEN stability and activity","Ub-specific processing proteases","Neddylation","Separation of Sister Chromatids","ABC-family proteins mediated transport","Regulation of RAS by GAPs","SCF(Skp2)-mediated degradation of p27\/p21"]	0	[]

Diseases Linked via Similar Genes

Alzheimer disease Linked via 2 of 5 related genesPSMC3, PSMC6 Neurodevelopmental disorder Linked via 2 of 5 related genesPSMC3, PSMC5 Hearing loss Linked via 1 of 5 related genesPSMC2 Diabetes mellitus type 2 Linked via 1 of 5 related genesPSMC2 Anomalous pulmonary venous Linked via 1 of 5 related genesPSMC3

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Alzheimer disease	2	["PSMC3","PSMC6"]
Neurodevelopmental disorder	2	["PSMC3","PSMC5"]
Hearing loss	1	["PSMC2"]
Diabetes mellitus type 2	1	["PSMC2"]
Anomalous pulmonary venous	1	["PSMC3"]