Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	5701
Gene name	Proteasome 26S subunit, ATPase 2
Gene symbol	PSMC2
Synonyms (NCBI Gene)	MSS1Nbla10058RPT1S7
Chromosome	7
Chromosome location	7q22.1
Summary	The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits a

107 Show/Hide all (107)

miRTarBase ID	miRNA	Experiments	Reference
MIRT031892	hsa-miR-16-5p	Proteomics	18668040
MIRT041958	hsa-miR-484	CLASH	23622248
MIRT721125	hsa-miR-141-5p	HITS-CLIP	19536157
MIRT721124	hsa-miR-5693	HITS-CLIP	19536157
MIRT721123	hsa-miR-194-3p	HITS-CLIP	19536157
MIRT721122	hsa-miR-3161	HITS-CLIP	19536157
MIRT721121	hsa-miR-670-3p	HITS-CLIP	19536157
MIRT721120	hsa-miR-599	HITS-CLIP	19536157
MIRT721125	hsa-miR-141-5p	HITS-CLIP	19536157
MIRT721124	hsa-miR-5693	HITS-CLIP	19536157
MIRT721123	hsa-miR-194-3p	HITS-CLIP	19536157
MIRT721122	hsa-miR-3161	HITS-CLIP	19536157
MIRT721121	hsa-miR-670-3p	HITS-CLIP	19536157
MIRT721120	hsa-miR-599	HITS-CLIP	19536157
MIRT1270315	hsa-miR-127-5p	CLIP-seq
MIRT1270316	hsa-miR-1321	CLIP-seq
MIRT1270317	hsa-miR-144	CLIP-seq
MIRT1270318	hsa-miR-3175	CLIP-seq
MIRT1270319	hsa-miR-3606	CLIP-seq
MIRT1270320	hsa-miR-362-5p	CLIP-seq
MIRT1270321	hsa-miR-4419a	CLIP-seq
MIRT1270322	hsa-miR-4510	CLIP-seq
MIRT1270323	hsa-miR-4645-3p	CLIP-seq
MIRT1270324	hsa-miR-4709-5p	CLIP-seq
MIRT1270325	hsa-miR-4728-5p	CLIP-seq
MIRT1270326	hsa-miR-4739	CLIP-seq
MIRT1270327	hsa-miR-4756-5p	CLIP-seq
MIRT1270328	hsa-miR-4786-3p	CLIP-seq
MIRT1270329	hsa-miR-500b	CLIP-seq
MIRT1270330	hsa-miR-501-5p	CLIP-seq
MIRT1270331	hsa-miR-548n	CLIP-seq
MIRT1270332	hsa-miR-921	CLIP-seq
MIRT1270333	hsa-miR-1258	CLIP-seq
MIRT1270334	hsa-miR-219-2-3p	CLIP-seq
MIRT1270335	hsa-miR-2964a-3p	CLIP-seq
MIRT1270336	hsa-miR-3159	CLIP-seq
MIRT1270337	hsa-miR-3614-5p	CLIP-seq
MIRT1270338	hsa-miR-410	CLIP-seq
MIRT1270339	hsa-miR-4477a	CLIP-seq
MIRT1270340	hsa-miR-4704-3p	CLIP-seq
MIRT1270341	hsa-miR-4796-5p	CLIP-seq
MIRT1270342	hsa-miR-5096	CLIP-seq
MIRT1270343	hsa-miR-561	CLIP-seq
MIRT1270344	hsa-miR-651	CLIP-seq
MIRT1270333	hsa-miR-1258	CLIP-seq
MIRT1270336	hsa-miR-3159	CLIP-seq
MIRT1270338	hsa-miR-410	CLIP-seq
MIRT1270340	hsa-miR-4704-3p	CLIP-seq
MIRT2079454	hsa-miR-4775	CLIP-seq
MIRT1270341	hsa-miR-4796-5p	CLIP-seq
MIRT1270343	hsa-miR-561	CLIP-seq
MIRT2079455	hsa-miR-570	CLIP-seq
MIRT1270344	hsa-miR-651	CLIP-seq
MIRT1270333	hsa-miR-1258	CLIP-seq
MIRT1270336	hsa-miR-3159	CLIP-seq
MIRT1270338	hsa-miR-410	CLIP-seq
MIRT2305759	hsa-miR-610	CLIP-seq
MIRT1270344	hsa-miR-651	CLIP-seq
MIRT2602966	hsa-miR-1185	CLIP-seq
MIRT2602967	hsa-miR-1255a	CLIP-seq
MIRT2602968	hsa-miR-1255b	CLIP-seq
MIRT2602969	hsa-miR-2278	CLIP-seq
MIRT2602970	hsa-miR-3138	CLIP-seq
MIRT2602971	hsa-miR-324-5p	CLIP-seq
MIRT2602972	hsa-miR-338-3p	CLIP-seq
MIRT2602973	hsa-miR-3663-3p	CLIP-seq
MIRT2602974	hsa-miR-3668	CLIP-seq
MIRT2602975	hsa-miR-3679-5p	CLIP-seq
MIRT2602976	hsa-miR-3689a-3p	CLIP-seq
MIRT2602977	hsa-miR-3689c	CLIP-seq
MIRT2602978	hsa-miR-4252	CLIP-seq
MIRT2602979	hsa-miR-4496	CLIP-seq
MIRT2602980	hsa-miR-4520a-3p	CLIP-seq
MIRT2602981	hsa-miR-4666-3p	CLIP-seq
MIRT2602982	hsa-miR-4699-5p	CLIP-seq
MIRT1270325	hsa-miR-4728-5p	CLIP-seq
MIRT2602983	hsa-miR-4732-5p	CLIP-seq
MIRT2602984	hsa-miR-491-3p	CLIP-seq
MIRT1270343	hsa-miR-561	CLIP-seq
MIRT2602985	hsa-miR-562	CLIP-seq
MIRT2602986	hsa-miR-580	CLIP-seq
MIRT2602987	hsa-miR-586	CLIP-seq
MIRT2602988	hsa-miR-941	CLIP-seq
MIRT2602966	hsa-miR-1185	CLIP-seq
MIRT2602967	hsa-miR-1255a	CLIP-seq
MIRT2602968	hsa-miR-1255b	CLIP-seq
MIRT2602969	hsa-miR-2278	CLIP-seq
MIRT2602970	hsa-miR-3138	CLIP-seq
MIRT2602971	hsa-miR-324-5p	CLIP-seq
MIRT2602973	hsa-miR-3663-3p	CLIP-seq
MIRT2602974	hsa-miR-3668	CLIP-seq
MIRT2602975	hsa-miR-3679-5p	CLIP-seq
MIRT2602976	hsa-miR-3689a-3p	CLIP-seq
MIRT2602977	hsa-miR-3689c	CLIP-seq
MIRT2602978	hsa-miR-4252	CLIP-seq
MIRT2602979	hsa-miR-4496	CLIP-seq
MIRT2602980	hsa-miR-4520a-3p	CLIP-seq
MIRT2602981	hsa-miR-4666-3p	CLIP-seq
MIRT2602982	hsa-miR-4699-5p	CLIP-seq
MIRT1270325	hsa-miR-4728-5p	CLIP-seq
MIRT2602983	hsa-miR-4732-5p	CLIP-seq
MIRT2602984	hsa-miR-491-3p	CLIP-seq
MIRT1270343	hsa-miR-561	CLIP-seq
MIRT2602985	hsa-miR-562	CLIP-seq
MIRT2602986	hsa-miR-580	CLIP-seq
MIRT2602987	hsa-miR-586	CLIP-seq
MIRT2602988	hsa-miR-941	CLIP-seq

31 Show/Hide all (31)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000502	Component	Proteasome complex	IDA	9295362, 9464850, 17323924
GO:0000502	Component	Proteasome complex	IEA
GO:0000502	Component	Proteasome complex	NAS	29636472
GO:0000932	Component	P-body	IEA
GO:0000932	Component	P-body	ISS
GO:0001649	Process	Osteoblast differentiation	HDA	16210410
GO:0005515	Function	Protein binding	IPI	16189514, 16712842, 16763564, 16990800, 19490896, 21516116, 22078707, 22901813, 25416956, 26496610, 27107012, 28514442, 31515488, 32296183, 32814053, 33961781, 35271311
GO:0005524	Function	ATP binding	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005634	Component	Nucleus	HDA	21630459
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	16130169
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IDA	9295362
GO:0008540	Component	Proteasome regulatory particle, base subcomplex	IBA
GO:0016020	Component	Membrane	HDA	16210410, 19946888
GO:0016887	Function	ATP hydrolysis activity	IEA
GO:0022624	Component	Proteasome accessory complex	IEA
GO:0022624	Component	Proteasome accessory complex	ISS
GO:0034774	Component	Secretory granule lumen	TAS
GO:0036402	Function	Proteasome-activating activity	IBA
GO:0036402	Function	Proteasome-activating activity	IDA	9295362
GO:0036402	Function	Proteasome-activating activity	TAS	9464850
GO:0036464	Component	Cytoplasmic ribonucleoprotein granule	IDA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IBA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	NAS	19489727
GO:1901800	Process	Positive regulation of proteasomal protein catabolic process	IC	9464850
GO:1904813	Component	Ficolin-1-rich granule lumen	TAS

MIM	HGNC	e!Ensembl
154365	9548	ENSG00000161057

P35998

Protein name

26S proteasome regulatory subunit 7 (26S proteasome AAA-ATPase subunit RPT1) (Proteasome 26S subunit ATPase 2)

Protein function

Component of the 26S proteasome, a multiprotein complex involved in the ATP-dependent degradation of ubiquitinated proteins. This complex plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins, which

PDB

5GJQ , 5GJR , 5L4G , 5LN3 , 5M32 , 5T0C , 5T0G , 5T0H , 5T0I , 5T0J , 5VFP , 5VFQ , 5VFR , 5VFS , 5VFT , 5VFU , 5VGZ , 5VHF , 5VHH , 5VHI , 5VHJ , 5VHM , 5VHN , 5VHO , 5VHP , 5VHQ , 5VHR , 5VHS , 6MSB , 6MSD , 6MSE , 6MSG , 6MSH , 6MSJ , 6MSK , 6WJD , 6WJN , 7QXN , 7QXP , 7QXU , 7QXW , 7QXX , 7QY7 , 7QYA , 7QYB , 7W37 , 7W38 , 7W39 , 7W3A , 7W3B , 7W3C

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00004	AAA	212 → 345	ATPase family associated with various cellular activities (AAA)	Domain
PF17862	AAA_lid_3	367 → 411	AAA+ lid domain	Domain

Sequence

MPDYLGADQRKTKEDEKDDKPIRALDEGDIALLKTYGQSTYSRQIKQVEDDIQQLLKKIN
ELTGIKESDTGLAPPALWDLAADKQTLQSEQPLQVARCTKIINADSEDPKYIINVKQFAK
FVVDLSDQVAPTDIEEGMRVGVDRNKYQIHIPLPPKIDPTVTMMQVEEKPDVTYSDVGGC
KEQIEKLREVVETPLLHPERFVNLGIEPPKGVLLFGPPGTGKTLCARAVANRTDACFIRV
IGSELVQKYVGEGARMVRELFEMARTKKACLIFFDEIDAIGGARFDDGAGGDNEVQRTML
ELINQLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKIEFSLPDLEGRTHIFKIHAR
SMSVERDIRFELLARLCPNSTGAEIRSVCTEAGMFAIRARRKIATEKDFLEAVNKVIKSY
AKFSATPRYMTYN

Sequence length

433

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Proteasome	Activation of NF-kappaB in B cells
Alzheimer disease	Oxygen-dependent proline hydroxylation of Hypoxia-inducible Factor Alpha
Parkinson disease	Cross-presentation of soluble exogenous antigens (endosomes)
Amyotrophic lateral sclerosis	Autodegradation of Cdh1 by Cdh1:APC/C
Huntington disease	SCF-beta-TrCP mediated degradation of Emi1
Spinocerebellar ataxia	APC/C:Cdc20 mediated degradation of Securin
Prion disease	APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1
Pathways of neurodegeneration - multiple diseases	Cdc20:Phospho-APC/C mediated degradation of Cyclin A
Epstein-Barr virus infection	Vpu mediated degradation of CD4
	Vif-mediated degradation of APOBEC3G
	SCF(Skp2)-mediated degradation of p27/p21
	Degradation of beta-catenin by the destruction complex
	Downstream TCR signaling
	Separation of Sister Chromatids
	FCERI mediated NF-kB activation
	Autodegradation of the E3 ubiquitin ligase COP1
	Regulation of ornithine decarboxylase (ODC)
	ABC-family proteins mediated transport
	AUF1 (hnRNP D0) binds and destabilizes mRNA
	Asymmetric localization of PCP proteins
	Degradation of AXIN
	Degradation of DVL
	Hedgehog ligand biogenesis
	Hh mutants that don't undergo autocatalytic processing are degraded by ERAD
	Dectin-1 mediated noncanonical NF-kB signaling
	CLEC7A (Dectin-1) signaling
	Degradation of GLI1 by the proteasome
	GLI3 is processed to GLI3R by the proteasome
	Hedgehog 'on' state
	Regulation of RAS by GAPs
	TNFR2 non-canonical NF-kB pathway
	NIK-->noncanonical NF-kB signaling
	Defective CFTR causes cystic fibrosis
	MAPK6/MAPK4 signaling
	UCH proteinases
	Ub-specific processing proteases
	Neutrophil degranulation
	CDT1 association with the CDC6:ORC:origin complex
	Orc1 removal from chromatin
	CDK-mediated phosphorylation and removal of Cdc6
	G2/M Checkpoints
	Ubiquitin Mediated Degradation of Phosphorylated Cdc25A
	Ubiquitin-dependent degradation of Cyclin D
	The role of GTSE1 in G2/M progression after G2 checkpoint
	FBXL7 down-regulates AURKA during mitotic entry and in early mitosis
	RUNX1 regulates transcription of genes involved in differentiation of HSCs
	Regulation of RUNX2 expression and activity
	Regulation of RUNX3 expression and activity
	Regulation of PTEN stability and activity
	Neddylation
	Interleukin-1 signaling
	Antigen processing: Ubiquitination & Proteasome degradation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
HEARING LOSS	—	GWAS catalog	35661827	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	30297969, 32541925	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (9)
Alveolar Soft Part Sarcoma	Alveolar Sarcoma	BEFREE	23980094		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	34329194	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	31715603		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	35287689	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	38569452	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	32972417	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	31715603		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	38123344	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	27888613, 30915734		★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Gene	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Names
PSMC3	[]	55	["Proteasome","Parkinson disease","Spinocerebellar ataxia","Prion disease","Epstein-Barr virus infection","Regulation of PTEN stability and activity","Ub-specific processing proteases","Neddylation","Separation of Sister Chromatids","ABC-family proteins mediated transport","Regulation of RAS by GAPs","SCF(Skp2)-mediated degradation of p27\/p21"]	[]
PSMC4	[]	55	["Proteasome","Parkinson disease","Spinocerebellar ataxia","Prion disease","Epstein-Barr virus infection","Regulation of PTEN stability and activity","Ub-specific processing proteases","Neddylation","Separation of Sister Chromatids","ABC-family proteins mediated transport","Regulation of RAS by GAPs","SCF(Skp2)-mediated degradation of p27\/p21"]	[]
PSMC5	[]	55	["Proteasome","Parkinson disease","Spinocerebellar ataxia","Prion disease","Epstein-Barr virus infection","Regulation of PTEN stability and activity","Ub-specific processing proteases","Neddylation","Separation of Sister Chromatids","ABC-family proteins mediated transport","Regulation of RAS by GAPs","SCF(Skp2)-mediated degradation of p27\/p21"]	[]
PSMC6	[]	55	["Proteasome","Parkinson disease","Spinocerebellar ataxia","Prion disease","Epstein-Barr virus infection","Regulation of PTEN stability and activity","Ub-specific processing proteases","Neddylation","Separation of Sister Chromatids","ABC-family proteins mediated transport","Regulation of RAS by GAPs","SCF(Skp2)-mediated degradation of p27\/p21"]	[]
PSMD1	[]	55	["Proteasome","Parkinson disease","Spinocerebellar ataxia","Prion disease","Epstein-Barr virus infection","Regulation of PTEN stability and activity","Ub-specific processing proteases","Neddylation","Separation of Sister Chromatids","ABC-family proteins mediated transport","Regulation of RAS by GAPs","SCF(Skp2)-mediated degradation of p27\/p21"]	[]

PSMC2 (proteasome 26S subunit, ATPase 2)

Save This Analysis