PRMT1 (protein arginine methyltransferase 1)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 3276
• Gene name: Protein arginine methyltransferase 1
• Gene symbol: PRMT1
• Synonyms (NCBI Gene): ANM1, HCP1, HRMT1L2, IR1B4
• Chromosome: 19
• Chromosome location: 19q13.33
• Summary: This gene encodes a member of the protein arginine N-methyltransferase (PRMT) family. Post-translational modification of target proteins by PRMTs plays an important regulatory role in many biological processes, whereby PRMTs methylate arginine residues by

miRNA Show/Hide all (103)

miRTarBase ID	miRNA	Experiments	Reference
MIRT028512	hsa-miR-30a-5p	Proteomics	18668040
MIRT043993	hsa-miR-378a-5p	CLASH	23622248
MIRT037074	hsa-miR-877-3p	CLASH	23622248
MIRT037074	hsa-miR-877-3p	CLASH	23622248
MIRT732906	hsa-let-7i-3p	Immunofluorescence, RNA-seq, qRT-PCR, Western blotting	33239422
MIRT733339	hsa-miR-493-3p	Luciferase reporter assay, qRT-PCR, Western blotting	32420808
MIRT735847	hsa-miR-15a-3p	Western blotting, Microarray, Immunoprecipitaion (IP), RNA-seq, Mass spectrometry, Immunofluorescence, qRT-PCR	31777917
MIRT1264506	hsa-miR-1185	CLIP-seq
MIRT1264507	hsa-miR-3163	CLIP-seq
MIRT1264508	hsa-miR-3605-5p	CLIP-seq
MIRT1264509	hsa-miR-3679-5p	CLIP-seq
MIRT1264510	hsa-miR-4290	CLIP-seq
MIRT1264511	hsa-miR-455-5p	CLIP-seq
MIRT1264512	hsa-miR-4704-3p	CLIP-seq
MIRT1264513	hsa-miR-548ac	CLIP-seq
MIRT1264514	hsa-miR-548ae	CLIP-seq
MIRT1264515	hsa-miR-548aj	CLIP-seq
MIRT1264516	hsa-miR-548am	CLIP-seq
MIRT1264517	hsa-miR-548d-3p	CLIP-seq
MIRT1264518	hsa-miR-548x	CLIP-seq
MIRT1264519	hsa-miR-548z	CLIP-seq
MIRT1264520	hsa-miR-1909	CLIP-seq
MIRT1264521	hsa-miR-3141	CLIP-seq
MIRT1264522	hsa-miR-378g	CLIP-seq
MIRT1264523	hsa-miR-4437	CLIP-seq
MIRT1264524	hsa-miR-4674	CLIP-seq
MIRT1264525	hsa-miR-517a	CLIP-seq
MIRT1264526	hsa-miR-517b	CLIP-seq
MIRT1264527	hsa-miR-517c	CLIP-seq
MIRT2304396	hsa-miR-361-3p	CLIP-seq
MIRT1264510	hsa-miR-4290	CLIP-seq
MIRT1264511	hsa-miR-455-5p	CLIP-seq
MIRT2304397	hsa-miR-4690-3p	CLIP-seq
MIRT2601160	hsa-miR-1225-3p	CLIP-seq
MIRT2601161	hsa-miR-1237	CLIP-seq
MIRT2601162	hsa-miR-1321	CLIP-seq
MIRT1264520	hsa-miR-1909	CLIP-seq
MIRT2601163	hsa-miR-3125	CLIP-seq
MIRT2601164	hsa-miR-3127-3p	CLIP-seq
MIRT2601165	hsa-miR-3135	CLIP-seq
MIRT1264521	hsa-miR-3141	CLIP-seq
MIRT2601166	hsa-miR-3179	CLIP-seq
MIRT2601167	hsa-miR-3202	CLIP-seq
MIRT2601168	hsa-miR-331-3p	CLIP-seq
MIRT2304396	hsa-miR-361-3p	CLIP-seq
MIRT1264522	hsa-miR-378g	CLIP-seq
MIRT2601169	hsa-miR-3916	CLIP-seq
MIRT1264510	hsa-miR-4290	CLIP-seq
MIRT2601170	hsa-miR-4292	CLIP-seq
MIRT2601171	hsa-miR-4419a	CLIP-seq
MIRT1264523	hsa-miR-4437	CLIP-seq
MIRT2601172	hsa-miR-4476	CLIP-seq
MIRT2601173	hsa-miR-4510	CLIP-seq
MIRT1264511	hsa-miR-455-5p	CLIP-seq
MIRT2601174	hsa-miR-4640-3p	CLIP-seq
MIRT1264524	hsa-miR-4674	CLIP-seq
MIRT2304397	hsa-miR-4690-3p	CLIP-seq
MIRT2601175	hsa-miR-4716-3p	CLIP-seq
MIRT2601176	hsa-miR-4723-5p	CLIP-seq
MIRT2601177	hsa-miR-4728-5p	CLIP-seq
MIRT2601178	hsa-miR-4734	CLIP-seq
MIRT2601179	hsa-miR-4739	CLIP-seq
MIRT2601180	hsa-miR-4756-5p	CLIP-seq
MIRT1264525	hsa-miR-517a	CLIP-seq
MIRT1264526	hsa-miR-517b	CLIP-seq
MIRT1264527	hsa-miR-517c	CLIP-seq
MIRT2601181	hsa-miR-548aa	CLIP-seq
MIRT2601182	hsa-miR-939	CLIP-seq
MIRT2601160	hsa-miR-1225-3p	CLIP-seq
MIRT2601161	hsa-miR-1237	CLIP-seq
MIRT2601162	hsa-miR-1321	CLIP-seq
MIRT1264520	hsa-miR-1909	CLIP-seq
MIRT2601163	hsa-miR-3125	CLIP-seq
MIRT2601164	hsa-miR-3127-3p	CLIP-seq
MIRT2601165	hsa-miR-3135	CLIP-seq
MIRT1264521	hsa-miR-3141	CLIP-seq
MIRT2601166	hsa-miR-3179	CLIP-seq
MIRT2601167	hsa-miR-3202	CLIP-seq
MIRT2601168	hsa-miR-331-3p	CLIP-seq
MIRT2304396	hsa-miR-361-3p	CLIP-seq
MIRT1264522	hsa-miR-378g	CLIP-seq
MIRT2601169	hsa-miR-3916	CLIP-seq
MIRT1264510	hsa-miR-4290	CLIP-seq
MIRT2601170	hsa-miR-4292	CLIP-seq
MIRT2601171	hsa-miR-4419a	CLIP-seq
MIRT1264523	hsa-miR-4437	CLIP-seq
MIRT2601172	hsa-miR-4476	CLIP-seq
MIRT2601173	hsa-miR-4510	CLIP-seq
MIRT1264511	hsa-miR-455-5p	CLIP-seq
MIRT2601174	hsa-miR-4640-3p	CLIP-seq
MIRT1264524	hsa-miR-4674	CLIP-seq
MIRT2304397	hsa-miR-4690-3p	CLIP-seq
MIRT2601175	hsa-miR-4716-3p	CLIP-seq
MIRT2601176	hsa-miR-4723-5p	CLIP-seq
MIRT2601177	hsa-miR-4728-5p	CLIP-seq
MIRT2601178	hsa-miR-4734	CLIP-seq
MIRT2601179	hsa-miR-4739	CLIP-seq
MIRT2601180	hsa-miR-4756-5p	CLIP-seq
MIRT1264525	hsa-miR-517a	CLIP-seq
MIRT1264526	hsa-miR-517b	CLIP-seq
MIRT1264527	hsa-miR-517c	CLIP-seq
MIRT2601181	hsa-miR-548aa	CLIP-seq
MIRT2601182	hsa-miR-939	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
PIAS1	Repression	19136629

Gene ontology (GO) Show/Hide all (103)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000724	Process	Double-strand break repair via homologous recombination	IDA	29670289, 30612738
GO:0001701	Process	In utero embryonic development	IEA
GO:0003723	Function	RNA binding	HDA	22681889
GO:0005515	Function	Protein binding	IPI	8663146, 10749851, 15084609, 16051612, 16169070, 16879614, 17053781, 19095693, 19101556, 19124016, 19858291, 21085121, 22095282, 22190034, 23152885, 23455924, 24726341, 25284789, 25416956, 26575292, 31515488, 32296183, 32814053, 33961781, 34029587, 35271311, 39251607
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	10749851
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	26876602
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	9029147
GO:0005764	Component	Lysosome	IEA
GO:0005765	Component	Lysosomal membrane	IDA	38006878
GO:0005765	Component	Lysosomal membrane	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006338	Process	Chromatin remodeling	IBA
GO:0006355	Process	Regulation of DNA-templated transcription	IBA
GO:0006479	Process	Protein methylation	IMP	26876602, 28040436
GO:0006479	Process	Protein methylation	TAS	9545638
GO:0006974	Process	DNA damage response	IDA	15741314, 16294045
GO:0007166	Process	Cell surface receptor signaling pathway	TAS	9029147
GO:0008168	Function	Methyltransferase activity	IEA
GO:0008168	Function	Methyltransferase activity	TAS	9545638
GO:0008170	Function	N-methyltransferase activity	IDA	18657504
GO:0008170	Function	N-methyltransferase activity	IMP	19124016
GO:0008170	Function	N-methyltransferase activity	TAS	9029147
GO:0008276	Function	Protein methyltransferase activity	IDA	19460357, 22095282, 30765518
GO:0008276	Function	Protein methyltransferase activity	IEA
GO:0008276	Function	Protein methyltransferase activity	IMP	28040436
GO:0008276	Function	Protein methyltransferase activity	TAS
GO:0008284	Process	Positive regulation of cell population proliferation	IMP	28040436
GO:0008327	Function	Methyl-CpG binding	IDA	25284789
GO:0008380	Process	RNA splicing	IEA
GO:0008380	Process	RNA splicing	ISS
GO:0016020	Component	Membrane	IEA
GO:0016274	Function	Protein-arginine N-methyltransferase activity	EXP	18316480
GO:0016274	Function	Protein-arginine N-methyltransferase activity	IDA	18495660, 33667543
GO:0016274	Function	Protein-arginine N-methyltransferase activity	IEA
GO:0016274	Function	Protein-arginine N-methyltransferase activity	TAS
GO:0016740	Function	Transferase activity	IEA
GO:0017148	Process	Negative regulation of translation	IDA	30765518
GO:0018216	Process	Peptidyl-arginine methylation	IDA	18657504, 22095282, 26575292
GO:0019082	Process	Viral protein processing	TAS
GO:0019899	Function	Enzyme binding	IPI	19460357
GO:0030509	Process	BMP signaling pathway	IDA	8653785, 9389648
GO:0030510	Process	Regulation of BMP signaling pathway	IDA	33667543
GO:0030514	Process	Negative regulation of BMP signaling pathway	IDA	33667543
GO:0031175	Process	Neuron projection development	IMP	18773938
GO:0031669	Process	Cellular response to nutrient levels	IDA	31601708, 31601764
GO:0032259	Process	Methylation	IEA
GO:0034198	Process	Cellular response to amino acid starvation	IDA	35338845
GO:0034709	Component	Methylosome	IDA	25284789
GO:0035241	Function	Protein-arginine omega-N monomethyltransferase activity	IBA
GO:0035241	Function	Protein-arginine omega-N monomethyltransferase activity	IDA	26575292
GO:0035241	Function	Protein-arginine omega-N monomethyltransferase activity	IEA
GO:0035242	Function	Protein-arginine omega-N asymmetric methyltransferase activity	IBA
GO:0035242	Function	Protein-arginine omega-N asymmetric methyltransferase activity	IDA	15741314, 16294045, 26575292, 26876602, 27642082, 29651020
GO:0035242	Function	Protein-arginine omega-N asymmetric methyltransferase activity	IEA
GO:0035242	Function	Protein-arginine omega-N asymmetric methyltransferase activity	IMP	25284789
GO:0035242	Function	Protein-arginine omega-N asymmetric methyltransferase activity	TAS
GO:0038202	Process	TORC1 signaling	IDA	38006878
GO:0042054	Function	Histone methyltransferase activity	IBA
GO:0042054	Function	Histone methyltransferase activity	IDA	19405910
GO:0042054	Function	Histone methyltransferase activity	IEA
GO:0042802	Function	Identical protein binding	IDA	26876602
GO:0042802	Function	Identical protein binding	IPI	16169070, 23455924, 25416956, 32296183
GO:0044020	Function	Histone H4R3 methyltransferase activity	IDA	11448779
GO:0044020	Function	Histone H4R3 methyltransferase activity	IMP	25284789
GO:0045648	Process	Positive regulation of erythrocyte differentiation	IMP	23483889
GO:0045652	Process	Regulation of megakaryocyte differentiation	IDA	26575292
GO:0045652	Process	Regulation of megakaryocyte differentiation	TAS
GO:0045653	Process	Negative regulation of megakaryocyte differentiation	IDA	20442406
GO:0045727	Process	Positive regulation of translation	IDA	30765518
GO:0045947	Process	Negative regulation of translational initiation	IDA	30765518
GO:0046329	Process	Negative regulation of JNK cascade	IMP	22095282
GO:0046985	Process	Positive regulation of hemoglobin biosynthetic process	ISS
GO:0048273	Function	Mitogen-activated protein kinase p38 binding	IPI	23483889
GO:0048738	Process	Cardiac muscle tissue development	IEA
GO:0048738	Process	Cardiac muscle tissue development	ISS
GO:0051260	Process	Protein homooligomerization	IDA	26876602
GO:0051260	Process	Protein homooligomerization	IEA
GO:0061431	Process	Cellular response to methionine	IDA	38006878
GO:0061431	Process	Cellular response to methionine	IDA	38006878
GO:0061431	Process	Cellular response to methionine	IEA
GO:0061431	Process	Cellular response to methionine	ISS
GO:0061462	Process	Protein localization to lysosome	IDA	31601708
GO:0106080	Function	GATOR1 complex binding	IEA
GO:0106080	Function	GATOR1 complex binding	ISS
GO:0140694	Process	Membraneless organelle assembly	IDA	30765518
GO:0140939	Function	Histone H4 methyltransferase activity	IEA
GO:1900745	Process	Positive regulation of p38MAPK cascade	ISS
GO:1904047	Function	S-adenosyl-L-methionine binding	IDA	26876602
GO:1904047	Function	S-adenosyl-L-methionine binding	IEA
GO:1904262	Process	Negative regulation of TORC1 signaling	IDA	30651352, 35338845
GO:1904263	Process	Positive regulation of TORC1 signaling	IDA	31601708, 31601764
GO:1904263	Process	Positive regulation of TORC1 signaling	IDA	38006878
GO:1904263	Process	Positive regulation of TORC1 signaling	IEA
GO:1904263	Process	Positive regulation of TORC1 signaling	ISS
GO:1905168	Process	Positive regulation of double-strand break repair via homologous recombination	IDA	15741314, 29651020
GO:2000042	Process	Negative regulation of double-strand break repair via homologous recombination	IDA	23333306, 23345425

Other IDs

• MIM: 602950
• HGNC: 5187
• e!Ensembl: ENSG00000126457

Protein

• UniProt ID: Q99873
• Protein name: Protein arginine N-methyltransferase 1 (EC 2.1.1.319) (Histone-arginine N-methyltransferase PRMT1) (Interferon receptor 1-bound protein 4)
• Protein function: Arginine methyltransferase that methylates (mono and asymmetric dimethylation) the guanidino nitrogens of arginyl residues present in proteins such as ESR1, histone H2, H3 and H4, FMR1, ILF3, HNRNPA1, HNRNPD, NFATC2IP, SUPT5H, TAF15, EWS, HABP4,
• PDB: 6NT2
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13649	Methyltransf_25	92 → 189	Methyltransferase domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Widely expressed (PubMed:11097842). Expressed strongly in colorectal cancer cells (at protein level) (PubMed:28040436). Expressed strongly in colorectal cancer tissues compared to wild-type colon samples (at protein level) (PubMed:2804
• Sequence:

  MAAAEAANCIMENFVATLANGMSLQPPLEEVSCGQAESSEKPNAEDMTSKDYYFDSYAHF
  GIHEEMLKDEVRTLTYRNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGARKVIGIECS
  SISDYAVKIVKANKLDHVVTIIKGKVEEVELPVEKVDIIISEWMGYCLFYESMLNTVLYA
  RDKWLAPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVYGFDMSCIKDVAIKEPLVDVV
  DPKQLVTNACLIKEVDIYTVKVEDLTFTSPFCLQVKRNDYVHALVAYFNIEFTRCHKRTG
  FSTSPESPYTHWKQTVFYMEDYLTVKTGEEIFGTIGMRPNAKNNRDLDFTIDLDFKGQLC
  ELSCSTDYRMR

• Sequence length: 371

Pathways

KEGG Pathway	Reactome Pathway
FoxO signaling pathway	RMTs methylate histone arginines
Glucagon signaling pathway	TP53 Regulates Transcription of Genes Involved in G2 Cell Cycle Arrest
	RUNX1 regulates genes involved in megakaryocyte differentiation and platelet function
	Extra-nuclear estrogen signaling
	Estrogen-dependent gene expression

Related Genes

Sort by: Blended Diseases Pathways Evidence source

PRMT6 2 shared pathwaysRMTs methylate histone arginines, RUNX1 regulates genes involved in megakaryocyte differentiation and platelet function Related via 2 shared pathways including RMTs methylate histone arginines, RUNX1 regulates genes involved in megakaryocyte differentiation and platelet function. CARM1 3 shared pathwaysRMTs methylate histone arginines, Estrogen-dependent gene expression, TP53 Regulates Transcription of Genes Involved in G2 Cell Cycle Arrest Related via 3 shared pathways including RMTs methylate histone arginines, Estrogen-dependent gene expression. WDR5 2 shared pathwaysRMTs methylate histone arginines, RUNX1 regulates genes involved in megakaryocyte differentiation and platelet function Related via 2 shared pathways including RMTs methylate histone arginines, RUNX1 regulates genes involved in megakaryocyte differentiation and platelet function. G6PC1 2 shared pathwaysFoxO signaling pathway, Glucagon signaling pathway Related via 2 shared pathways including FoxO signaling pathway, Glucagon signaling pathway. G6PC2 2 shared pathwaysFoxO signaling pathway, Glucagon signaling pathway Related via 2 shared pathways including FoxO signaling pathway, Glucagon signaling pathway.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
PRMT6	0	[]	2	["RMTs methylate histone arginines","RUNX1 regulates genes involved in megakaryocyte differentiation and platelet function"]	0	[]
CARM1	0	[]	3	["RMTs methylate histone arginines","Estrogen-dependent gene expression","TP53 Regulates Transcription of Genes Involved in G2 Cell Cycle Arrest"]	0	[]
WDR5	0	[]	2	["RMTs methylate histone arginines","RUNX1 regulates genes involved in megakaryocyte differentiation and platelet function"]	0	[]
G6PC1	0	[]	2	["FoxO signaling pathway","Glucagon signaling pathway"]	0	[]
G6PC2	0	[]	2	["FoxO signaling pathway","Glucagon signaling pathway"]	0	[]

Diseases Linked via Similar Genes

Metabolic syndrome Linked via 2 of 5 related genesPRMT6, G6PC2 Diabetes mellitus type 2 Linked via 2 of 5 related genesPRMT6, G6PC2 Neurodevelopmental disorder Linked via 2 of 5 related genesCARM1, WDR5 Biliary tract cancer Linked via 1 of 5 related genesPRMT6 Breast cancer Linked via 1 of 5 related genesPRMT6

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Metabolic syndrome	2	["PRMT6","G6PC2"]
Diabetes mellitus type 2	2	["PRMT6","G6PC2"]
Neurodevelopmental disorder	2	["CARM1","WDR5"]
Biliary tract cancer	1	["PRMT6"]
Breast cancer	1	["PRMT6"]