Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	55170
Gene name	Protein arginine methyltransferase 6
Gene symbol	PRMT6
Synonyms (NCBI Gene)	HRMT1L6
Chromosome	1
Chromosome location	1p13.3
Summary	The protein encoded by this gene belongs to the arginine N-methyltransferase family, which catalyze the sequential transfer of methyl group from S-adenosyl-L-methionine to the side chain nitrogens of arginine residues within proteins, to form methylated a

390 Show/Hide all (390)

miRTarBase ID	miRNA	Experiments	Reference
MIRT569367	hsa-miR-6895-5p	PAR-CLIP	20371350
MIRT569366	hsa-miR-3919	PAR-CLIP	20371350
MIRT569365	hsa-miR-4756-3p	PAR-CLIP	20371350
MIRT569363	hsa-miR-4330	PAR-CLIP	20371350
MIRT569364	hsa-miR-617	PAR-CLIP	20371350
MIRT569362	hsa-miR-6505-3p	PAR-CLIP	20371350
MIRT569367	hsa-miR-6895-5p	PAR-CLIP	20371350
MIRT569366	hsa-miR-3919	PAR-CLIP	20371350
MIRT569365	hsa-miR-4756-3p	PAR-CLIP	20371350
MIRT569363	hsa-miR-4330	PAR-CLIP	20371350
MIRT569367	hsa-miR-6895-5p	PAR-CLIP	20371350
MIRT569366	hsa-miR-3919	PAR-CLIP	20371350
MIRT569365	hsa-miR-4756-3p	PAR-CLIP	20371350
MIRT569363	hsa-miR-4330	PAR-CLIP	20371350
MIRT569364	hsa-miR-617	PAR-CLIP	20371350
MIRT569362	hsa-miR-6505-3p	PAR-CLIP	20371350
MIRT569367	hsa-miR-6895-5p	PAR-CLIP	20371350
MIRT569366	hsa-miR-3919	PAR-CLIP	20371350
MIRT569365	hsa-miR-4756-3p	PAR-CLIP	20371350
MIRT569363	hsa-miR-4330	PAR-CLIP	20371350
MIRT569364	hsa-miR-617	PAR-CLIP	20371350
MIRT569362	hsa-miR-6505-3p	PAR-CLIP	20371350
MIRT569367	hsa-miR-6895-5p	PAR-CLIP	20371350
MIRT569366	hsa-miR-3919	PAR-CLIP	20371350
MIRT569365	hsa-miR-4756-3p	PAR-CLIP	20371350
MIRT569363	hsa-miR-4330	PAR-CLIP	20371350
MIRT569367	hsa-miR-6895-5p	PAR-CLIP	20371350
MIRT569366	hsa-miR-3919	PAR-CLIP	20371350
MIRT569365	hsa-miR-4756-3p	PAR-CLIP	20371350
MIRT569363	hsa-miR-4330	PAR-CLIP	20371350
MIRT569364	hsa-miR-617	PAR-CLIP	20371350
MIRT569362	hsa-miR-6505-3p	PAR-CLIP	20371350
MIRT1264649	hsa-miR-103b	CLIP-seq
MIRT1264650	hsa-miR-105	CLIP-seq
MIRT1264651	hsa-miR-1206	CLIP-seq
MIRT1264652	hsa-miR-1226	CLIP-seq
MIRT1264653	hsa-miR-1236	CLIP-seq
MIRT1264654	hsa-miR-1237	CLIP-seq
MIRT1264655	hsa-miR-1243	CLIP-seq
MIRT1264656	hsa-miR-1272	CLIP-seq
MIRT1264657	hsa-miR-1294	CLIP-seq
MIRT1264658	hsa-miR-1304	CLIP-seq
MIRT1264659	hsa-miR-1321	CLIP-seq
MIRT1264660	hsa-miR-1322	CLIP-seq
MIRT1264661	hsa-miR-135a	CLIP-seq
MIRT1264662	hsa-miR-135b	CLIP-seq
MIRT1264663	hsa-miR-146a	CLIP-seq
MIRT1264664	hsa-miR-146b-5p	CLIP-seq
MIRT1264665	hsa-miR-1470	CLIP-seq
MIRT1264666	hsa-miR-1587	CLIP-seq
MIRT1264667	hsa-miR-185	CLIP-seq
MIRT1264668	hsa-miR-18a	CLIP-seq
MIRT1264669	hsa-miR-18b	CLIP-seq
MIRT1264670	hsa-miR-191	CLIP-seq
MIRT1264671	hsa-miR-199a-3p	CLIP-seq
MIRT1264672	hsa-miR-199b-3p	CLIP-seq
MIRT1264673	hsa-miR-200b	CLIP-seq
MIRT1264674	hsa-miR-200c	CLIP-seq
MIRT1264675	hsa-miR-2115	CLIP-seq
MIRT1264676	hsa-miR-2116	CLIP-seq
MIRT1264677	hsa-miR-216b	CLIP-seq
MIRT1264678	hsa-miR-224	CLIP-seq
MIRT1264679	hsa-miR-2355-5p	CLIP-seq
MIRT1264680	hsa-miR-23a	CLIP-seq
MIRT1264681	hsa-miR-23b	CLIP-seq
MIRT1264682	hsa-miR-23c	CLIP-seq
MIRT1264683	hsa-miR-24	CLIP-seq
MIRT1264684	hsa-miR-2467-5p	CLIP-seq
MIRT1264685	hsa-miR-297	CLIP-seq
MIRT1264686	hsa-miR-299-3p	CLIP-seq
MIRT1264687	hsa-miR-29a	CLIP-seq
MIRT1264688	hsa-miR-29b	CLIP-seq
MIRT1264689	hsa-miR-29c	CLIP-seq
MIRT1264690	hsa-miR-300	CLIP-seq
MIRT1264691	hsa-miR-302a	CLIP-seq
MIRT1264692	hsa-miR-302b	CLIP-seq
MIRT1264693	hsa-miR-302c	CLIP-seq
MIRT1264694	hsa-miR-302d	CLIP-seq
MIRT1264695	hsa-miR-302e	CLIP-seq
MIRT1264696	hsa-miR-30a	CLIP-seq
MIRT1264697	hsa-miR-30b	CLIP-seq
MIRT1264698	hsa-miR-30c	CLIP-seq
MIRT1264699	hsa-miR-30d	CLIP-seq
MIRT1264700	hsa-miR-30e	CLIP-seq
MIRT1264701	hsa-miR-3127-3p	CLIP-seq
MIRT1264702	hsa-miR-3129-5p	CLIP-seq
MIRT1264703	hsa-miR-3140-3p	CLIP-seq
MIRT1264704	hsa-miR-3162-5p	CLIP-seq
MIRT1264705	hsa-miR-3171	CLIP-seq
MIRT1264706	hsa-miR-3184	CLIP-seq
MIRT1264707	hsa-miR-3185	CLIP-seq
MIRT1264708	hsa-miR-3188	CLIP-seq
MIRT1264709	hsa-miR-3189-3p	CLIP-seq
MIRT1264710	hsa-miR-323-3p	CLIP-seq
MIRT1264711	hsa-miR-331-5p	CLIP-seq
MIRT1264712	hsa-miR-3606	CLIP-seq
MIRT1264713	hsa-miR-362-5p	CLIP-seq
MIRT1264714	hsa-miR-3646	CLIP-seq
MIRT1264715	hsa-miR-365	CLIP-seq
MIRT1264716	hsa-miR-3654	CLIP-seq
MIRT1264717	hsa-miR-3667-3p	CLIP-seq
MIRT1264718	hsa-miR-3671	CLIP-seq
MIRT1264719	hsa-miR-3679-3p	CLIP-seq
MIRT1264720	hsa-miR-3685	CLIP-seq
MIRT1264721	hsa-miR-3713	CLIP-seq
MIRT1264722	hsa-miR-372	CLIP-seq
MIRT1264723	hsa-miR-373	CLIP-seq
MIRT1264724	hsa-miR-381	CLIP-seq
MIRT1264725	hsa-miR-384	CLIP-seq
MIRT1264726	hsa-miR-3915	CLIP-seq
MIRT1264727	hsa-miR-3928	CLIP-seq
MIRT1264728	hsa-miR-3975	CLIP-seq
MIRT1264729	hsa-miR-423-5p	CLIP-seq
MIRT1264730	hsa-miR-4251	CLIP-seq
MIRT1264731	hsa-miR-4269	CLIP-seq
MIRT1264732	hsa-miR-4270	CLIP-seq
MIRT1264733	hsa-miR-4287	CLIP-seq
MIRT1264734	hsa-miR-429	CLIP-seq
MIRT1264735	hsa-miR-4303	CLIP-seq
MIRT1264736	hsa-miR-4306	CLIP-seq
MIRT1264737	hsa-miR-4316	CLIP-seq
MIRT1264738	hsa-miR-4436b-3p	CLIP-seq
MIRT1264739	hsa-miR-4438	CLIP-seq
MIRT1264740	hsa-miR-4441	CLIP-seq
MIRT1264741	hsa-miR-4469	CLIP-seq
MIRT1264742	hsa-miR-4491	CLIP-seq
MIRT1264743	hsa-miR-4494	CLIP-seq
MIRT1264744	hsa-miR-4517	CLIP-seq
MIRT1264745	hsa-miR-4525	CLIP-seq
MIRT1264746	hsa-miR-4639-3p	CLIP-seq
MIRT1264747	hsa-miR-4644	CLIP-seq
MIRT1264748	hsa-miR-4657	CLIP-seq
MIRT1264749	hsa-miR-4667-3p	CLIP-seq
MIRT1264750	hsa-miR-4670-3p	CLIP-seq
MIRT1264751	hsa-miR-4674	CLIP-seq
MIRT1264752	hsa-miR-4677-5p	CLIP-seq
MIRT1264753	hsa-miR-4678	CLIP-seq
MIRT1264754	hsa-miR-4682	CLIP-seq
MIRT1264755	hsa-miR-4685-3p	CLIP-seq
MIRT1264756	hsa-miR-4712-3p	CLIP-seq
MIRT1264757	hsa-miR-4713-5p	CLIP-seq
MIRT1264758	hsa-miR-4716-3p	CLIP-seq
MIRT1264759	hsa-miR-4717-3p	CLIP-seq
MIRT1264760	hsa-miR-4717-5p	CLIP-seq
MIRT1264761	hsa-miR-4718	CLIP-seq
MIRT1264762	hsa-miR-4728-3p	CLIP-seq
MIRT1264763	hsa-miR-4728-5p	CLIP-seq
MIRT1264764	hsa-miR-4733-3p	CLIP-seq
MIRT1264765	hsa-miR-4735-3p	CLIP-seq
MIRT1264766	hsa-miR-4739	CLIP-seq
MIRT1264767	hsa-miR-4740-5p	CLIP-seq
MIRT1264768	hsa-miR-4756-5p	CLIP-seq
MIRT1264769	hsa-miR-4764-5p	CLIP-seq
MIRT1264770	hsa-miR-4773	CLIP-seq
MIRT1264771	hsa-miR-4799-5p	CLIP-seq
MIRT1264772	hsa-miR-4800-3p	CLIP-seq
MIRT1264773	hsa-miR-483-3p	CLIP-seq
MIRT1264774	hsa-miR-485-3p	CLIP-seq
MIRT1264775	hsa-miR-485-5p	CLIP-seq
MIRT1264776	hsa-miR-487a	CLIP-seq
MIRT1264777	hsa-miR-499-3p	CLIP-seq
MIRT1264778	hsa-miR-499a-3p	CLIP-seq
MIRT1264779	hsa-miR-499a-5p	CLIP-seq
MIRT1264780	hsa-miR-500b	CLIP-seq
MIRT1264781	hsa-miR-501-3p	CLIP-seq
MIRT1264782	hsa-miR-501-5p	CLIP-seq
MIRT1264783	hsa-miR-502-3p	CLIP-seq
MIRT1264784	hsa-miR-5095	CLIP-seq
MIRT1264785	hsa-miR-513b	CLIP-seq
MIRT1264786	hsa-miR-516a-3p	CLIP-seq
MIRT1264787	hsa-miR-516b	CLIP-seq
MIRT1264788	hsa-miR-520a-3p	CLIP-seq
MIRT1264789	hsa-miR-520b	CLIP-seq
MIRT1264790	hsa-miR-520c-3p	CLIP-seq
MIRT1264791	hsa-miR-520d-3p	CLIP-seq
MIRT1264792	hsa-miR-520e	CLIP-seq
MIRT1264793	hsa-miR-520f	CLIP-seq
MIRT1264794	hsa-miR-539	CLIP-seq
MIRT1264795	hsa-miR-548g	CLIP-seq
MIRT1264796	hsa-miR-562	CLIP-seq
MIRT1264797	hsa-miR-567	CLIP-seq
MIRT1264798	hsa-miR-570	CLIP-seq
MIRT1264799	hsa-miR-577	CLIP-seq
MIRT1264800	hsa-miR-580	CLIP-seq
MIRT1264801	hsa-miR-589	CLIP-seq
MIRT1264802	hsa-miR-607	CLIP-seq
MIRT1264803	hsa-miR-625	CLIP-seq
MIRT1264804	hsa-miR-634	CLIP-seq
MIRT1264805	hsa-miR-635	CLIP-seq
MIRT1264806	hsa-miR-636	CLIP-seq
MIRT1264807	hsa-miR-645	CLIP-seq
MIRT1264808	hsa-miR-647	CLIP-seq
MIRT1264809	hsa-miR-653	CLIP-seq
MIRT1264810	hsa-miR-668	CLIP-seq
MIRT1264811	hsa-miR-711	CLIP-seq
MIRT1264812	hsa-miR-759	CLIP-seq
MIRT1264813	hsa-miR-760	CLIP-seq
MIRT1264814	hsa-miR-875-3p	CLIP-seq
MIRT1264815	hsa-miR-889	CLIP-seq
MIRT1552571	hsa-let-7a	CLIP-seq
MIRT1552572	hsa-let-7b	CLIP-seq
MIRT1552573	hsa-let-7c	CLIP-seq
MIRT1552574	hsa-let-7d	CLIP-seq
MIRT1552575	hsa-let-7e	CLIP-seq
MIRT1552576	hsa-let-7f	CLIP-seq
MIRT1552577	hsa-let-7g	CLIP-seq
MIRT1552578	hsa-let-7i	CLIP-seq
MIRT1552579	hsa-miR-3122	CLIP-seq
MIRT1552580	hsa-miR-3689a-3p	CLIP-seq
MIRT1552581	hsa-miR-3689c	CLIP-seq
MIRT1552582	hsa-miR-3913-5p	CLIP-seq
MIRT1552583	hsa-miR-4458	CLIP-seq
MIRT1552584	hsa-miR-4500	CLIP-seq
MIRT1264763	hsa-miR-4728-5p	CLIP-seq
MIRT1552585	hsa-miR-98	CLIP-seq
MIRT1552571	hsa-let-7a	CLIP-seq
MIRT1552572	hsa-let-7b	CLIP-seq
MIRT1552573	hsa-let-7c	CLIP-seq
MIRT1552574	hsa-let-7d	CLIP-seq
MIRT1552575	hsa-let-7e	CLIP-seq
MIRT1552576	hsa-let-7f	CLIP-seq
MIRT1552577	hsa-let-7g	CLIP-seq
MIRT1552578	hsa-let-7i	CLIP-seq
MIRT1264651	hsa-miR-1206	CLIP-seq
MIRT2077820	hsa-miR-1228	CLIP-seq
MIRT2077821	hsa-miR-1252	CLIP-seq
MIRT2077822	hsa-miR-1258	CLIP-seq
MIRT1264656	hsa-miR-1272	CLIP-seq
MIRT2077823	hsa-miR-1302	CLIP-seq
MIRT1264658	hsa-miR-1304	CLIP-seq
MIRT1264660	hsa-miR-1322	CLIP-seq
MIRT2077824	hsa-miR-141	CLIP-seq
MIRT1264663	hsa-miR-146a	CLIP-seq
MIRT1264664	hsa-miR-146b-5p	CLIP-seq
MIRT1264665	hsa-miR-1470	CLIP-seq
MIRT1264670	hsa-miR-191	CLIP-seq
MIRT2077825	hsa-miR-194	CLIP-seq
MIRT2077826	hsa-miR-200a	CLIP-seq
MIRT2077827	hsa-miR-204	CLIP-seq
MIRT2077828	hsa-miR-211	CLIP-seq
MIRT1264675	hsa-miR-2115	CLIP-seq
MIRT1264676	hsa-miR-2116	CLIP-seq
MIRT2077829	hsa-miR-219-2-3p	CLIP-seq
MIRT1264678	hsa-miR-224	CLIP-seq
MIRT2077830	hsa-miR-2355-3p	CLIP-seq
MIRT1264684	hsa-miR-2467-5p	CLIP-seq
MIRT2077831	hsa-miR-2964a-3p	CLIP-seq
MIRT1264685	hsa-miR-297	CLIP-seq
MIRT1264686	hsa-miR-299-3p	CLIP-seq
MIRT1264687	hsa-miR-29a	CLIP-seq
MIRT1264688	hsa-miR-29b	CLIP-seq
MIRT1264689	hsa-miR-29c	CLIP-seq
MIRT2077832	hsa-miR-3115	CLIP-seq
MIRT1552579	hsa-miR-3122	CLIP-seq
MIRT1264701	hsa-miR-3127-3p	CLIP-seq
MIRT2077833	hsa-miR-3129-3p	CLIP-seq
MIRT2077834	hsa-miR-3140-5p	CLIP-seq
MIRT2077835	hsa-miR-3153	CLIP-seq
MIRT2077836	hsa-miR-3155	CLIP-seq
MIRT2077837	hsa-miR-3155b	CLIP-seq
MIRT2077838	hsa-miR-3161	CLIP-seq
MIRT1264705	hsa-miR-3171	CLIP-seq
MIRT2077839	hsa-miR-3174	CLIP-seq
MIRT2077840	hsa-miR-3175	CLIP-seq
MIRT2077841	hsa-miR-3179	CLIP-seq
MIRT1264708	hsa-miR-3188	CLIP-seq
MIRT2077842	hsa-miR-3591-3p	CLIP-seq
MIRT1264713	hsa-miR-362-5p	CLIP-seq
MIRT1264714	hsa-miR-3646	CLIP-seq
MIRT1264715	hsa-miR-365	CLIP-seq
MIRT2077843	hsa-miR-3653	CLIP-seq
MIRT2077844	hsa-miR-3658	CLIP-seq
MIRT1264717	hsa-miR-3667-3p	CLIP-seq
MIRT1264719	hsa-miR-3679-3p	CLIP-seq
MIRT1552580	hsa-miR-3689a-3p	CLIP-seq
MIRT1552581	hsa-miR-3689c	CLIP-seq
MIRT2077845	hsa-miR-377	CLIP-seq
MIRT1552582	hsa-miR-3913-5p	CLIP-seq
MIRT2077846	hsa-miR-3938	CLIP-seq
MIRT2077847	hsa-miR-3941	CLIP-seq
MIRT2077848	hsa-miR-3942-3p	CLIP-seq
MIRT1264728	hsa-miR-3975	CLIP-seq
MIRT2077849	hsa-miR-4261	CLIP-seq
MIRT1264733	hsa-miR-4287	CLIP-seq
MIRT2077850	hsa-miR-4298	CLIP-seq
MIRT2077851	hsa-miR-4307	CLIP-seq
MIRT2077852	hsa-miR-4328	CLIP-seq
MIRT2077853	hsa-miR-4452	CLIP-seq
MIRT1552583	hsa-miR-4458	CLIP-seq
MIRT1264741	hsa-miR-4469	CLIP-seq
MIRT2077854	hsa-miR-4476	CLIP-seq
MIRT1264742	hsa-miR-4491	CLIP-seq
MIRT2077855	hsa-miR-4496	CLIP-seq
MIRT1552584	hsa-miR-4500	CLIP-seq
MIRT2077856	hsa-miR-450b-3p	CLIP-seq
MIRT2077857	hsa-miR-4511	CLIP-seq
MIRT2077858	hsa-miR-4533	CLIP-seq
MIRT1264746	hsa-miR-4639-3p	CLIP-seq
MIRT2077859	hsa-miR-4646-5p	CLIP-seq
MIRT2077860	hsa-miR-4654	CLIP-seq
MIRT1264748	hsa-miR-4657	CLIP-seq
MIRT2077861	hsa-miR-466	CLIP-seq
MIRT1264749	hsa-miR-4667-3p	CLIP-seq
MIRT2077862	hsa-miR-4668-5p	CLIP-seq
MIRT1264750	hsa-miR-4670-3p	CLIP-seq
MIRT2077863	hsa-miR-4672	CLIP-seq
MIRT2077864	hsa-miR-4675	CLIP-seq
MIRT1264752	hsa-miR-4677-5p	CLIP-seq
MIRT1264755	hsa-miR-4685-3p	CLIP-seq
MIRT2077865	hsa-miR-4713-3p	CLIP-seq
MIRT1264758	hsa-miR-4716-3p	CLIP-seq
MIRT1264759	hsa-miR-4717-3p	CLIP-seq
MIRT1264760	hsa-miR-4717-5p	CLIP-seq
MIRT2077866	hsa-miR-4719	CLIP-seq
MIRT2077867	hsa-miR-4723-5p	CLIP-seq
MIRT1264763	hsa-miR-4728-5p	CLIP-seq
MIRT2077868	hsa-miR-4731-3p	CLIP-seq
MIRT2077869	hsa-miR-4741	CLIP-seq
MIRT2077870	hsa-miR-4769-5p	CLIP-seq
MIRT1264770	hsa-miR-4773	CLIP-seq
MIRT2077871	hsa-miR-4778-5p	CLIP-seq
MIRT2077872	hsa-miR-4801	CLIP-seq
MIRT1264773	hsa-miR-483-3p	CLIP-seq
MIRT2077873	hsa-miR-484	CLIP-seq
MIRT1264775	hsa-miR-485-5p	CLIP-seq
MIRT2077874	hsa-miR-494	CLIP-seq
MIRT1264780	hsa-miR-500b	CLIP-seq
MIRT1264781	hsa-miR-501-3p	CLIP-seq
MIRT1264782	hsa-miR-501-5p	CLIP-seq
MIRT1264783	hsa-miR-502-3p	CLIP-seq
MIRT2077875	hsa-miR-5096	CLIP-seq
MIRT1264786	hsa-miR-516a-3p	CLIP-seq
MIRT1264794	hsa-miR-539	CLIP-seq
MIRT2077876	hsa-miR-548an	CLIP-seq
MIRT2077877	hsa-miR-548b-3p	CLIP-seq
MIRT1264795	hsa-miR-548g	CLIP-seq
MIRT1264797	hsa-miR-567	CLIP-seq
MIRT1264801	hsa-miR-589	CLIP-seq
MIRT2077878	hsa-miR-624	CLIP-seq
MIRT2077879	hsa-miR-638	CLIP-seq
MIRT2077880	hsa-miR-660	CLIP-seq
MIRT1264810	hsa-miR-668	CLIP-seq
MIRT2077881	hsa-miR-676	CLIP-seq
MIRT1264812	hsa-miR-759	CLIP-seq
MIRT2077882	hsa-miR-769-3p	CLIP-seq
MIRT1552585	hsa-miR-98	CLIP-seq
MIRT1264650	hsa-miR-105	CLIP-seq
MIRT1264651	hsa-miR-1206	CLIP-seq
MIRT1264652	hsa-miR-1226	CLIP-seq
MIRT1264653	hsa-miR-1236	CLIP-seq
MIRT1264656	hsa-miR-1272	CLIP-seq
MIRT1264660	hsa-miR-1322	CLIP-seq
MIRT1264665	hsa-miR-1470	CLIP-seq
MIRT1264670	hsa-miR-191	CLIP-seq
MIRT1264677	hsa-miR-216b	CLIP-seq
MIRT1264678	hsa-miR-224	CLIP-seq
MIRT1264685	hsa-miR-297	CLIP-seq
MIRT1264686	hsa-miR-299-3p	CLIP-seq
MIRT1264687	hsa-miR-29a	CLIP-seq
MIRT1264688	hsa-miR-29b	CLIP-seq
MIRT1264689	hsa-miR-29c	CLIP-seq
MIRT1264696	hsa-miR-30a	CLIP-seq
MIRT1264697	hsa-miR-30b	CLIP-seq
MIRT1264698	hsa-miR-30c	CLIP-seq
MIRT1264699	hsa-miR-30d	CLIP-seq
MIRT1264700	hsa-miR-30e	CLIP-seq
MIRT1264705	hsa-miR-3171	CLIP-seq
MIRT2077842	hsa-miR-3591-3p	CLIP-seq
MIRT1264718	hsa-miR-3671	CLIP-seq
MIRT2077848	hsa-miR-3942-3p	CLIP-seq
MIRT1264733	hsa-miR-4287	CLIP-seq
MIRT2077852	hsa-miR-4328	CLIP-seq
MIRT1264741	hsa-miR-4469	CLIP-seq
MIRT1264742	hsa-miR-4491	CLIP-seq
MIRT2304398	hsa-miR-4528	CLIP-seq
MIRT1264746	hsa-miR-4639-3p	CLIP-seq
MIRT1264748	hsa-miR-4657	CLIP-seq
MIRT1264749	hsa-miR-4667-3p	CLIP-seq
MIRT1264755	hsa-miR-4685-3p	CLIP-seq
MIRT2304399	hsa-miR-4694-3p	CLIP-seq
MIRT2077868	hsa-miR-4731-3p	CLIP-seq
MIRT1264764	hsa-miR-4733-3p	CLIP-seq
MIRT2077872	hsa-miR-4801	CLIP-seq
MIRT1264777	hsa-miR-499-3p	CLIP-seq
MIRT1264778	hsa-miR-499a-3p	CLIP-seq
MIRT2077875	hsa-miR-5096	CLIP-seq
MIRT1264797	hsa-miR-567	CLIP-seq
MIRT1264802	hsa-miR-607	CLIP-seq
MIRT1264810	hsa-miR-668	CLIP-seq
MIRT1264812	hsa-miR-759	CLIP-seq

43 Show/Hide all (43)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0003682	Function	Chromatin binding	IEA
GO:0005515	Function	Protein binding	IPI	16157300, 16293633, 16600869, 23455924, 25416956, 28514442, 30420520, 32828318, 33961781
GO:0005634	Component	Nucleus	IDA	11724789
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005730	Component	Nucleolus	IDA
GO:0006281	Process	DNA repair	IEA
GO:0006284	Process	Base-excision repair	TAS	16600869
GO:0006325	Process	Chromatin organization	IEA
GO:0006338	Process	Chromatin remodeling	IBA
GO:0006338	Process	Chromatin remodeling	IDA	30420520
GO:0006355	Process	Regulation of DNA-templated transcription	IBA
GO:0006974	Process	DNA damage response	IEA
GO:0008168	Function	Methyltransferase activity	IEA
GO:0008469	Function	Histone arginine N-methyltransferase activity	IDA	23980157
GO:0010821	Process	Regulation of mitochondrion organization	IDA	30420520
GO:0016274	Function	Protein-arginine N-methyltransferase activity	IBA
GO:0016274	Function	Protein-arginine N-methyltransferase activity	IDA	30420520
GO:0016274	Function	Protein-arginine N-methyltransferase activity	IEA
GO:0016274	Function	Protein-arginine N-methyltransferase activity	TAS
GO:0016740	Function	Transferase activity	IEA
GO:0032259	Process	Methylation	IEA
GO:0033554	Process	Cellular response to stress	IEA
GO:0035241	Function	Protein-arginine omega-N monomethyltransferase activity	IDA	11724789, 16157300, 16600869
GO:0035242	Function	Protein-arginine omega-N asymmetric methyltransferase activity	IDA	11724789, 16157300, 17898714, 18079182, 30420520
GO:0035242	Function	Protein-arginine omega-N asymmetric methyltransferase activity	IEA
GO:0042054	Function	Histone methyltransferase activity	IBA
GO:0042054	Function	Histone methyltransferase activity	IDA	19405910
GO:0042393	Function	Histone binding	IDA	17898714, 18079182
GO:0044020	Function	Histone H4R3 methyltransferase activity	IDA	18079182
GO:0045652	Process	Regulation of megakaryocyte differentiation	TAS
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	18079182
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0070611	Function	Histone H3R2 methyltransferase activity	IDA	17898714, 18079182
GO:0070611	Function	Histone H3R2 methyltransferase activity	IEA
GO:0070612	Function	Histone H2AR3 methyltransferase activity	IDA	18079182
GO:0090398	Process	Cellular senescence	IEA
GO:0140938	Function	Histone H3 methyltransferase activity	EXP	19509293, 22777353
GO:0140938	Function	Histone H3 methyltransferase activity	TAS
GO:1901796	Process	Regulation of signal transduction by p53 class mediator	IEA
GO:2000059	Process	Negative regulation of ubiquitin-dependent protein catabolic process	IEA

MIM	HGNC	e!Ensembl
608274	18241	ENSG00000198890

Q96LA8

Protein name

Protein arginine N-methyltransferase 6 (EC 2.1.1.319) (Heterogeneous nuclear ribonucleoprotein methyltransferase-like protein 6) (Histone-arginine N-methyltransferase PRMT6)

Protein function

Arginine methyltransferase that can catalyze the formation of both omega-N monomethylarginine (MMA) and asymmetrical dimethylarginine (aDMA), with a strong preference for the formation of aDMA (PubMed:17898714, PubMed:18077460, PubMed:18079182,

PDB

4HC4 , 4QPP , 4QQK , 4Y2H , 4Y30 , 5E8R , 5EGS , 5HZM , 5WCF , 6P7I , 6W6D , 6WAD , 7NR4

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13649	Methyltransf_25	86 → 182	Methyltransferase domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in kidney and testis. {ECO:0000269|PubMed:11724789}.

Sequence

MSQPKKRKLESGGGGEGGEGTEEEDGAEREAALERPRRTKRERDQLYYECYSDVSVHEEM
IADRVRTDAYRLGILRNWAALRGKTVLDVGAGTGILSIFCAQAGARRVYAVEASAIWQQA
REVVRFNGLEDRVHVLPGPVETVELPEQVDAIVSEWMGYGLLHESMLSSVLHARTKWLKE
GGLLLPASAELFIAPISDQMLEWRLGFWSQVKQHYGVDMSCLEGFATRCLMGHSEIVVQG
LSGEDVLARPQRFAQLELSRAGLEQELEAGVGGRFRCSCYGSAPMHGFAIWFQVTFPGGE
SEKPLVLSTSPFHPATHWKQALLYLNEPVQVEQDTDVSGEITLLPSRDNPRRLRVLLRYK
VGDQEEKTKDFAMED

Sequence length

375

Interactions

View interactions

Reactome Pathway
RMTs methylate histone arginines
RUNX1 regulates genes involved in megakaryocyte differentiation and platelet function

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (26)
BILIARY TRACT CANCER	—	GWAS catalog	37340002	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	37340002	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANCER	—	GWAS catalog	37340002	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CERVICAL CARCINOMA	—	GWAS catalog	37340002	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	37340002	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL CANCER	—	GWAS catalog	37340002	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL CANCER	—	GWAS catalog	37340002	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN-RECEPTOR NEGATIVE BREAST CANCER	—	GWAS catalog	37340002	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTRIC CANCER	—	GWAS catalog	37340002	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GESTATIONAL DIABETES	—	GWAS catalog	38087213	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATOCELLULAR CARCINOMA	—	GWAS catalog	37340002	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	37340002	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CANCER	—	GWAS catalog	37340002	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	37340002	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	39349817	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-HODGKINS LYMPHOMA	—	GWAS catalog	37340002	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CANCER	—	GWAS catalog	37340002	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	37340002	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN ENDOMETRIOID CARCINOMA	—	GWAS catalog	37340002	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN SEROUS CARCINOMA	—	GWAS catalog	37340002	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATIC CARCINOMA	—	GWAS catalog	37340002	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRMT6-related disorder	Benign; Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	37340002	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SMALL VESSEL STROKE	—	GWAS catalog	34031191	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	37340002	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	39349817	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (44)
Anemia	Anemia	Pubtator	38385251	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Azoospermia	Azoospermia	Pubtator	24303009	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Azoospermia, Nonobstructive	Azoospermia	BEFREE	30863997		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	29138553		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	22673335, 22987071, 23380452, 24447537		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	20047962, 24447537, 24742914, 36941223	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bulbo-Spinal Atrophy, X-Linked	Bulbospinal Atrophy, X-Linked	BEFREE	25569348		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	33740472	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	31619507		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	29410016		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	31154022		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	29507670, 29927001		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	29927001	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	38087213	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	38299254	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	33740472, 36792756	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	36792756	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	36941223	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	24165912	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	38340948	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	30332648, 31469916		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	31619507		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malformations of Cortical Development, Group II	Malformation of cortical development	BEFREE	19509293		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	22673335, 22987071, 23380452, 24447537		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	31619507		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	27323813		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	30508037		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	19509293, 20473859, 22673335, 22987071, 24447537, 26436589, 29262320, 29927001, 30332648		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	22673335		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	30942395		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	30332648, 31154022		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	19726520	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-obstructive azoospermia	Non-obstructive azoospermia	BEFREE	22197933		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	24570487		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oligospermia	Oligospermia	BEFREE	24303009		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	19509293		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	22916108	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	27323813		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	27323813, 29115463, 36814156, 38299254	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	27480107	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	29138553		★★★★★ ★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency disease	BEFREE	22987071		★★★★★ ★☆☆☆☆ Found in Text Mining only
Splenomegaly	Splenomegaly	Pubtator	38340948	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	30508037		★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
EPHB6	10	["Biliary tract cancer","Cancer","Cervical cancer","Endometrial cancer","Esophageal cancer","Estrogen-receptor negative breast cancer","Pancreatic cancer","Gastric cancer","Non-hodgkins lymphoma","Ovarian serous carcinoma"]	[]	11	["GWAS catalog (Biliary tract cancer)","GWAS catalog (Cancer)","GWAS catalog (Cervical cancer)","GWAS catalog (Endometrial cancer)","GWAS catalog (Esophageal cancer)","GWAS catalog (Estrogen-receptor negative breast cancer)","GWAS catalog (Pancreatic cancer)","GWAS catalog (Gastric cancer)","GWAS catalog (Hepatocellular carcinoma)","GWAS catalog (Non-hodgkins lymphoma)","GWAS catalog (Ovarian serous carcinoma)"]
GPR137	10	["Biliary tract cancer","Cancer","Cervical cancer","Endometrial cancer","Esophageal cancer","Estrogen-receptor negative breast cancer","Pancreatic cancer","Gastric cancer","Non-hodgkins lymphoma","Ovarian serous carcinoma"]	[]	11	["GWAS catalog (Biliary tract cancer)","GWAS catalog (Cancer)","GWAS catalog (Cervical cancer)","GWAS catalog (Endometrial cancer)","GWAS catalog (Esophageal cancer)","GWAS catalog (Estrogen-receptor negative breast cancer)","GWAS catalog (Pancreatic cancer)","GWAS catalog (Gastric cancer)","GWAS catalog (Hepatocellular carcinoma)","GWAS catalog (Non-hodgkins lymphoma)","GWAS catalog (Ovarian serous carcinoma)"]
OR6C6	10	["Biliary tract cancer","Cancer","Cervical cancer","Endometrial cancer","Esophageal cancer","Estrogen-receptor negative breast cancer","Pancreatic cancer","Gastric cancer","Non-hodgkins lymphoma","Ovarian serous carcinoma"]	[]	11	["GWAS catalog (Biliary tract cancer)","GWAS catalog (Cancer)","GWAS catalog (Cervical cancer)","GWAS catalog (Endometrial cancer)","GWAS catalog (Esophageal cancer)","GWAS catalog (Estrogen-receptor negative breast cancer)","GWAS catalog (Pancreatic cancer)","GWAS catalog (Gastric cancer)","GWAS catalog (Hepatocellular carcinoma)","GWAS catalog (Non-hodgkins lymphoma)","GWAS catalog (Ovarian serous carcinoma)"]
RBM25	10	["Biliary tract cancer","Cancer","Cervical cancer","Endometrial cancer","Esophageal cancer","Estrogen-receptor negative breast cancer","Pancreatic cancer","Gastric cancer","Non-hodgkins lymphoma","Ovarian serous carcinoma"]	[]	11	["GWAS catalog (Biliary tract cancer)","GWAS catalog (Cancer)","GWAS catalog (Cervical cancer)","GWAS catalog (Endometrial cancer)","GWAS catalog (Esophageal cancer)","GWAS catalog (Estrogen-receptor negative breast cancer)","GWAS catalog (Pancreatic cancer)","GWAS catalog (Gastric cancer)","GWAS catalog (Hepatocellular carcinoma)","GWAS catalog (Non-hodgkins lymphoma)","GWAS catalog (Ovarian serous carcinoma)"]
TMX1	10	["Biliary tract cancer","Cancer","Cervical cancer","Endometrial cancer","Esophageal cancer","Estrogen-receptor negative breast cancer","Pancreatic cancer","Gastric cancer","Non-hodgkins lymphoma","Ovarian serous carcinoma"]	[]	11	["GWAS catalog (Biliary tract cancer)","GWAS catalog (Cancer)","GWAS catalog (Cervical cancer)","GWAS catalog (Endometrial cancer)","GWAS catalog (Esophageal cancer)","GWAS catalog (Estrogen-receptor negative breast cancer)","GWAS catalog (Pancreatic cancer)","GWAS catalog (Gastric cancer)","GWAS catalog (Hepatocellular carcinoma)","GWAS catalog (Non-hodgkins lymphoma)","GWAS catalog (Ovarian serous carcinoma)"]

PRMT6 (protein arginine methyltransferase 6)

Bookmark This Gene