Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Other IDs Associated diseases
Entrez ID	57818
Gene name	Glucose-6-phosphatase catalytic subunit 2
Gene symbol	G6PC2
Synonyms (NCBI Gene)	IGRP
Chromosome	2
Chromosome location	2q31.1
Summary	This gene encodes an enzyme belonging to the glucose-6-phosphatase catalytic subunit family. These enzymes are part of a multicomponent integral membrane system that catalyzes the hydrolysis of glucose-6-phosphate, the terminal step in gluconeogenic and g

Show/Hide all (90)

miRTarBase ID	miRNA	Experiments	Reference
MIRT440599	hsa-miR-377-5p	HITS-CLIP	24374217
MIRT440598	hsa-miR-409-3p	HITS-CLIP	24374217
MIRT440599	hsa-miR-377-5p	HITS-CLIP	24374217
MIRT440598	hsa-miR-409-3p	HITS-CLIP	24374217
MIRT1008910	hsa-miR-1228	CLIP-seq
MIRT1008911	hsa-miR-1285	CLIP-seq
MIRT1008912	hsa-miR-1321	CLIP-seq
MIRT1008913	hsa-miR-147	CLIP-seq
MIRT1008914	hsa-miR-203	CLIP-seq
MIRT1008915	hsa-miR-224	CLIP-seq
MIRT1008916	hsa-miR-297	CLIP-seq
MIRT1008917	hsa-miR-3150b-3p	CLIP-seq
MIRT1008918	hsa-miR-3151	CLIP-seq
MIRT1008919	hsa-miR-3187-5p	CLIP-seq
MIRT1008920	hsa-miR-3189-3p	CLIP-seq
MIRT1008921	hsa-miR-323-5p	CLIP-seq
MIRT1008922	hsa-miR-3622b-5p	CLIP-seq
MIRT1008923	hsa-miR-362-5p	CLIP-seq
MIRT1008924	hsa-miR-371b-5p	CLIP-seq
MIRT1008925	hsa-miR-3911	CLIP-seq
MIRT1008926	hsa-miR-3929	CLIP-seq
MIRT1008927	hsa-miR-3940-5p	CLIP-seq
MIRT1008928	hsa-miR-4419a	CLIP-seq
MIRT1008929	hsa-miR-4419b	CLIP-seq
MIRT1008930	hsa-miR-4433	CLIP-seq
MIRT1008931	hsa-miR-4447	CLIP-seq
MIRT1008932	hsa-miR-4472	CLIP-seq
MIRT1008933	hsa-miR-4478	CLIP-seq
MIRT1008934	hsa-miR-4507	CLIP-seq
MIRT1008935	hsa-miR-4510	CLIP-seq
MIRT1008936	hsa-miR-4645-5p	CLIP-seq
MIRT1008937	hsa-miR-4662a-5p	CLIP-seq
MIRT1008938	hsa-miR-4668-3p	CLIP-seq
MIRT1008939	hsa-miR-4673	CLIP-seq
MIRT1008940	hsa-miR-4676-5p	CLIP-seq
MIRT1008941	hsa-miR-4689	CLIP-seq
MIRT1008942	hsa-miR-4698	CLIP-seq
MIRT1008943	hsa-miR-4735-5p	CLIP-seq
MIRT1008944	hsa-miR-4739	CLIP-seq
MIRT1008945	hsa-miR-4755-3p	CLIP-seq
MIRT1008946	hsa-miR-4756-5p	CLIP-seq
MIRT1008947	hsa-miR-4779	CLIP-seq
MIRT1008948	hsa-miR-4784	CLIP-seq
MIRT1008949	hsa-miR-491-5p	CLIP-seq
MIRT1008950	hsa-miR-500a	CLIP-seq
MIRT1008951	hsa-miR-500b	CLIP-seq
MIRT1008952	hsa-miR-567	CLIP-seq
MIRT1008953	hsa-miR-575	CLIP-seq
MIRT1008954	hsa-miR-576-5p	CLIP-seq
MIRT1008955	hsa-miR-579	CLIP-seq
MIRT1008956	hsa-miR-592	CLIP-seq
MIRT1008957	hsa-miR-597	CLIP-seq
MIRT1008958	hsa-miR-612	CLIP-seq
MIRT1008959	hsa-miR-644	CLIP-seq
MIRT1008960	hsa-miR-661	CLIP-seq
MIRT1008961	hsa-miR-665	CLIP-seq
MIRT1008962	hsa-miR-876-3p	CLIP-seq
MIRT1998939	hsa-miR-1289	CLIP-seq
MIRT1998940	hsa-miR-3198	CLIP-seq
MIRT1998941	hsa-miR-4294	CLIP-seq
MIRT1998942	hsa-miR-4309	CLIP-seq
MIRT1998943	hsa-miR-502-5p	CLIP-seq
MIRT1998944	hsa-miR-539	CLIP-seq
MIRT1008923	hsa-miR-362-5p	CLIP-seq
MIRT1008924	hsa-miR-371b-5p	CLIP-seq
MIRT1008938	hsa-miR-4668-3p	CLIP-seq
MIRT1008942	hsa-miR-4698	CLIP-seq
MIRT1008950	hsa-miR-500a	CLIP-seq
MIRT1008951	hsa-miR-500b	CLIP-seq
MIRT2449978	hsa-miR-548p	CLIP-seq
MIRT1008923	hsa-miR-362-5p	CLIP-seq
MIRT1008924	hsa-miR-371b-5p	CLIP-seq
MIRT1008938	hsa-miR-4668-3p	CLIP-seq
MIRT1008942	hsa-miR-4698	CLIP-seq
MIRT1008950	hsa-miR-500a	CLIP-seq
MIRT1008951	hsa-miR-500b	CLIP-seq
MIRT2449978	hsa-miR-548p	CLIP-seq
MIRT1008914	hsa-miR-203	CLIP-seq
MIRT1008923	hsa-miR-362-5p	CLIP-seq
MIRT2536240	hsa-miR-425	CLIP-seq
MIRT1008950	hsa-miR-500a	CLIP-seq
MIRT1008951	hsa-miR-500b	CLIP-seq
MIRT1008914	hsa-miR-203	CLIP-seq
MIRT1008923	hsa-miR-362-5p	CLIP-seq
MIRT2536240	hsa-miR-425	CLIP-seq
MIRT2681273	hsa-miR-4263	CLIP-seq
MIRT2681274	hsa-miR-4799-5p	CLIP-seq
MIRT1008950	hsa-miR-500a	CLIP-seq
MIRT1008951	hsa-miR-500b	CLIP-seq
MIRT1008954	hsa-miR-576-5p	CLIP-seq

Show/Hide all (15)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004346	Function	Glucose-6-phosphatase activity	EXP	14722102
GO:0004346	Function	Glucose-6-phosphatase activity	IBA
GO:0004346	Function	Glucose-6-phosphatase activity	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0006094	Process	Gluconeogenesis	IBA
GO:0006094	Process	Gluconeogenesis	IEA
GO:0006094	Process	Gluconeogenesis	TAS
GO:0016020	Component	Membrane	IBA
GO:0016020	Component	Membrane	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0042593	Process	Glucose homeostasis	IMP	20668700
GO:0050796	Process	Regulation of insulin secretion	IMP	20668700
GO:0051156	Process	Glucose 6-phosphate metabolic process	IBA

MIM	HGNC	e!Ensembl
608058	28906	ENSG00000152254

Q9NQR9

Protein name

Glucose-6-phosphatase 2 (G-6-Pase 2) (G6Pase 2) (EC 3.1.3.9) (Islet-specific glucose-6-phosphatase catalytic subunit-related protein)

Protein function

May hydrolyze glucose-6-phosphate to glucose in the endoplasmic reticulum. May be responsible for glucose production through glycogenolysis and gluconeogenesis (By similarity).

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01569	PAP2	53 → 197	PAP2 superfamily	Family

Tissue specificity

TISSUE SPECIFICITY: Specifically expressed in pancreas and also detected to a lower extent in testis. Expressed by most islet cells in the pancreas (at protein level). {ECO:0000269|PubMed:11297555}.

Sequence

MDFLHRNGVLIIQHLQKDYRAYYTFLNFMSNVGDPRNIFFIYFPLCFQFNQTVGTKMIWV
AVIGDWLNLIFKWILFGHRPYWWVQETQIYPNHSSPCLEQFPTTCETGPGSPSGHAMGAS
CVWYVMVTAALSHTVCGMDKFSITLHRLTWSFLWSVFWLIQISVCISRVFIATHFPHQVI
LGVIGGMLVAEAFEHTPGIQTASLGTYLKTNLFLFLFAVGFYLLLRVLNIDLLWSVPIAK
KWCANPDWIHIDTTPFAGLVRNLGVLFGLGFAINSEMFLLSCRGGNNYTLSFRLLCALTS
LTILQLYHFLQIPTHEEHLFYVLSFCKSASIPLTVVAFIPYSVHMLMKQSGKKSQ

Sequence length

355

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (8)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CARBOHYDRATE METABOLISM DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fasting plasma glucose level quantitative trait locus 1	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
G6PC2-related disorder	Likely benign; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTESTINAL DISACCHARIDE DEFICIENCY AND DISACCHARIDE MALABSORPTION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, HIP	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (24)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Breast Carcinoma	Breast Carcinoma	BEFREE	31246991		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	31246991	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	10078554, 15044018, 21346176, 21896930, 22486180, 24918535, 26003759		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	10078554, 15044018, 21346176, 21896930, 22486180, 24918535, 26003759		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	20357361, 27322064	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	28566371, 36961507	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	19533084, 19669124, 20628598, 20668700, 25631608, 29621232, 30055620, 35657990	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	16493034, 16493087, 16520917, 17376821, 21896930, 22438186, 23155466, 24030068, 24918535, 29506985, 30390011		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	14722102, 19082990, 19533084, 20628598, 20668700, 20878272, 23840762, 25625282, 27300767, 28173748, 28704540, 30055620		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes, Autoimmune	Autoimmune Diabetes	BEFREE	21896930		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	33553434	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease	Glycogen Storage Disease	LHGDN	17607665		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	20628598, 20826583		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	19669124		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	Pubtator	19669124	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	20628598	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
insulinoma	Insulinoma	BEFREE	10078553		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	31246991		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	GWASCAT_DG	22399527		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	GWASDB_DG	22399527		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	28919193		★★★★★ ★☆☆☆☆ Found in Text Mining only
Monogenic diabetes	Monogenic Diabetes	BEFREE	24918535		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	26132169	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	20053773	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

G6PC2 (glucose-6-phosphatase catalytic subunit 2)