Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	5532
Gene name	Protein phosphatase 3 catalytic subunit beta
Gene symbol	PPP3CB
Synonyms (NCBI Gene)	CALNA2CALNBCNA2PP2Bbeta
Chromosome	10
Chromosome location	10q22.2

202 Show/Hide all (202)

miRTarBase ID	miRNA	Experiments	Reference
MIRT047460	hsa-miR-10b-5p	CLASH	23622248
MIRT572809	hsa-miR-6769a-3p	PAR-CLIP	20371350
MIRT572810	hsa-miR-181a-2-3p	PAR-CLIP	20371350
MIRT572808	hsa-miR-1273g-3p	PAR-CLIP	20371350
MIRT572807	hsa-miR-875-3p	PAR-CLIP	20371350
MIRT572806	hsa-miR-5699-5p	PAR-CLIP	20371350
MIRT572805	hsa-miR-4758-3p	PAR-CLIP	20371350
MIRT572804	hsa-miR-3189-5p	PAR-CLIP	20371350
MIRT572803	hsa-miR-5093	PAR-CLIP	20371350
MIRT572802	hsa-miR-6509-3p	PAR-CLIP	20371350
MIRT572801	hsa-miR-1178-3p	PAR-CLIP	20371350
MIRT555308	hsa-miR-30c-5p	PAR-CLIP	21572407
MIRT555307	hsa-miR-30b-5p	PAR-CLIP	21572407
MIRT555306	hsa-miR-30a-5p	PAR-CLIP	21572407
MIRT555305	hsa-miR-30d-5p	PAR-CLIP	21572407
MIRT555304	hsa-miR-30e-5p	PAR-CLIP	21572407
MIRT555303	hsa-miR-3920	PAR-CLIP	21572407
MIRT555302	hsa-miR-29a-5p	PAR-CLIP	21572407
MIRT555301	hsa-miR-6818-5p	PAR-CLIP	21572407
MIRT572809	hsa-miR-6769a-3p	PAR-CLIP	20371350
MIRT572810	hsa-miR-181a-2-3p	PAR-CLIP	20371350
MIRT572808	hsa-miR-1273g-3p	PAR-CLIP	20371350
MIRT572807	hsa-miR-875-3p	PAR-CLIP	20371350
MIRT572806	hsa-miR-5699-5p	PAR-CLIP	20371350
MIRT572805	hsa-miR-4758-3p	PAR-CLIP	20371350
MIRT572804	hsa-miR-3189-5p	PAR-CLIP	20371350
MIRT572803	hsa-miR-5093	PAR-CLIP	20371350
MIRT572802	hsa-miR-6509-3p	PAR-CLIP	20371350
MIRT572801	hsa-miR-1178-3p	PAR-CLIP	20371350
MIRT555308	hsa-miR-30c-5p	PAR-CLIP	21572407
MIRT555307	hsa-miR-30b-5p	PAR-CLIP	21572407
MIRT555306	hsa-miR-30a-5p	PAR-CLIP	21572407
MIRT555305	hsa-miR-30d-5p	PAR-CLIP	21572407
MIRT555304	hsa-miR-30e-5p	PAR-CLIP	21572407
MIRT555303	hsa-miR-3920	PAR-CLIP	21572407
MIRT555302	hsa-miR-29a-5p	PAR-CLIP	21572407
MIRT555301	hsa-miR-6818-5p	PAR-CLIP	21572407
MIRT1258228	hsa-miR-3149	CLIP-seq
MIRT1258229	hsa-miR-568	CLIP-seq
MIRT1258230	hsa-miR-629	CLIP-seq
MIRT1258231	hsa-miR-3148	CLIP-seq
MIRT1258232	hsa-miR-361-5p	CLIP-seq
MIRT1258233	hsa-miR-3617	CLIP-seq
MIRT1258234	hsa-miR-3688-3p	CLIP-seq
MIRT1258235	hsa-miR-3919	CLIP-seq
MIRT1258236	hsa-miR-4282	CLIP-seq
MIRT1258237	hsa-miR-4452	CLIP-seq
MIRT1258238	hsa-miR-4659a-3p	CLIP-seq
MIRT1258239	hsa-miR-4659b-3p	CLIP-seq
MIRT1258240	hsa-miR-4756-3p	CLIP-seq
MIRT1258241	hsa-miR-490-5p	CLIP-seq
MIRT1258242	hsa-miR-501-5p	CLIP-seq
MIRT1258243	hsa-miR-548u	CLIP-seq
MIRT1258244	hsa-miR-641	CLIP-seq
MIRT1258245	hsa-miR-30a	CLIP-seq
MIRT1258246	hsa-miR-30b	CLIP-seq
MIRT1258247	hsa-miR-30c	CLIP-seq
MIRT1258248	hsa-miR-30d	CLIP-seq
MIRT1258249	hsa-miR-30e	CLIP-seq
MIRT1258231	hsa-miR-3148	CLIP-seq
MIRT1258250	hsa-miR-3163	CLIP-seq
MIRT1258251	hsa-miR-340	CLIP-seq
MIRT1258233	hsa-miR-3617	CLIP-seq
MIRT1258234	hsa-miR-3688-3p	CLIP-seq
MIRT1258252	hsa-miR-4267	CLIP-seq
MIRT1258253	hsa-miR-4453	CLIP-seq
MIRT1258254	hsa-miR-4538	CLIP-seq
MIRT1258255	hsa-miR-4540	CLIP-seq
MIRT1258241	hsa-miR-490-5p	CLIP-seq
MIRT1258242	hsa-miR-501-5p	CLIP-seq
MIRT1258243	hsa-miR-548u	CLIP-seq
MIRT1258256	hsa-miR-582-5p	CLIP-seq
MIRT1258244	hsa-miR-641	CLIP-seq
MIRT1258257	hsa-miR-766	CLIP-seq
MIRT2076111	hsa-miR-1254	CLIP-seq
MIRT2076112	hsa-miR-3116	CLIP-seq
MIRT1258252	hsa-miR-4267	CLIP-seq
MIRT2076113	hsa-miR-4268	CLIP-seq
MIRT1258253	hsa-miR-4453	CLIP-seq
MIRT1258254	hsa-miR-4538	CLIP-seq
MIRT1258256	hsa-miR-582-5p	CLIP-seq
MIRT2076114	hsa-miR-661	CLIP-seq
MIRT1258257	hsa-miR-766	CLIP-seq
MIRT2302706	hsa-miR-1182	CLIP-seq
MIRT2302707	hsa-miR-1290	CLIP-seq
MIRT2302708	hsa-miR-1297	CLIP-seq
MIRT2302709	hsa-miR-208a	CLIP-seq
MIRT2302710	hsa-miR-208b	CLIP-seq
MIRT2302711	hsa-miR-26a	CLIP-seq
MIRT2302712	hsa-miR-26b	CLIP-seq
MIRT2302713	hsa-miR-3150a-5p	CLIP-seq
MIRT2302714	hsa-miR-3150b-5p	CLIP-seq
MIRT1258250	hsa-miR-3163	CLIP-seq
MIRT2302715	hsa-miR-3167	CLIP-seq
MIRT2302716	hsa-miR-3179	CLIP-seq
MIRT2302717	hsa-miR-3202	CLIP-seq
MIRT2302718	hsa-miR-3658	CLIP-seq
MIRT2302719	hsa-miR-3667-5p	CLIP-seq
MIRT1258252	hsa-miR-4267	CLIP-seq
MIRT2076113	hsa-miR-4268	CLIP-seq
MIRT2302720	hsa-miR-4330	CLIP-seq
MIRT1258253	hsa-miR-4453	CLIP-seq
MIRT2302721	hsa-miR-4465	CLIP-seq
MIRT2302722	hsa-miR-4476	CLIP-seq
MIRT2302723	hsa-miR-4489	CLIP-seq
MIRT1258254	hsa-miR-4538	CLIP-seq
MIRT2302724	hsa-miR-4760-3p	CLIP-seq
MIRT2302725	hsa-miR-499-5p	CLIP-seq
MIRT1258256	hsa-miR-582-5p	CLIP-seq
MIRT2302726	hsa-miR-591	CLIP-seq
MIRT2302727	hsa-miR-599	CLIP-seq
MIRT2302728	hsa-miR-628-3p	CLIP-seq
MIRT2302729	hsa-miR-665	CLIP-seq
MIRT1258257	hsa-miR-766	CLIP-seq
MIRT2302730	hsa-miR-802	CLIP-seq
MIRT2302731	hsa-miR-876-5p	CLIP-seq
MIRT2076111	hsa-miR-1254	CLIP-seq
MIRT2599392	hsa-miR-126	CLIP-seq
MIRT2599393	hsa-miR-1284	CLIP-seq
MIRT2599394	hsa-miR-219-1-3p	CLIP-seq
MIRT2076112	hsa-miR-3116	CLIP-seq
MIRT2599395	hsa-miR-3126-5p	CLIP-seq
MIRT2599396	hsa-miR-3128	CLIP-seq
MIRT2599397	hsa-miR-33a	CLIP-seq
MIRT2599398	hsa-miR-33b	CLIP-seq
MIRT2599399	hsa-miR-3921	CLIP-seq
MIRT2599400	hsa-miR-3929	CLIP-seq
MIRT2599401	hsa-miR-3977	CLIP-seq
MIRT2599402	hsa-miR-4253	CLIP-seq
MIRT2599403	hsa-miR-4254	CLIP-seq
MIRT1258236	hsa-miR-4282	CLIP-seq
MIRT2599404	hsa-miR-4325	CLIP-seq
MIRT2599405	hsa-miR-4419a	CLIP-seq
MIRT2599406	hsa-miR-4419b	CLIP-seq
MIRT2599407	hsa-miR-4427	CLIP-seq
MIRT2599408	hsa-miR-4470	CLIP-seq
MIRT2599409	hsa-miR-4478	CLIP-seq
MIRT2599410	hsa-miR-4510	CLIP-seq
MIRT2599411	hsa-miR-4633-3p	CLIP-seq
MIRT2599412	hsa-miR-4653-5p	CLIP-seq
MIRT2599413	hsa-miR-4666-5p	CLIP-seq
MIRT2599414	hsa-miR-4680-3p	CLIP-seq
MIRT2599415	hsa-miR-4682	CLIP-seq
MIRT2599416	hsa-miR-4685-5p	CLIP-seq
MIRT2599417	hsa-miR-4690-5p	CLIP-seq
MIRT2599418	hsa-miR-4720-3p	CLIP-seq
MIRT2599419	hsa-miR-4720-5p	CLIP-seq
MIRT2599420	hsa-miR-4761-3p	CLIP-seq
MIRT2599421	hsa-miR-4768-3p	CLIP-seq
MIRT2599422	hsa-miR-4786-5p	CLIP-seq
MIRT2599423	hsa-miR-4796-5p	CLIP-seq
MIRT2599424	hsa-miR-4799-3p	CLIP-seq
MIRT2599425	hsa-miR-4804-3p	CLIP-seq
MIRT2599426	hsa-miR-486-5p	CLIP-seq
MIRT2599427	hsa-miR-499-3p	CLIP-seq
MIRT2599428	hsa-miR-499a-3p	CLIP-seq
MIRT2599429	hsa-miR-513a-3p	CLIP-seq
MIRT2599430	hsa-miR-548a-5p	CLIP-seq
MIRT2599431	hsa-miR-548ab	CLIP-seq
MIRT2599432	hsa-miR-548ak	CLIP-seq
MIRT2599433	hsa-miR-548b-5p	CLIP-seq
MIRT2599434	hsa-miR-548c-5p	CLIP-seq
MIRT2599435	hsa-miR-548d-5p	CLIP-seq
MIRT2599436	hsa-miR-548h	CLIP-seq
MIRT2599437	hsa-miR-548i	CLIP-seq
MIRT2599438	hsa-miR-548j	CLIP-seq
MIRT2599439	hsa-miR-548w	CLIP-seq
MIRT2599440	hsa-miR-548y	CLIP-seq
MIRT2599441	hsa-miR-559	CLIP-seq
MIRT2599442	hsa-miR-571	CLIP-seq
MIRT2599443	hsa-miR-572	CLIP-seq
MIRT2599444	hsa-miR-630	CLIP-seq
MIRT2599445	hsa-miR-645	CLIP-seq
MIRT2076114	hsa-miR-661	CLIP-seq
MIRT2076111	hsa-miR-1254	CLIP-seq
MIRT2688486	hsa-miR-1972	CLIP-seq
MIRT2599394	hsa-miR-219-1-3p	CLIP-seq
MIRT2076112	hsa-miR-3116	CLIP-seq
MIRT2599395	hsa-miR-3126-5p	CLIP-seq
MIRT2599396	hsa-miR-3128	CLIP-seq
MIRT2599399	hsa-miR-3921	CLIP-seq
MIRT2599402	hsa-miR-4253	CLIP-seq
MIRT2599403	hsa-miR-4254	CLIP-seq
MIRT2599404	hsa-miR-4325	CLIP-seq
MIRT2599405	hsa-miR-4419a	CLIP-seq
MIRT2599408	hsa-miR-4470	CLIP-seq
MIRT2599410	hsa-miR-4510	CLIP-seq
MIRT2599411	hsa-miR-4633-3p	CLIP-seq
MIRT2599412	hsa-miR-4653-5p	CLIP-seq
MIRT2599415	hsa-miR-4682	CLIP-seq
MIRT2599416	hsa-miR-4685-5p	CLIP-seq
MIRT2599417	hsa-miR-4690-5p	CLIP-seq
MIRT2688487	hsa-miR-4717-5p	CLIP-seq
MIRT2599419	hsa-miR-4720-5p	CLIP-seq
MIRT2599420	hsa-miR-4761-3p	CLIP-seq
MIRT2599421	hsa-miR-4768-3p	CLIP-seq
MIRT2599422	hsa-miR-4786-5p	CLIP-seq
MIRT2599424	hsa-miR-4799-3p	CLIP-seq
MIRT2599442	hsa-miR-571	CLIP-seq
MIRT2599443	hsa-miR-572	CLIP-seq
MIRT2599444	hsa-miR-630	CLIP-seq
MIRT2076114	hsa-miR-661	CLIP-seq

83 Show/Hide all (83)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001913	Process	T cell mediated cytotoxicity	IEA
GO:0001915	Process	Negative regulation of T cell mediated cytotoxicity	IEA
GO:0001946	Process	Lymphangiogenesis	IEA
GO:0004721	Function	Phosphoprotein phosphatase activity	IEA
GO:0004722	Function	Protein serine/threonine phosphatase activity	IEA
GO:0004722	Function	Protein serine/threonine phosphatase activity	NAS	8392375
GO:0005509	Function	Calcium ion binding	IDA	8524402
GO:0005515	Function	Protein binding	IPI	21903422, 22688515, 26496921, 26794871, 33961781, 34446558, 35914814
GO:0005516	Function	Calmodulin binding	IBA
GO:0005516	Function	Calmodulin binding	IDA	2556704, 11005320, 26794871
GO:0005516	Function	Calmodulin binding	IEA
GO:0005516	Function	Calmodulin binding	NAS	8524402
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	19154138
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	NAS	22343722, 28126489
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0005955	Component	Calcineurin complex	IBA
GO:0005955	Component	Calcineurin complex	IDA	8524402, 22688515, 26794871
GO:0005955	Component	Calcineurin complex	NAS	11123943
GO:0006468	Process	Protein phosphorylation	ISS
GO:0006470	Process	Protein dephosphorylation	IDA	19154138, 26794871
GO:0006470	Process	Protein dephosphorylation	ISS
GO:0006950	Process	Response to stress	IEA
GO:0007040	Process	Lysosome organization	IDA	32753672, 35662396
GO:0007165	Process	Signal transduction	NAS	8978785
GO:0007507	Process	Heart development	IEA
GO:0007612	Process	Learning	TAS	21531385
GO:0007613	Process	Memory	TAS	21531385
GO:0008287	Component	Protein serine/threonine phosphatase complex	NAS	22343722
GO:0010468	Process	Regulation of gene expression	IEA
GO:0016311	Process	Dephosphorylation	TAS	2556704
GO:0016787	Function	Hydrolase activity	IEA
GO:0017156	Process	Calcium-ion regulated exocytosis	IEA
GO:0017156	Process	Calcium-ion regulated exocytosis	ISS
GO:0019899	Function	Enzyme binding	IDA	11005320
GO:0023057	Process	Negative regulation of signaling	IEA
GO:0023057	Process	Negative regulation of signaling	ISS
GO:0030018	Component	Z disc	IEA
GO:0030217	Process	T cell differentiation	IEA
GO:0030315	Component	T-tubule	IEA
GO:0030346	Function	Protein phosphatase 2B binding	IDA	2556704
GO:0031987	Process	Locomotion involved in locomotory behavior	IEA
GO:0033173	Process	Calcineurin-NFAT signaling cascade	IDA	19154138, 22688515
GO:0033173	Process	Calcineurin-NFAT signaling cascade	IEA
GO:0033192	Function	Calmodulin-dependent protein phosphatase activity	IBA
GO:0033192	Function	Calmodulin-dependent protein phosphatase activity	IDA	19154138, 25720963, 26794871, 32753672
GO:0033192	Function	Calmodulin-dependent protein phosphatase activity	IEA
GO:0033192	Function	Calmodulin-dependent protein phosphatase activity	ISS
GO:0033192	Function	Calmodulin-dependent protein phosphatase activity	TAS	2556704
GO:0034097	Process	Response to cytokine	IEA
GO:0035774	Process	Positive regulation of insulin secretion involved in cellular response to glucose stimulus	IEA
GO:0035774	Process	Positive regulation of insulin secretion involved in cellular response to glucose stimulus	ISS
GO:0042098	Process	T cell proliferation	NAS	8978785
GO:0042110	Process	T cell activation	TAS	11005320
GO:0043029	Process	T cell homeostasis	IEA
GO:0045824	Process	Negative regulation of innate immune response	IDA	35662396
GO:0045893	Process	Positive regulation of DNA-templated transcription	NAS	8978785
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	22688515
GO:0046872	Function	Metal ion binding	IEA
GO:0046983	Function	Protein dimerization activity	IPI	11005320
GO:0048167	Process	Regulation of synaptic plasticity	TAS	21531385
GO:0048675	Process	Axon extension	TAS	21531385
GO:0048741	Process	Skeletal muscle fiber development	IEA
GO:0048741	Process	Skeletal muscle fiber development	ISS
GO:0050796	Process	Regulation of insulin secretion	ISS
GO:0070886	Process	Positive regulation of calcineurin-NFAT signaling cascade	NAS	8631904, 22343722
GO:0097720	Process	Calcineurin-mediated signaling	IBA
GO:0097720	Process	Calcineurin-mediated signaling	IEA
GO:0097720	Process	Calcineurin-mediated signaling	IMP	11005320
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0140367	Process	Antibacterial innate immune response	IDA	32753672, 35662396
GO:1900181	Process	Negative regulation of protein localization to nucleus	IDA	35662396
GO:1900182	Process	Positive regulation of protein localization to nucleus	IDA	25720963, 32753672
GO:1900182	Process	Positive regulation of protein localization to nucleus	IDA	25720963, 32753672
GO:1900242	Process	Regulation of synaptic vesicle endocytosis	IEA
GO:1905665	Process	Positive regulation of calcium ion import across plasma membrane	NAS	17640527
GO:1905673	Process	Positive regulation of lysosome organization	IDA	25720963, 32753672
GO:1905673	Process	Positive regulation of lysosome organization	IDA	25720963, 32753672
GO:1905949	Process	Negative regulation of calcium ion import across plasma membrane	NAS	17640527

MIM	HGNC	e!Ensembl
114106	9315	ENSG00000107758

P16298

Protein name

Serine/threonine-protein phosphatase 2B catalytic subunit beta isoform (EC 3.1.3.16) (CAM-PRP catalytic subunit) (Calmodulin-dependent calcineurin A subunit beta isoform) (CNA beta)

Protein function

Calcium-dependent, calmodulin-stimulated protein phosphatase which plays an essential role in the transduction of intracellular Ca(2+)-mediated signals (PubMed:19154138, PubMed:25720963, PubMed:26794871, PubMed:32753672). Dephosphorylates TFEB i

PDB

4OR9 , 4ORA , 4ORC

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00149	Metallophos	92 → 294	Calcineurin-like phosphoesterase	Domain

Sequence

MAAPEPARAAPPPPPPPPPPPGADRVVKAVPFPPTHRLTSEEVFDLDGIPRVDVLKNHLV
KEGRVDEEIALRIINEGAAILRREKTMIEVEAPITVCGDIHGQFFDLMKLFEVGGSPANT
RYLFLGDYVDRGYFSIECVLYLWVLKILYPSTLFLLRGNHECRHLTEYFTFKQECKIKYS
ERVYEACMEAFDSLPLAALLNQQFLCVHGGLSPEIHTLDDIRRLDRFKEPPAFGPMCDLL
WSDPSEDFGNEKSQEHFSHNTVRGCSYFYNYPAVCEFLQNNNLLSIIRAHEAQDAGYRMY
RKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCSPHPYWLPNFMDVFT
WSLPFVGEKVTEMLVNVLSICSDDELMTEGEDQFDGSAAARKEIIRNKIRAIGKMARVFS
VLREESESVLTLKGLTPTGMLPSGVLAGGRQTLQSATVEAIEAEKAIRGFSPPHRICSFE
EAKGLDRINERMPPRKDAVQQDGFNSLNTAHATENHGTGNHTAQ

Sequence length

524

Interactions

View interactions

KEGG Pathway	Reactome Pathway
MAPK signaling pathway	Calcineurin activates NFAT
Calcium signaling pathway	FCERI mediated Ca+2 mobilization
cGMP-PKG signaling pathway	Ca2+ pathway
Oocyte meiosis	CLEC7A (Dectin-1) induces NFAT activation
Cellular senescence
Wnt signaling pathway
Axon guidance
VEGF signaling pathway
Osteoclast differentiation
C-type lectin receptor signaling pathway
Natural killer cell mediated cytotoxicity
Th1 and Th2 cell differentiation
Th17 cell differentiation
T cell receptor signaling pathway
B cell receptor signaling pathway
Long-term potentiation
Glutamatergic synapse
Dopaminergic synapse
Oxytocin signaling pathway
Glucagon signaling pathway
Renin secretion
Alzheimer disease
Amyotrophic lateral sclerosis
Prion disease
Pathways of neurodegeneration - multiple diseases
Amphetamine addiction
Tuberculosis
Human cytomegalovirus infection
Human T-cell leukemia virus 1 infection
Kaposi sarcoma-associated herpesvirus infection
Human immunodeficiency virus 1 infection
PD-L1 expression and PD-1 checkpoint pathway in cancer
Lipid and atherosclerosis

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CONGENITAL STENOSIS OF AORTIC VALVE	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATOLENTICULAR DEGENERATION	—	CTD, Disgenet CTD, Disgenet	23519153	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (13)
Aortic Valve Stenosis	Aortic Valve Sclerosis	BEFREE	15533858		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	26899345		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cornea plana	Cornea Plana	BEFREE	7601455, 8723718, 8825624, 8929947		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cornea Plana 1	Cornea plana	Pubtator	8723718, 8929947	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatic Form of Wilson Disease	Hepatolenticular degeneration	CTD_human_DG	23519153		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatolenticular Degeneration	Hepatolenticular Degeneration	CTD_human_DG	23519153		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperglycemia	Hyperglycemia	Pubtator	23985558	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	30457174, 30641937		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	30457174		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	22078386	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	33270085	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	BEFREE	25980752		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	26899345, 29214423		★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
PPP3CA	1	["Hepatolenticular degeneration"]	34	["MAPK signaling pathway","Calcium signaling pathway","cGMP-PKG signaling pathway","Oocyte meiosis","Cellular senescence","Wnt signaling pathway","Axon guidance","VEGF signaling pathway","Osteoclast differentiation","C-type lectin receptor signaling pathway","Natural killer cell mediated cytotoxicity","Th1 and Th2 cell differentiation"]	2	["CTD (Hepatolenticular degeneration)","Disgenet (Hepatolenticular degeneration)"]
ASMT	1	["Hepatolenticular degeneration"]	0	[]	2	["CTD (Hepatolenticular degeneration)","Disgenet (Hepatolenticular degeneration)"]
PPP3R1	0	[]	33	["MAPK signaling pathway","Calcium signaling pathway","cGMP-PKG signaling pathway","Oocyte meiosis","Cellular senescence","Wnt signaling pathway","Axon guidance","VEGF signaling pathway","Osteoclast differentiation","C-type lectin receptor signaling pathway","Natural killer cell mediated cytotoxicity","Th1 and Th2 cell differentiation"]	0	[]
PPP3CC	0	[]	30	["MAPK signaling pathway","Calcium signaling pathway","cGMP-PKG signaling pathway","Oocyte meiosis","Cellular senescence","Wnt signaling pathway","Axon guidance","VEGF signaling pathway","Osteoclast differentiation","C-type lectin receptor signaling pathway","Natural killer cell mediated cytotoxicity","Th1 and Th2 cell differentiation"]	0	[]
PPP3R2	0	[]	29	["MAPK signaling pathway","Calcium signaling pathway","cGMP-PKG signaling pathway","Oocyte meiosis","Cellular senescence","Wnt signaling pathway","Axon guidance","VEGF signaling pathway","Osteoclast differentiation","C-type lectin receptor signaling pathway","Natural killer cell mediated cytotoxicity","Th1 and Th2 cell differentiation"]	0	[]

PPP3CB (protein phosphatase 3 catalytic subunit beta)

Bookmark This Gene