PPP3R1 (protein phosphatase 3 regulatory subunit B, alpha)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 5534
• Gene name: Protein phosphatase 3 regulatory subunit B, alpha
• Gene symbol: PPP3R1
• Synonyms (NCBI Gene): CALNB1, CNB, CNB1
• Chromosome: 2
• Chromosome location: 2p14

miRNA Show/Hide all (763)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005180	hsa-miR-30a-5p	pSILAC	18668040
MIRT025005	hsa-miR-183-5p	Sequencing	20371350
MIRT025426	hsa-miR-34a-5p	Sequencing	20371350
MIRT005180	hsa-miR-30a-5p	Proteomics;Other	18668040
MIRT029303	hsa-miR-26b-5p	Sequencing	20371350
MIRT030457	hsa-miR-24-3p	Sequencing	20371350
MIRT037914	hsa-miR-532-3p	CLASH	23622248
MIRT654821	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT654820	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT654819	hsa-miR-3127-3p	HITS-CLIP	23824327
MIRT654818	hsa-miR-6756-3p	HITS-CLIP	23824327
MIRT654817	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT159806	hsa-miR-5189-3p	HITS-CLIP	23824327
MIRT654816	hsa-miR-623	HITS-CLIP	23824327
MIRT654815	hsa-miR-515-5p	HITS-CLIP	23824327
MIRT654814	hsa-miR-519e-5p	HITS-CLIP	23824327
MIRT654813	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT654812	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT654811	hsa-miR-629-3p	HITS-CLIP	23824327
MIRT521725	hsa-miR-548ac	PAR-CLIP	20371350
MIRT521724	hsa-miR-548bb-3p	PAR-CLIP	20371350
MIRT521723	hsa-miR-548d-3p	PAR-CLIP	20371350
MIRT521722	hsa-miR-548h-3p	PAR-CLIP	20371350
MIRT521721	hsa-miR-548z	PAR-CLIP	20371350
MIRT521720	hsa-miR-548as-3p	PAR-CLIP	20371350
MIRT571779	hsa-miR-5692a	PAR-CLIP	20371350
MIRT521719	hsa-miR-651-3p	PAR-CLIP	20371350
MIRT303233	hsa-miR-409-3p	PAR-CLIP	20371350
MIRT303230	hsa-miR-33a-3p	PAR-CLIP	20371350
MIRT510954	hsa-miR-4704-5p	PAR-CLIP	20371350
MIRT510953	hsa-miR-4707-5p	PAR-CLIP	20371350
MIRT510952	hsa-miR-5587-3p	PAR-CLIP	20371350
MIRT510951	hsa-miR-6758-3p	PAR-CLIP	20371350
MIRT510950	hsa-miR-6763-3p	PAR-CLIP	20371350
MIRT521725	hsa-miR-548ac	PAR-CLIP	20371350
MIRT521724	hsa-miR-548bb-3p	PAR-CLIP	20371350
MIRT521723	hsa-miR-548d-3p	PAR-CLIP	20371350
MIRT521722	hsa-miR-548h-3p	PAR-CLIP	20371350
MIRT521721	hsa-miR-548z	PAR-CLIP	20371350
MIRT521720	hsa-miR-548as-3p	PAR-CLIP	20371350
MIRT571779	hsa-miR-5692a	PAR-CLIP	20371350
MIRT521719	hsa-miR-651-3p	PAR-CLIP	20371350
MIRT303233	hsa-miR-409-3p	PAR-CLIP	20371350
MIRT303230	hsa-miR-33a-3p	PAR-CLIP	20371350
MIRT510954	hsa-miR-4704-5p	PAR-CLIP	20371350
MIRT510953	hsa-miR-4707-5p	PAR-CLIP	20371350
MIRT510952	hsa-miR-5587-3p	PAR-CLIP	20371350
MIRT510951	hsa-miR-6758-3p	PAR-CLIP	20371350
MIRT510950	hsa-miR-6763-3p	PAR-CLIP	20371350
MIRT566296	hsa-miR-3163	PAR-CLIP	20371350
MIRT566295	hsa-miR-3185	PAR-CLIP	20371350
MIRT566294	hsa-miR-340-5p	PAR-CLIP	20371350
MIRT566293	hsa-miR-578	PAR-CLIP	20371350
MIRT303233	hsa-miR-409-3p	PAR-CLIP	20371350
MIRT303230	hsa-miR-33a-3p	PAR-CLIP	20371350
MIRT510954	hsa-miR-4704-5p	PAR-CLIP	20371350
MIRT510953	hsa-miR-4707-5p	PAR-CLIP	20371350
MIRT510952	hsa-miR-5587-3p	PAR-CLIP	20371350
MIRT510951	hsa-miR-6758-3p	PAR-CLIP	20371350
MIRT510950	hsa-miR-6763-3p	PAR-CLIP	20371350
MIRT521719	hsa-miR-651-3p	PAR-CLIP	20371350
MIRT303233	hsa-miR-409-3p	PAR-CLIP	20371350
MIRT303230	hsa-miR-33a-3p	PAR-CLIP	20371350
MIRT510954	hsa-miR-4704-5p	PAR-CLIP	20371350
MIRT510953	hsa-miR-4707-5p	PAR-CLIP	20371350
MIRT510952	hsa-miR-5587-3p	PAR-CLIP	20371350
MIRT510951	hsa-miR-6758-3p	PAR-CLIP	20371350
MIRT510950	hsa-miR-6763-3p	PAR-CLIP	20371350
MIRT521725	hsa-miR-548ac	PAR-CLIP	23446348
MIRT521724	hsa-miR-548bb-3p	PAR-CLIP	23446348
MIRT521723	hsa-miR-548d-3p	PAR-CLIP	23446348
MIRT521722	hsa-miR-548h-3p	PAR-CLIP	23446348
MIRT521721	hsa-miR-548z	PAR-CLIP	23446348
MIRT521720	hsa-miR-548as-3p	PAR-CLIP	23446348
MIRT521719	hsa-miR-651-3p	PAR-CLIP	23446348
MIRT303233	hsa-miR-409-3p	PAR-CLIP	23446348
MIRT303230	hsa-miR-33a-3p	PAR-CLIP	23446348
MIRT510954	hsa-miR-4704-5p	PAR-CLIP	23446348
MIRT510953	hsa-miR-4707-5p	PAR-CLIP	23446348
MIRT510952	hsa-miR-5587-3p	PAR-CLIP	23446348
MIRT510951	hsa-miR-6758-3p	PAR-CLIP	23446348
MIRT510950	hsa-miR-6763-3p	PAR-CLIP	23446348
MIRT303233	hsa-miR-409-3p	PAR-CLIP	23446348
MIRT303230	hsa-miR-33a-3p	PAR-CLIP	23446348
MIRT510954	hsa-miR-4704-5p	PAR-CLIP	23446348
MIRT510953	hsa-miR-4707-5p	PAR-CLIP	23446348
MIRT510952	hsa-miR-5587-3p	PAR-CLIP	23446348
MIRT510951	hsa-miR-6758-3p	PAR-CLIP	23446348
MIRT510950	hsa-miR-6763-3p	PAR-CLIP	23446348
MIRT442617	hsa-miR-656-3p	PAR-CLIP	22100165
MIRT442616	hsa-miR-4714-3p	PAR-CLIP	22100165
MIRT159806	hsa-miR-5189-3p	PAR-CLIP	22100165
MIRT442615	hsa-miR-9-3p	PAR-CLIP	22100165
MIRT439911	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT439910	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT439908	hsa-miR-376a-3p	HITS-CLIP	24374217
MIRT439909	hsa-miR-369-3p	HITS-CLIP	24374217
MIRT439911	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT726877	hsa-miR-17-5p	HITS-CLIP	22473208
MIRT726878	hsa-miR-20b-5p	HITS-CLIP	22473208
MIRT726876	hsa-miR-93-5p	HITS-CLIP	22473208
MIRT726875	hsa-miR-519d-3p	HITS-CLIP	22473208
MIRT439910	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT439908	hsa-miR-376a-3p	HITS-CLIP	24374217
MIRT439909	hsa-miR-369-3p	HITS-CLIP	24374217
MIRT733511	hsa-miR-6859-5p	qRT-PCR	34150008
MIRT654821	hsa-miR-204-5p	HITS-CLIP	23824327
MIRT654820	hsa-miR-211-5p	HITS-CLIP	23824327
MIRT654819	hsa-miR-3127-3p	HITS-CLIP	23824327
MIRT654818	hsa-miR-6756-3p	HITS-CLIP	23824327
MIRT654817	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT159806	hsa-miR-5189-3p	HITS-CLIP	23824327
MIRT654816	hsa-miR-623	HITS-CLIP	23824327
MIRT654815	hsa-miR-515-5p	HITS-CLIP	23824327
MIRT654814	hsa-miR-519e-5p	HITS-CLIP	23824327
MIRT654813	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT654812	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT654811	hsa-miR-629-3p	HITS-CLIP	23824327
MIRT521725	hsa-miR-548ac	PAR-CLIP	20371350
MIRT521724	hsa-miR-548bb-3p	PAR-CLIP	20371350
MIRT521723	hsa-miR-548d-3p	PAR-CLIP	20371350
MIRT521722	hsa-miR-548h-3p	PAR-CLIP	20371350
MIRT521721	hsa-miR-548z	PAR-CLIP	20371350
MIRT521720	hsa-miR-548as-3p	PAR-CLIP	20371350
MIRT571779	hsa-miR-5692a	PAR-CLIP	20371350
MIRT521719	hsa-miR-651-3p	PAR-CLIP	20371350
MIRT303233	hsa-miR-409-3p	PAR-CLIP	20371350
MIRT303230	hsa-miR-33a-3p	PAR-CLIP	20371350
MIRT510954	hsa-miR-4704-5p	PAR-CLIP	20371350
MIRT510953	hsa-miR-4707-5p	PAR-CLIP	20371350
MIRT510952	hsa-miR-5587-3p	PAR-CLIP	20371350
MIRT510951	hsa-miR-6758-3p	PAR-CLIP	20371350
MIRT510950	hsa-miR-6763-3p	PAR-CLIP	20371350
MIRT521725	hsa-miR-548ac	PAR-CLIP	20371350
MIRT521724	hsa-miR-548bb-3p	PAR-CLIP	20371350
MIRT521723	hsa-miR-548d-3p	PAR-CLIP	20371350
MIRT521722	hsa-miR-548h-3p	PAR-CLIP	20371350
MIRT521721	hsa-miR-548z	PAR-CLIP	20371350
MIRT521720	hsa-miR-548as-3p	PAR-CLIP	20371350
MIRT571779	hsa-miR-5692a	PAR-CLIP	20371350
MIRT521719	hsa-miR-651-3p	PAR-CLIP	20371350
MIRT303233	hsa-miR-409-3p	PAR-CLIP	20371350
MIRT303230	hsa-miR-33a-3p	PAR-CLIP	20371350
MIRT510954	hsa-miR-4704-5p	PAR-CLIP	20371350
MIRT510953	hsa-miR-4707-5p	PAR-CLIP	20371350
MIRT510952	hsa-miR-5587-3p	PAR-CLIP	20371350
MIRT510951	hsa-miR-6758-3p	PAR-CLIP	20371350
MIRT510950	hsa-miR-6763-3p	PAR-CLIP	20371350
MIRT566296	hsa-miR-3163	PAR-CLIP	20371350
MIRT566295	hsa-miR-3185	PAR-CLIP	20371350
MIRT566294	hsa-miR-340-5p	PAR-CLIP	20371350
MIRT566293	hsa-miR-578	PAR-CLIP	20371350
MIRT303233	hsa-miR-409-3p	PAR-CLIP	20371350
MIRT303230	hsa-miR-33a-3p	PAR-CLIP	20371350
MIRT510954	hsa-miR-4704-5p	PAR-CLIP	20371350
MIRT510953	hsa-miR-4707-5p	PAR-CLIP	20371350
MIRT510952	hsa-miR-5587-3p	PAR-CLIP	20371350
MIRT510951	hsa-miR-6758-3p	PAR-CLIP	20371350
MIRT510950	hsa-miR-6763-3p	PAR-CLIP	20371350
MIRT521719	hsa-miR-651-3p	PAR-CLIP	20371350
MIRT303233	hsa-miR-409-3p	PAR-CLIP	20371350
MIRT303230	hsa-miR-33a-3p	PAR-CLIP	20371350
MIRT510954	hsa-miR-4704-5p	PAR-CLIP	20371350
MIRT510953	hsa-miR-4707-5p	PAR-CLIP	20371350
MIRT510952	hsa-miR-5587-3p	PAR-CLIP	20371350
MIRT510951	hsa-miR-6758-3p	PAR-CLIP	20371350
MIRT510950	hsa-miR-6763-3p	PAR-CLIP	20371350
MIRT521725	hsa-miR-548ac	PAR-CLIP	23446348
MIRT521724	hsa-miR-548bb-3p	PAR-CLIP	23446348
MIRT521723	hsa-miR-548d-3p	PAR-CLIP	23446348
MIRT521722	hsa-miR-548h-3p	PAR-CLIP	23446348
MIRT521721	hsa-miR-548z	PAR-CLIP	23446348
MIRT521720	hsa-miR-548as-3p	PAR-CLIP	23446348
MIRT521719	hsa-miR-651-3p	PAR-CLIP	23446348
MIRT303233	hsa-miR-409-3p	PAR-CLIP	23446348
MIRT303230	hsa-miR-33a-3p	PAR-CLIP	23446348
MIRT510954	hsa-miR-4704-5p	PAR-CLIP	23446348
MIRT510953	hsa-miR-4707-5p	PAR-CLIP	23446348
MIRT510952	hsa-miR-5587-3p	PAR-CLIP	23446348
MIRT510951	hsa-miR-6758-3p	PAR-CLIP	23446348
MIRT510950	hsa-miR-6763-3p	PAR-CLIP	23446348
MIRT303233	hsa-miR-409-3p	PAR-CLIP	23446348
MIRT303230	hsa-miR-33a-3p	PAR-CLIP	23446348
MIRT510954	hsa-miR-4704-5p	PAR-CLIP	23446348
MIRT510953	hsa-miR-4707-5p	PAR-CLIP	23446348
MIRT510952	hsa-miR-5587-3p	PAR-CLIP	23446348
MIRT510951	hsa-miR-6758-3p	PAR-CLIP	23446348
MIRT510950	hsa-miR-6763-3p	PAR-CLIP	23446348
MIRT442617	hsa-miR-656-3p	PAR-CLIP	22100165
MIRT442616	hsa-miR-4714-3p	PAR-CLIP	22100165
MIRT159806	hsa-miR-5189-3p	PAR-CLIP	22100165
MIRT442615	hsa-miR-9-3p	PAR-CLIP	22100165
MIRT1258267	hsa-miR-101	CLIP-seq
MIRT1258268	hsa-miR-106a	CLIP-seq
MIRT1258269	hsa-miR-106b	CLIP-seq
MIRT1258270	hsa-miR-1197	CLIP-seq
MIRT1258271	hsa-miR-1207-5p	CLIP-seq
MIRT1258272	hsa-miR-1226	CLIP-seq
MIRT1258273	hsa-miR-1252	CLIP-seq
MIRT1258274	hsa-miR-1253	CLIP-seq
MIRT1258275	hsa-miR-1264	CLIP-seq
MIRT1258276	hsa-miR-1271	CLIP-seq
MIRT1258277	hsa-miR-1287	CLIP-seq
MIRT1258278	hsa-miR-1290	CLIP-seq
MIRT1258279	hsa-miR-1297	CLIP-seq
MIRT1258280	hsa-miR-132	CLIP-seq
MIRT1258281	hsa-miR-1323	CLIP-seq
MIRT1258282	hsa-miR-1324	CLIP-seq
MIRT1258283	hsa-miR-141	CLIP-seq
MIRT1258284	hsa-miR-144	CLIP-seq
MIRT1258285	hsa-miR-17	CLIP-seq
MIRT1258286	hsa-miR-182	CLIP-seq
MIRT1258287	hsa-miR-188-3p	CLIP-seq
MIRT1258288	hsa-miR-194	CLIP-seq
MIRT1258289	hsa-miR-200a	CLIP-seq
MIRT1258290	hsa-miR-204	CLIP-seq
MIRT1258291	hsa-miR-205	CLIP-seq
MIRT1258292	hsa-miR-2052	CLIP-seq
MIRT1258293	hsa-miR-20a	CLIP-seq
MIRT1258294	hsa-miR-20b	CLIP-seq
MIRT1258295	hsa-miR-211	CLIP-seq
MIRT1258296	hsa-miR-2114	CLIP-seq
MIRT1258297	hsa-miR-212	CLIP-seq
MIRT1258298	hsa-miR-22	CLIP-seq
MIRT1258299	hsa-miR-221	CLIP-seq
MIRT1258300	hsa-miR-222	CLIP-seq
MIRT1258301	hsa-miR-2276	CLIP-seq
MIRT1258302	hsa-miR-2467-5p	CLIP-seq
MIRT1258303	hsa-miR-2681	CLIP-seq
MIRT1258304	hsa-miR-26a	CLIP-seq
MIRT1258305	hsa-miR-26b	CLIP-seq
MIRT1258306	hsa-miR-27a	CLIP-seq
MIRT1258307	hsa-miR-27b	CLIP-seq
MIRT1258308	hsa-miR-298	CLIP-seq
MIRT1258309	hsa-miR-302a	CLIP-seq
MIRT1258310	hsa-miR-302b	CLIP-seq
MIRT1258311	hsa-miR-302c	CLIP-seq
MIRT1258312	hsa-miR-302d	CLIP-seq
MIRT1258313	hsa-miR-302e	CLIP-seq
MIRT1258314	hsa-miR-3064-5p	CLIP-seq
MIRT1258315	hsa-miR-30a	CLIP-seq
MIRT1258316	hsa-miR-30b	CLIP-seq
MIRT1258317	hsa-miR-30c	CLIP-seq
MIRT1258318	hsa-miR-30d	CLIP-seq
MIRT1258319	hsa-miR-30e	CLIP-seq
MIRT1258320	hsa-miR-3121-3p	CLIP-seq
MIRT1258321	hsa-miR-3121-5p	CLIP-seq
MIRT1258322	hsa-miR-3123	CLIP-seq
MIRT1258323	hsa-miR-3135b	CLIP-seq
MIRT1258324	hsa-miR-3143	CLIP-seq
MIRT1258325	hsa-miR-3148	CLIP-seq
MIRT1258326	hsa-miR-3156-5p	CLIP-seq
MIRT1258327	hsa-miR-3188	CLIP-seq
MIRT1258328	hsa-miR-3194-5p	CLIP-seq
MIRT1258329	hsa-miR-3201	CLIP-seq
MIRT1258330	hsa-miR-3202	CLIP-seq
MIRT1258331	hsa-miR-320a	CLIP-seq
MIRT1258332	hsa-miR-320b	CLIP-seq
MIRT1258333	hsa-miR-320c	CLIP-seq
MIRT1258334	hsa-miR-320d	CLIP-seq
MIRT1258335	hsa-miR-342-3p	CLIP-seq
MIRT1258336	hsa-miR-3607-3p	CLIP-seq
MIRT1258337	hsa-miR-3609	CLIP-seq
MIRT1258338	hsa-miR-3613-3p	CLIP-seq
MIRT1258339	hsa-miR-3652	CLIP-seq
MIRT1258340	hsa-miR-3678-3p	CLIP-seq
MIRT1258341	hsa-miR-3686	CLIP-seq
MIRT1258342	hsa-miR-372	CLIP-seq
MIRT1258343	hsa-miR-373	CLIP-seq
MIRT1258344	hsa-miR-380	CLIP-seq
MIRT1258345	hsa-miR-3908	CLIP-seq
MIRT1258346	hsa-miR-3919	CLIP-seq
MIRT1258347	hsa-miR-3924	CLIP-seq
MIRT1258348	hsa-miR-3973	CLIP-seq
MIRT1258349	hsa-miR-3975	CLIP-seq
MIRT1258350	hsa-miR-3978	CLIP-seq
MIRT1258351	hsa-miR-410	CLIP-seq
MIRT1258352	hsa-miR-4259	CLIP-seq
MIRT1258353	hsa-miR-4263	CLIP-seq
MIRT1258354	hsa-miR-4267	CLIP-seq
MIRT1258355	hsa-miR-4282	CLIP-seq
MIRT1258356	hsa-miR-4292	CLIP-seq
MIRT1258357	hsa-miR-4307	CLIP-seq
MIRT1258358	hsa-miR-4308	CLIP-seq
MIRT1258359	hsa-miR-4328	CLIP-seq
MIRT1258360	hsa-miR-433	CLIP-seq
MIRT1258361	hsa-miR-4422	CLIP-seq
MIRT1258362	hsa-miR-4424	CLIP-seq
MIRT1258363	hsa-miR-4427	CLIP-seq
MIRT1258364	hsa-miR-4429	CLIP-seq
MIRT1258365	hsa-miR-4430	CLIP-seq
MIRT1258366	hsa-miR-4461	CLIP-seq
MIRT1258367	hsa-miR-4465	CLIP-seq
MIRT1258368	hsa-miR-4468	CLIP-seq
MIRT1258369	hsa-miR-4474-3p	CLIP-seq
MIRT1258370	hsa-miR-448	CLIP-seq
MIRT1258371	hsa-miR-4494	CLIP-seq
MIRT1258372	hsa-miR-4495	CLIP-seq
MIRT1258373	hsa-miR-4505	CLIP-seq
MIRT1258374	hsa-miR-4509	CLIP-seq
MIRT1258375	hsa-miR-4514	CLIP-seq
MIRT1258376	hsa-miR-451b	CLIP-seq
MIRT1258377	hsa-miR-4539	CLIP-seq
MIRT1258378	hsa-miR-4639-5p	CLIP-seq
MIRT1258379	hsa-miR-4652-3p	CLIP-seq
MIRT1258380	hsa-miR-4659a-3p	CLIP-seq
MIRT1258381	hsa-miR-4659b-3p	CLIP-seq
MIRT1258382	hsa-miR-4670-3p	CLIP-seq
MIRT1258383	hsa-miR-4672	CLIP-seq
MIRT1258384	hsa-miR-4678	CLIP-seq
MIRT1258385	hsa-miR-4680-3p	CLIP-seq
MIRT1258386	hsa-miR-4682	CLIP-seq
MIRT1258387	hsa-miR-4692	CLIP-seq
MIRT1258388	hsa-miR-4698	CLIP-seq
MIRT1258389	hsa-miR-4708-3p	CLIP-seq
MIRT1258390	hsa-miR-4715-5p	CLIP-seq
MIRT1258391	hsa-miR-4716-5p	CLIP-seq
MIRT1258392	hsa-miR-4719	CLIP-seq
MIRT1258393	hsa-miR-4733-3p	CLIP-seq
MIRT1258394	hsa-miR-4736	CLIP-seq
MIRT1258395	hsa-miR-4744	CLIP-seq
MIRT1258396	hsa-miR-4747-5p	CLIP-seq
MIRT1258397	hsa-miR-4757-3p	CLIP-seq
MIRT1258398	hsa-miR-4760-5p	CLIP-seq
MIRT1258399	hsa-miR-4762-3p	CLIP-seq
MIRT1258400	hsa-miR-4763-3p	CLIP-seq
MIRT1258401	hsa-miR-4768-5p	CLIP-seq
MIRT1258402	hsa-miR-4781-3p	CLIP-seq
MIRT1258403	hsa-miR-4791	CLIP-seq
MIRT1258404	hsa-miR-4796-3p	CLIP-seq
MIRT1258405	hsa-miR-4799-5p	CLIP-seq
MIRT1258406	hsa-miR-485-3p	CLIP-seq
MIRT1258407	hsa-miR-485-5p	CLIP-seq
MIRT1258408	hsa-miR-491-3p	CLIP-seq
MIRT1258409	hsa-miR-495	CLIP-seq
MIRT1258410	hsa-miR-499a-5p	CLIP-seq
MIRT1258411	hsa-miR-501-3p	CLIP-seq
MIRT1258412	hsa-miR-502-3p	CLIP-seq
MIRT1258413	hsa-miR-513a-5p	CLIP-seq
MIRT1258414	hsa-miR-513b	CLIP-seq
MIRT1258415	hsa-miR-519d	CLIP-seq
MIRT1258416	hsa-miR-520a-3p	CLIP-seq
MIRT1258417	hsa-miR-520b	CLIP-seq
MIRT1258418	hsa-miR-520c-3p	CLIP-seq
MIRT1258419	hsa-miR-520d-3p	CLIP-seq
MIRT1258420	hsa-miR-520d-5p	CLIP-seq
MIRT1258421	hsa-miR-520e	CLIP-seq
MIRT1258422	hsa-miR-524-5p	CLIP-seq
MIRT1258423	hsa-miR-526b	CLIP-seq
MIRT1258424	hsa-miR-539	CLIP-seq
MIRT1258425	hsa-miR-543	CLIP-seq
MIRT1258426	hsa-miR-545	CLIP-seq
MIRT1258427	hsa-miR-548ah	CLIP-seq
MIRT1258428	hsa-miR-548o	CLIP-seq
MIRT1258429	hsa-miR-548v	CLIP-seq
MIRT1258430	hsa-miR-561	CLIP-seq
MIRT1258431	hsa-miR-562	CLIP-seq
MIRT1258432	hsa-miR-576-5p	CLIP-seq
MIRT1258433	hsa-miR-582-5p	CLIP-seq
MIRT1258434	hsa-miR-614	CLIP-seq
MIRT1258435	hsa-miR-622	CLIP-seq
MIRT1258436	hsa-miR-626	CLIP-seq
MIRT1258437	hsa-miR-630	CLIP-seq
MIRT1258438	hsa-miR-646	CLIP-seq
MIRT1258439	hsa-miR-656	CLIP-seq
MIRT1258440	hsa-miR-664	CLIP-seq
MIRT1258441	hsa-miR-767-3p	CLIP-seq
MIRT1258442	hsa-miR-892b	CLIP-seq
MIRT1258443	hsa-miR-93	CLIP-seq
MIRT1258444	hsa-miR-940	CLIP-seq
MIRT1258445	hsa-miR-96	CLIP-seq
MIRT1258267	hsa-miR-101	CLIP-seq
MIRT2076115	hsa-miR-103a	CLIP-seq
MIRT2076116	hsa-miR-107	CLIP-seq
MIRT1258271	hsa-miR-1207-5p	CLIP-seq
MIRT1258273	hsa-miR-1252	CLIP-seq
MIRT1258274	hsa-miR-1253	CLIP-seq
MIRT2076117	hsa-miR-1270	CLIP-seq
MIRT1258276	hsa-miR-1271	CLIP-seq
MIRT1258277	hsa-miR-1287	CLIP-seq
MIRT1258278	hsa-miR-1290	CLIP-seq
MIRT1258279	hsa-miR-1297	CLIP-seq
MIRT1258280	hsa-miR-132	CLIP-seq
MIRT1258282	hsa-miR-1324	CLIP-seq
MIRT1258283	hsa-miR-141	CLIP-seq
MIRT2076118	hsa-miR-142-3p	CLIP-seq
MIRT1258284	hsa-miR-144	CLIP-seq
MIRT2076119	hsa-miR-146b-3p	CLIP-seq
MIRT1258286	hsa-miR-182	CLIP-seq
MIRT1258287	hsa-miR-188-3p	CLIP-seq
MIRT2076120	hsa-miR-1914	CLIP-seq
MIRT1258289	hsa-miR-200a	CLIP-seq
MIRT1258292	hsa-miR-2052	CLIP-seq
MIRT1258297	hsa-miR-212	CLIP-seq
MIRT1258304	hsa-miR-26a	CLIP-seq
MIRT1258305	hsa-miR-26b	CLIP-seq
MIRT1258306	hsa-miR-27a	CLIP-seq
MIRT1258307	hsa-miR-27b	CLIP-seq
MIRT1258308	hsa-miR-298	CLIP-seq
MIRT1258314	hsa-miR-3064-5p	CLIP-seq
MIRT2076121	hsa-miR-3117-5p	CLIP-seq
MIRT1258321	hsa-miR-3121-5p	CLIP-seq
MIRT2076122	hsa-miR-3125	CLIP-seq
MIRT2076123	hsa-miR-3126-5p	CLIP-seq
MIRT1258323	hsa-miR-3135b	CLIP-seq
MIRT1258324	hsa-miR-3143	CLIP-seq
MIRT1258325	hsa-miR-3148	CLIP-seq
MIRT1258326	hsa-miR-3156-5p	CLIP-seq
MIRT2076124	hsa-miR-3176	CLIP-seq
MIRT1258328	hsa-miR-3194-5p	CLIP-seq
MIRT1258330	hsa-miR-3202	CLIP-seq
MIRT1258335	hsa-miR-342-3p	CLIP-seq
MIRT2076125	hsa-miR-3591-3p	CLIP-seq
MIRT1258336	hsa-miR-3607-3p	CLIP-seq
MIRT1258339	hsa-miR-3652	CLIP-seq
MIRT1258340	hsa-miR-3678-3p	CLIP-seq
MIRT2076126	hsa-miR-3681	CLIP-seq
MIRT1258341	hsa-miR-3686	CLIP-seq
MIRT2076127	hsa-miR-3916	CLIP-seq
MIRT1258346	hsa-miR-3919	CLIP-seq
MIRT2076128	hsa-miR-3922-3p	CLIP-seq
MIRT1258347	hsa-miR-3924	CLIP-seq
MIRT2076129	hsa-miR-3944-5p	CLIP-seq
MIRT1258348	hsa-miR-3973	CLIP-seq
MIRT1258350	hsa-miR-3978	CLIP-seq
MIRT1258351	hsa-miR-410	CLIP-seq
MIRT2076130	hsa-miR-4252	CLIP-seq
MIRT1258352	hsa-miR-4259	CLIP-seq
MIRT1258353	hsa-miR-4263	CLIP-seq
MIRT1258357	hsa-miR-4307	CLIP-seq
MIRT1258360	hsa-miR-433	CLIP-seq
MIRT2076131	hsa-miR-4419a	CLIP-seq
MIRT1258362	hsa-miR-4424	CLIP-seq
MIRT1258363	hsa-miR-4427	CLIP-seq
MIRT1258365	hsa-miR-4430	CLIP-seq
MIRT1258366	hsa-miR-4461	CLIP-seq
MIRT1258367	hsa-miR-4465	CLIP-seq
MIRT1258368	hsa-miR-4468	CLIP-seq
MIRT1258369	hsa-miR-4474-3p	CLIP-seq
MIRT1258373	hsa-miR-4505	CLIP-seq
MIRT1258374	hsa-miR-4509	CLIP-seq
MIRT2076132	hsa-miR-4510	CLIP-seq
MIRT1258375	hsa-miR-4514	CLIP-seq
MIRT1258376	hsa-miR-451b	CLIP-seq
MIRT1258377	hsa-miR-4539	CLIP-seq
MIRT1258379	hsa-miR-4652-3p	CLIP-seq
MIRT2076133	hsa-miR-4666-5p	CLIP-seq
MIRT2076134	hsa-miR-4668-3p	CLIP-seq
MIRT1258382	hsa-miR-4670-3p	CLIP-seq
MIRT1258385	hsa-miR-4680-3p	CLIP-seq
MIRT1258386	hsa-miR-4682	CLIP-seq
MIRT2076135	hsa-miR-4683	CLIP-seq
MIRT1258387	hsa-miR-4692	CLIP-seq
MIRT1258390	hsa-miR-4715-5p	CLIP-seq
MIRT2076136	hsa-miR-4731-3p	CLIP-seq
MIRT1258394	hsa-miR-4736	CLIP-seq
MIRT1258395	hsa-miR-4744	CLIP-seq
MIRT1258396	hsa-miR-4747-5p	CLIP-seq
MIRT2076137	hsa-miR-4756-3p	CLIP-seq
MIRT2076138	hsa-miR-4760-3p	CLIP-seq
MIRT1258399	hsa-miR-4762-3p	CLIP-seq
MIRT1258400	hsa-miR-4763-3p	CLIP-seq
MIRT1258401	hsa-miR-4768-5p	CLIP-seq
MIRT2076139	hsa-miR-4773	CLIP-seq
MIRT1258402	hsa-miR-4781-3p	CLIP-seq
MIRT1258405	hsa-miR-4799-5p	CLIP-seq
MIRT2076140	hsa-miR-4801	CLIP-seq
MIRT1258406	hsa-miR-485-3p	CLIP-seq
MIRT2076141	hsa-miR-494	CLIP-seq
MIRT1258411	hsa-miR-501-3p	CLIP-seq
MIRT1258412	hsa-miR-502-3p	CLIP-seq
MIRT1258413	hsa-miR-513a-5p	CLIP-seq
MIRT2076142	hsa-miR-520a-5p	CLIP-seq
MIRT1258420	hsa-miR-520d-5p	CLIP-seq
MIRT1258422	hsa-miR-524-5p	CLIP-seq
MIRT2076143	hsa-miR-525-5p	CLIP-seq
MIRT1258423	hsa-miR-526b	CLIP-seq
MIRT1258424	hsa-miR-539	CLIP-seq
MIRT1258425	hsa-miR-543	CLIP-seq
MIRT2076144	hsa-miR-548a-3p	CLIP-seq
MIRT2076145	hsa-miR-548e	CLIP-seq
MIRT2076146	hsa-miR-548f	CLIP-seq
MIRT2076147	hsa-miR-548g	CLIP-seq
MIRT1258430	hsa-miR-561	CLIP-seq
MIRT1258431	hsa-miR-562	CLIP-seq
MIRT2076148	hsa-miR-568	CLIP-seq
MIRT1258432	hsa-miR-576-5p	CLIP-seq
MIRT1258434	hsa-miR-614	CLIP-seq
MIRT2076149	hsa-miR-620	CLIP-seq
MIRT1258435	hsa-miR-622	CLIP-seq
MIRT2076150	hsa-miR-640	CLIP-seq
MIRT1258439	hsa-miR-656	CLIP-seq
MIRT1258440	hsa-miR-664	CLIP-seq
MIRT1258442	hsa-miR-892b	CLIP-seq
MIRT2076151	hsa-miR-936	CLIP-seq
MIRT1258444	hsa-miR-940	CLIP-seq
MIRT2076152	hsa-miR-941	CLIP-seq
MIRT1258445	hsa-miR-96	CLIP-seq
MIRT1258267	hsa-miR-101	CLIP-seq
MIRT2076115	hsa-miR-103a	CLIP-seq
MIRT1258268	hsa-miR-106a	CLIP-seq
MIRT1258269	hsa-miR-106b	CLIP-seq
MIRT2076116	hsa-miR-107	CLIP-seq
MIRT1258270	hsa-miR-1197	CLIP-seq
MIRT1258271	hsa-miR-1207-5p	CLIP-seq
MIRT1258273	hsa-miR-1252	CLIP-seq
MIRT1258274	hsa-miR-1253	CLIP-seq
MIRT2302732	hsa-miR-1262	CLIP-seq
MIRT2076117	hsa-miR-1270	CLIP-seq
MIRT1258276	hsa-miR-1271	CLIP-seq
MIRT2302733	hsa-miR-1273f	CLIP-seq
MIRT2302734	hsa-miR-127-5p	CLIP-seq
MIRT1258278	hsa-miR-1290	CLIP-seq
MIRT2302735	hsa-miR-1293	CLIP-seq
MIRT1258279	hsa-miR-1297	CLIP-seq
MIRT1258280	hsa-miR-132	CLIP-seq
MIRT1258281	hsa-miR-1323	CLIP-seq
MIRT1258282	hsa-miR-1324	CLIP-seq
MIRT1258283	hsa-miR-141	CLIP-seq
MIRT2076118	hsa-miR-142-3p	CLIP-seq
MIRT1258285	hsa-miR-17	CLIP-seq
MIRT1258286	hsa-miR-182	CLIP-seq
MIRT1258289	hsa-miR-200a	CLIP-seq
MIRT1258291	hsa-miR-205	CLIP-seq
MIRT1258293	hsa-miR-20a	CLIP-seq
MIRT1258294	hsa-miR-20b	CLIP-seq
MIRT1258296	hsa-miR-2114	CLIP-seq
MIRT1258297	hsa-miR-212	CLIP-seq
MIRT1258299	hsa-miR-221	CLIP-seq
MIRT1258300	hsa-miR-222	CLIP-seq
MIRT2302736	hsa-miR-2467-3p	CLIP-seq
MIRT1258302	hsa-miR-2467-5p	CLIP-seq
MIRT1258304	hsa-miR-26a	CLIP-seq
MIRT1258305	hsa-miR-26b	CLIP-seq
MIRT1258308	hsa-miR-298	CLIP-seq
MIRT1258309	hsa-miR-302a	CLIP-seq
MIRT1258310	hsa-miR-302b	CLIP-seq
MIRT1258311	hsa-miR-302c	CLIP-seq
MIRT1258312	hsa-miR-302d	CLIP-seq
MIRT1258313	hsa-miR-302e	CLIP-seq
MIRT1258314	hsa-miR-3064-5p	CLIP-seq
MIRT2076121	hsa-miR-3117-5p	CLIP-seq
MIRT1258321	hsa-miR-3121-5p	CLIP-seq
MIRT1258322	hsa-miR-3123	CLIP-seq
MIRT2076122	hsa-miR-3125	CLIP-seq
MIRT2076123	hsa-miR-3126-5p	CLIP-seq
MIRT1258324	hsa-miR-3143	CLIP-seq
MIRT2302737	hsa-miR-3147	CLIP-seq
MIRT2302738	hsa-miR-3152-5p	CLIP-seq
MIRT1258326	hsa-miR-3156-5p	CLIP-seq
MIRT2076124	hsa-miR-3176	CLIP-seq
MIRT1258327	hsa-miR-3188	CLIP-seq
MIRT1258328	hsa-miR-3194-5p	CLIP-seq
MIRT1258329	hsa-miR-3201	CLIP-seq
MIRT1258330	hsa-miR-3202	CLIP-seq
MIRT2302739	hsa-miR-34a	CLIP-seq
MIRT2302740	hsa-miR-34c-5p	CLIP-seq
MIRT2076125	hsa-miR-3591-3p	CLIP-seq
MIRT1258336	hsa-miR-3607-3p	CLIP-seq
MIRT1258337	hsa-miR-3609	CLIP-seq
MIRT1258339	hsa-miR-3652	CLIP-seq
MIRT2302741	hsa-miR-3665	CLIP-seq
MIRT1258340	hsa-miR-3678-3p	CLIP-seq
MIRT2302742	hsa-miR-3679-3p	CLIP-seq
MIRT2076126	hsa-miR-3681	CLIP-seq
MIRT1258341	hsa-miR-3686	CLIP-seq
MIRT1258342	hsa-miR-372	CLIP-seq
MIRT1258343	hsa-miR-373	CLIP-seq
MIRT1258344	hsa-miR-380	CLIP-seq
MIRT1258345	hsa-miR-3908	CLIP-seq
MIRT2076127	hsa-miR-3916	CLIP-seq
MIRT1258346	hsa-miR-3919	CLIP-seq
MIRT2076128	hsa-miR-3922-3p	CLIP-seq
MIRT1258347	hsa-miR-3924	CLIP-seq
MIRT2302743	hsa-miR-3934	CLIP-seq
MIRT2302744	hsa-miR-3942-3p	CLIP-seq
MIRT2076129	hsa-miR-3944-5p	CLIP-seq
MIRT1258349	hsa-miR-3975	CLIP-seq
MIRT2302745	hsa-miR-4257	CLIP-seq
MIRT1258352	hsa-miR-4259	CLIP-seq
MIRT1258354	hsa-miR-4267	CLIP-seq
MIRT2302746	hsa-miR-4272	CLIP-seq
MIRT2302747	hsa-miR-4279	CLIP-seq
MIRT1258355	hsa-miR-4282	CLIP-seq
MIRT1258356	hsa-miR-4292	CLIP-seq
MIRT1258358	hsa-miR-4308	CLIP-seq
MIRT1258360	hsa-miR-433	CLIP-seq
MIRT2076131	hsa-miR-4419a	CLIP-seq
MIRT1258362	hsa-miR-4424	CLIP-seq
MIRT2302748	hsa-miR-4425	CLIP-seq
MIRT1258363	hsa-miR-4427	CLIP-seq
MIRT1258365	hsa-miR-4430	CLIP-seq
MIRT2302749	hsa-miR-4434	CLIP-seq
MIRT1258366	hsa-miR-4461	CLIP-seq
MIRT1258367	hsa-miR-4465	CLIP-seq
MIRT1258368	hsa-miR-4468	CLIP-seq
MIRT1258370	hsa-miR-448	CLIP-seq
MIRT2302750	hsa-miR-4483	CLIP-seq
MIRT1258371	hsa-miR-4494	CLIP-seq
MIRT2302751	hsa-miR-449a	CLIP-seq
MIRT2302752	hsa-miR-449b	CLIP-seq
MIRT1258373	hsa-miR-4505	CLIP-seq
MIRT2076132	hsa-miR-4510	CLIP-seq
MIRT1258375	hsa-miR-4514	CLIP-seq
MIRT2302753	hsa-miR-4516	CLIP-seq
MIRT1258376	hsa-miR-451b	CLIP-seq
MIRT2302754	hsa-miR-4531	CLIP-seq
MIRT2302755	hsa-miR-4534	CLIP-seq
MIRT1258377	hsa-miR-4539	CLIP-seq
MIRT2302756	hsa-miR-4635	CLIP-seq
MIRT1258379	hsa-miR-4652-3p	CLIP-seq
MIRT2302757	hsa-miR-4666-3p	CLIP-seq
MIRT2076133	hsa-miR-4666-5p	CLIP-seq
MIRT2076134	hsa-miR-4668-3p	CLIP-seq
MIRT1258383	hsa-miR-4672	CLIP-seq
MIRT1258384	hsa-miR-4678	CLIP-seq
MIRT1258385	hsa-miR-4680-3p	CLIP-seq
MIRT1258386	hsa-miR-4682	CLIP-seq
MIRT2076135	hsa-miR-4683	CLIP-seq
MIRT1258387	hsa-miR-4692	CLIP-seq
MIRT1258388	hsa-miR-4698	CLIP-seq
MIRT2302758	hsa-miR-4701-3p	CLIP-seq
MIRT2302759	hsa-miR-4705	CLIP-seq
MIRT1258389	hsa-miR-4708-3p	CLIP-seq
MIRT1258390	hsa-miR-4715-5p	CLIP-seq
MIRT1258391	hsa-miR-4716-5p	CLIP-seq
MIRT2302760	hsa-miR-4717-3p	CLIP-seq
MIRT1258394	hsa-miR-4736	CLIP-seq
MIRT1258396	hsa-miR-4747-5p	CLIP-seq
MIRT2076137	hsa-miR-4756-3p	CLIP-seq
MIRT1258398	hsa-miR-4760-5p	CLIP-seq
MIRT1258399	hsa-miR-4762-3p	CLIP-seq
MIRT1258400	hsa-miR-4763-3p	CLIP-seq
MIRT2302761	hsa-miR-4780	CLIP-seq
MIRT1258402	hsa-miR-4781-3p	CLIP-seq
MIRT1258403	hsa-miR-4791	CLIP-seq
MIRT1258404	hsa-miR-4796-3p	CLIP-seq
MIRT1258407	hsa-miR-485-5p	CLIP-seq
MIRT1258408	hsa-miR-491-3p	CLIP-seq
MIRT1258410	hsa-miR-499a-5p	CLIP-seq
MIRT1258411	hsa-miR-501-3p	CLIP-seq
MIRT1258412	hsa-miR-502-3p	CLIP-seq
MIRT2302762	hsa-miR-514	CLIP-seq
MIRT2302763	hsa-miR-514b-3p	CLIP-seq
MIRT1258415	hsa-miR-519d	CLIP-seq
MIRT1258416	hsa-miR-520a-3p	CLIP-seq
MIRT2076142	hsa-miR-520a-5p	CLIP-seq
MIRT1258417	hsa-miR-520b	CLIP-seq
MIRT1258418	hsa-miR-520c-3p	CLIP-seq
MIRT1258419	hsa-miR-520d-3p	CLIP-seq
MIRT1258420	hsa-miR-520d-5p	CLIP-seq
MIRT1258421	hsa-miR-520e	CLIP-seq
MIRT1258422	hsa-miR-524-5p	CLIP-seq
MIRT2076143	hsa-miR-525-5p	CLIP-seq
MIRT1258423	hsa-miR-526b	CLIP-seq
MIRT1258425	hsa-miR-543	CLIP-seq
MIRT1258427	hsa-miR-548ah	CLIP-seq
MIRT1258428	hsa-miR-548o	CLIP-seq
MIRT2302764	hsa-miR-548p	CLIP-seq
MIRT2302765	hsa-miR-548t	CLIP-seq
MIRT1258429	hsa-miR-548v	CLIP-seq
MIRT1258430	hsa-miR-561	CLIP-seq
MIRT1258431	hsa-miR-562	CLIP-seq
MIRT2076148	hsa-miR-568	CLIP-seq
MIRT1258433	hsa-miR-582-5p	CLIP-seq
MIRT1258434	hsa-miR-614	CLIP-seq
MIRT2076149	hsa-miR-620	CLIP-seq
MIRT1258435	hsa-miR-622	CLIP-seq
MIRT1258436	hsa-miR-626	CLIP-seq
MIRT1258437	hsa-miR-630	CLIP-seq
MIRT2076150	hsa-miR-640	CLIP-seq
MIRT1258438	hsa-miR-646	CLIP-seq
MIRT1258439	hsa-miR-656	CLIP-seq
MIRT1258442	hsa-miR-892b	CLIP-seq
MIRT1258443	hsa-miR-93	CLIP-seq
MIRT1258444	hsa-miR-940	CLIP-seq
MIRT2076152	hsa-miR-941	CLIP-seq
MIRT1258445	hsa-miR-96	CLIP-seq
MIRT2076117	hsa-miR-1270	CLIP-seq
MIRT2302734	hsa-miR-127-5p	CLIP-seq
MIRT2076118	hsa-miR-142-3p	CLIP-seq
MIRT1258314	hsa-miR-3064-5p	CLIP-seq
MIRT2076121	hsa-miR-3117-5p	CLIP-seq
MIRT1258339	hsa-miR-3652	CLIP-seq
MIRT2302742	hsa-miR-3679-3p	CLIP-seq
MIRT2076126	hsa-miR-3681	CLIP-seq
MIRT1258365	hsa-miR-4430	CLIP-seq
MIRT1258373	hsa-miR-4505	CLIP-seq
MIRT1258376	hsa-miR-451b	CLIP-seq
MIRT1258377	hsa-miR-4539	CLIP-seq
MIRT2302756	hsa-miR-4635	CLIP-seq
MIRT2076135	hsa-miR-4683	CLIP-seq
MIRT1258392	hsa-miR-4719	CLIP-seq
MIRT1258398	hsa-miR-4760-5p	CLIP-seq
MIRT2392925	hsa-miR-4766-3p	CLIP-seq
MIRT2302761	hsa-miR-4780	CLIP-seq
MIRT1258414	hsa-miR-513b	CLIP-seq
MIRT2076149	hsa-miR-620	CLIP-seq
MIRT1258435	hsa-miR-622	CLIP-seq
MIRT1258442	hsa-miR-892b	CLIP-seq
MIRT1258321	hsa-miR-3121-5p	CLIP-seq
MIRT1258344	hsa-miR-380	CLIP-seq
MIRT1258420	hsa-miR-520d-5p	CLIP-seq
MIRT1258422	hsa-miR-524-5p	CLIP-seq
MIRT2076125	hsa-miR-3591-3p	CLIP-seq
MIRT2076152	hsa-miR-941	CLIP-seq
MIRT2076117	hsa-miR-1270	CLIP-seq
MIRT1258282	hsa-miR-1324	CLIP-seq
MIRT2076118	hsa-miR-142-3p	CLIP-seq
MIRT1258291	hsa-miR-205	CLIP-seq
MIRT1258314	hsa-miR-3064-5p	CLIP-seq
MIRT2076121	hsa-miR-3117-5p	CLIP-seq
MIRT1258321	hsa-miR-3121-5p	CLIP-seq
MIRT2076122	hsa-miR-3125	CLIP-seq
MIRT2076123	hsa-miR-3126-5p	CLIP-seq
MIRT1258324	hsa-miR-3143	CLIP-seq
MIRT2302738	hsa-miR-3152-5p	CLIP-seq
MIRT2076124	hsa-miR-3176	CLIP-seq
MIRT1258339	hsa-miR-3652	CLIP-seq
MIRT2076126	hsa-miR-3681	CLIP-seq
MIRT1258344	hsa-miR-380	CLIP-seq
MIRT2076127	hsa-miR-3916	CLIP-seq
MIRT2076128	hsa-miR-3922-3p	CLIP-seq
MIRT1258347	hsa-miR-3924	CLIP-seq
MIRT2076130	hsa-miR-4252	CLIP-seq
MIRT1258357	hsa-miR-4307	CLIP-seq
MIRT1258360	hsa-miR-433	CLIP-seq
MIRT2076131	hsa-miR-4419a	CLIP-seq
MIRT1258365	hsa-miR-4430	CLIP-seq
MIRT1258371	hsa-miR-4494	CLIP-seq
MIRT1258373	hsa-miR-4505	CLIP-seq
MIRT2076132	hsa-miR-4510	CLIP-seq
MIRT1258377	hsa-miR-4539	CLIP-seq
MIRT1258380	hsa-miR-4659a-3p	CLIP-seq
MIRT1258381	hsa-miR-4659b-3p	CLIP-seq
MIRT2302757	hsa-miR-4666-3p	CLIP-seq
MIRT2076133	hsa-miR-4666-5p	CLIP-seq
MIRT2076134	hsa-miR-4668-3p	CLIP-seq
MIRT2076135	hsa-miR-4683	CLIP-seq
MIRT1258388	hsa-miR-4698	CLIP-seq
MIRT2302759	hsa-miR-4705	CLIP-seq
MIRT1258406	hsa-miR-485-3p	CLIP-seq
MIRT1258410	hsa-miR-499a-5p	CLIP-seq
MIRT2076142	hsa-miR-520a-5p	CLIP-seq
MIRT1258420	hsa-miR-520d-5p	CLIP-seq
MIRT1258422	hsa-miR-524-5p	CLIP-seq
MIRT2076143	hsa-miR-525-5p	CLIP-seq
MIRT1258425	hsa-miR-543	CLIP-seq
MIRT2599456	hsa-miR-548ag	CLIP-seq
MIRT2599457	hsa-miR-548ai	CLIP-seq
MIRT1258430	hsa-miR-561	CLIP-seq
MIRT2076148	hsa-miR-568	CLIP-seq
MIRT2076149	hsa-miR-620	CLIP-seq
MIRT1258435	hsa-miR-622	CLIP-seq
MIRT1258436	hsa-miR-626	CLIP-seq
MIRT2076150	hsa-miR-640	CLIP-seq
MIRT1258442	hsa-miR-892b	CLIP-seq
MIRT1258314	hsa-miR-3064-5p	CLIP-seq
MIRT2076121	hsa-miR-3117-5p	CLIP-seq
MIRT1258339	hsa-miR-3652	CLIP-seq
MIRT1258365	hsa-miR-4430	CLIP-seq
MIRT1258373	hsa-miR-4505	CLIP-seq
MIRT1258442	hsa-miR-892b	CLIP-seq

Gene ontology (GO) Show/Hide all (49)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001569	Process	Branching involved in blood vessel morphogenesis	IEA
GO:0001837	Process	Epithelial to mesenchymal transition	IEA
GO:0004721	Function	Phosphoprotein phosphatase activity	IEA
GO:0004723	Function	Calcium-dependent protein serine/threonine phosphatase activity	NAS	2558868
GO:0005509	Function	Calcium ion binding	IEA
GO:0005509	Function	Calcium ion binding	NAS	2558868
GO:0005515	Function	Protein binding	IPI	8524402, 12218175, 12357034, 12809556, 16648474, 22343722, 23468591, 24954618, 25416956, 26871637, 27880917, 28514442, 32296183, 32814053, 33961781, 34446558, 35914814, 37398436
GO:0005516	Function	Calmodulin binding	NAS	2558868
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	NAS	22343722, 28126489
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IEA
GO:0005955	Component	Calcineurin complex	IBA
GO:0005955	Component	Calcineurin complex	IDA	12218175, 12357034, 22343722, 22688515, 23468591, 26794871, 27974827
GO:0005955	Component	Calcineurin complex	IEA
GO:0005955	Component	Calcineurin complex	NAS	2558868, 11123943
GO:0006606	Process	Protein import into nucleus	IEA
GO:0007507	Process	Heart development	IEA
GO:0008287	Component	Protein serine/threonine phosphatase complex	NAS	22343722
GO:0008597	Function	Calcium-dependent protein serine/threonine phosphatase regulator activity	IBA
GO:0014044	Process	Schwann cell development	IEA
GO:0016020	Component	Membrane	IEA
GO:0019902	Function	Phosphatase binding	IBA
GO:0019902	Function	Phosphatase binding	IEA
GO:0019902	Function	Phosphatase binding	IPI	26794871, 27974827
GO:0019904	Function	Protein domain specific binding	IPI	20639889
GO:0022011	Process	Myelination in peripheral nervous system	IEA
GO:0033173	Process	Calcineurin-NFAT signaling cascade	IBA
GO:0033173	Process	Calcineurin-NFAT signaling cascade	IDA	22688515
GO:0033173	Process	Calcineurin-NFAT signaling cascade	IEA
GO:0034504	Process	Protein localization to nucleus	IEA
GO:0042383	Component	Sarcolemma	IEA
GO:0045202	Component	Synapse	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	22688515
GO:0046872	Function	Metal ion binding	IEA
GO:0060487	Process	Lung epithelial cell differentiation	IEA
GO:0070886	Process	Positive regulation of calcineurin-NFAT signaling cascade	NAS	8631904, 22343722
GO:0098685	Component	Schaffer collateral - CA1 synapse	IEA
GO:0098686	Component	Hippocampal mossy fiber to CA3 synapse	IEA
GO:0098688	Component	Parallel fiber to Purkinje cell synapse	IEA
GO:0098693	Process	Regulation of synaptic vesicle cycle	IEA
GO:0098794	Component	Postsynapse	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0099149	Process	Regulation of postsynaptic neurotransmitter receptor internalization	IEA
GO:0099170	Process	Postsynaptic modulation of chemical synaptic transmission	IEA
GO:1905665	Process	Positive regulation of calcium ion import across plasma membrane	NAS	17640527
GO:1905949	Process	Negative regulation of calcium ion import across plasma membrane	NAS	17640527

Other IDs

• MIM: 601302
• HGNC: 9317
• e!Ensembl: ENSG00000221823

Protein

• UniProt ID: P63098
• Protein name: Calcineurin subunit B type 1 (Protein phosphatase 2B regulatory subunit 1) (Protein phosphatase 3 regulatory subunit B alpha isoform 1)
• Protein function: Regulatory subunit of calcineurin, a calcium-dependent, calmodulin stimulated protein phosphatase. Confers calcium sensitivity.
• PDB: 1AUI , 1M63 , 1MF8 , 2P6B , 3LL8 , 4F0Z , 4OR9 , 4ORA , 4ORC , 5SVE , 6NUC , 6NUF , 6NUU , 7U0T , 9B9G , 9CHU , 9CHV , 9CHX
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00036	EF-hand_1	132 → 160	EF hand	Domain
  PF13499	EF-hand_7	89 → 158	EF-hand domain pair	Domain
  PF13499	EF-hand_7	20 → 80	EF-hand domain pair	Domain

• Sequence:

  MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVID
  IFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMV
  GNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV

• Sequence length: 170

Pathways

KEGG Pathway	Reactome Pathway
MAPK signaling pathway	Activation of BAD and translocation to mitochondria
Calcium signaling pathway	Calcineurin activates NFAT
cGMP-PKG signaling pathway	FCERI mediated Ca+2 mobilization
Oocyte meiosis	Ca2+ pathway
Cellular senescence	CLEC7A (Dectin-1) induces NFAT activation
Wnt signaling pathway
Axon guidance
VEGF signaling pathway
Osteoclast differentiation
C-type lectin receptor signaling pathway
Natural killer cell mediated cytotoxicity
Th1 and Th2 cell differentiation
Th17 cell differentiation
T cell receptor signaling pathway
B cell receptor signaling pathway
Long-term potentiation
Glutamatergic synapse
Oxytocin signaling pathway
Glucagon signaling pathway
Renin secretion
Alzheimer disease
Amyotrophic lateral sclerosis
Prion disease
Pathways of neurodegeneration - multiple diseases
Amphetamine addiction
Tuberculosis
Human cytomegalovirus infection
Human T-cell leukemia virus 1 infection
Kaposi sarcoma-associated herpesvirus infection
Human immunodeficiency virus 1 infection
PD-L1 expression and PD-1 checkpoint pathway in cancer
Lipid and atherosclerosis

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (8)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
ALZHEIMERS DISEASE	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHY, DILATED	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTROPHY, LEFT VENTRICULAR	—	CTD	18344631	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEFT VENTRICULAR HYPERTROPHY	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	16214533	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	37945903	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	37945903	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	28991256, 30285260	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (36)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Alzheimer Disease	Alzheimer disease	Pubtator	23727081, 31745181, 36569892	Associate	★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	23785163		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	34198460	Associate	★☆☆☆☆ Found in Text Mining only
Atypical Ductal Breast Hyperplasia	Breast Hyperplasia	BEFREE	31013355		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	29972239		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	15012912	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Hypertrophic Familial	Cardiomyopathy	Pubtator	31754133	Associate	★☆☆☆☆ Found in Text Mining only
Cervical lymphadenopathy	Cervical lymphadenopathy	BEFREE	29188372		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	29549257		★☆☆☆☆ Found in Text Mining only
Cornea plana	Cornea Plana	BEFREE	7601455, 8723718, 8825624, 8929947		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	28827117		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	23727081	Associate	★☆☆☆☆ Found in Text Mining only
Hearing Loss	Hearing loss	Pubtator	37595341	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	31754133	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	16209992, 31754133		★☆☆☆☆ Found in Text Mining only
Idiopathic Membranous Glomerulonephritis	Membranous Glomerulonephritis	BEFREE	30388516, 30985728		★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	16209992		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	CTD_human_DG	18344631		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	LHGDN	18825932		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	33912138	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	29972239		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	26215382, 29227044, 30216597		★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	CTD_human_DG	16214533		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neuroblastoma	Neuroblastoma	BEFREE	23900721		★☆☆☆☆ Found in Text Mining only
Paraplegia	Paraplegia	BEFREE	31397359		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	23900721		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	29181737		★☆☆☆☆ Found in Text Mining only
Restless Legs Syndrome	Willis-ekbom disease	Pubtator	32651461	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	PSYGENET_DG	12851458		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	BEFREE	12851458, 29427598		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	LHGDN	18343007		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	GWASCAT_DG	28991256		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach neoplasms	Pubtator	33661721	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Nodule	Thyroid Nodule	BEFREE	25978151		★☆☆☆☆ Found in Text Mining only
Trigeminal Neuralgia	Trigeminal neuralgia	Pubtator	38158702	Associate	★☆☆☆☆ Found in Text Mining only
Ventricular hypertrophy	Ventricular hypertrophy	BEFREE	31754133		★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

PLEKHM2 2 shared diseasesDilated cardiomyopathy, Left ventricular disease 2 shared evidence sourcesDisgenet (Dilated cardiomyopathy), Disgenet (Left ventricular disease) Related via 2 shared diseases including Dilated cardiomyopathy, Left ventricular disease — evidence mostly Disgenet. CKM 2 shared diseasesHypertrophy, Left ventricular disease 2 shared evidence sourcesCTD (Hypertrophy), Disgenet (Left ventricular disease) Related via 2 shared diseases including Hypertrophy, Left ventricular disease — evidence mostly CTD. PPP3CA 2 shared diseasesHypertrophy, Left ventricular disease 33 shared pathwaysMAPK signaling pathway, Calcium signaling pathway, cGMP-PKG signaling pathway, Oocyte meiosis, Cellular senescence, Wnt signaling pathway, Axon guidance, VEGF signaling pathway, Osteoclast differentiation, C-type lectin receptor signaling pathway, Natural killer cell mediated cytotoxicity, Th1 and Th2 cell differentiation +21 more 2 shared evidence sourcesCTD (Hypertrophy), Disgenet (Left ventricular disease) Related via 33 shared pathways including MAPK signaling pathway, Calcium signaling pathway — evidence mostly CTD. CKB 2 shared diseasesHypertrophy, Left ventricular disease 2 shared evidence sourcesCTD (Hypertrophy), Disgenet (Left ventricular disease) Related via 2 shared diseases including Hypertrophy, Left ventricular disease — evidence mostly CTD. HRH2 2 shared diseasesHypertrophy, Left ventricular disease 1 shared pathwayCalcium signaling pathway 2 shared evidence sourcesCTD (Hypertrophy), Disgenet (Left ventricular disease) Related via 2 shared diseases including Hypertrophy, Left ventricular disease — evidence mostly CTD.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
PLEKHM2	2	["Dilated cardiomyopathy","Left ventricular disease"]	0	[]	2	["Disgenet (Dilated cardiomyopathy)","Disgenet (Left ventricular disease)"]
CKM	2	["Hypertrophy","Left ventricular disease"]	0	[]	2	["CTD (Hypertrophy)","Disgenet (Left ventricular disease)"]
PPP3CA	2	["Hypertrophy","Left ventricular disease"]	33	["MAPK signaling pathway","Calcium signaling pathway","cGMP-PKG signaling pathway","Oocyte meiosis","Cellular senescence","Wnt signaling pathway","Axon guidance","VEGF signaling pathway","Osteoclast differentiation","C-type lectin receptor signaling pathway","Natural killer cell mediated cytotoxicity","Th1 and Th2 cell differentiation"]	2	["CTD (Hypertrophy)","Disgenet (Left ventricular disease)"]
CKB	2	["Hypertrophy","Left ventricular disease"]	0	[]	2	["CTD (Hypertrophy)","Disgenet (Left ventricular disease)"]
HRH2	2	["Hypertrophy","Left ventricular disease"]	1	["Calcium signaling pathway"]	2	["CTD (Hypertrophy)","Disgenet (Left ventricular disease)"]

Diseases Linked via Similar Genes

Coronary artery disease Linked via 2 of 5 related genesPLEKHM2, CKB Insomnia Linked via 2 of 5 related genesPLEKHM2, PPP3CA Diabetes mellitus type 2 Linked via 2 of 5 related genesPLEKHM2, PPP3CA Myocardial infarction Linked via 2 of 5 related genesCKM, CKB Color vision deficiency Linked via 2 of 5 related genesPPP3CA, HRH2

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Coronary artery disease	2	["PLEKHM2","CKB"]
Insomnia	2	["PLEKHM2","PPP3CA"]
Diabetes mellitus type 2	2	["PLEKHM2","PPP3CA"]
Myocardial infarction	2	["CKM","CKB"]
Color vision deficiency	2	["PPP3CA","HRH2"]