PPP2R5A (protein phosphatase 2 regulatory subunit B'alpha)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 5525
• Gene name: Protein phosphatase 2 regulatory subunit B'alpha
• Gene symbol: PPP2R5A
• Synonyms (NCBI Gene): B56A, B56alpha, PR61A
• Chromosome: 1
• Chromosome location: 1q32.3
• Summary: The product of this gene belongs to the phosphatase 2A regulatory subunit B family. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common het

miRNA Show/Hide all (186)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004602	hsa-miR-1-3p	Luciferase reporter assay, Western blot	19131648
MIRT016181	hsa-miR-590-3p	Sequencing	20371350
MIRT018236	hsa-miR-335-5p	Microarray	18185580
MIRT042199	hsa-miR-484	CLASH	23622248
MIRT439913	ebv-miR-BART7-3p	HITS-CLIP	22473208
MIRT439913	ebv-miR-BART7-3p	HITS-CLIP	22473208
MIRT1257908	hsa-miR-1	CLIP-seq
MIRT1257909	hsa-miR-1202	CLIP-seq
MIRT1257910	hsa-miR-1298	CLIP-seq
MIRT1257911	hsa-miR-19a	CLIP-seq
MIRT1257912	hsa-miR-19b	CLIP-seq
MIRT1257913	hsa-miR-2052	CLIP-seq
MIRT1257914	hsa-miR-2054	CLIP-seq
MIRT1257915	hsa-miR-206	CLIP-seq
MIRT1257916	hsa-miR-2276	CLIP-seq
MIRT1257917	hsa-miR-2278	CLIP-seq
MIRT1257918	hsa-miR-3120-3p	CLIP-seq
MIRT1257919	hsa-miR-3148	CLIP-seq
MIRT1257920	hsa-miR-3673	CLIP-seq
MIRT1257921	hsa-miR-3692	CLIP-seq
MIRT1257922	hsa-miR-3972	CLIP-seq
MIRT1257923	hsa-miR-4328	CLIP-seq
MIRT1257924	hsa-miR-4464	CLIP-seq
MIRT1257925	hsa-miR-4468	CLIP-seq
MIRT1257926	hsa-miR-4502	CLIP-seq
MIRT1257927	hsa-miR-4540	CLIP-seq
MIRT1257928	hsa-miR-455-5p	CLIP-seq
MIRT1257929	hsa-miR-4652-3p	CLIP-seq
MIRT1257930	hsa-miR-4668-5p	CLIP-seq
MIRT1257931	hsa-miR-4677-3p	CLIP-seq
MIRT1257932	hsa-miR-4679	CLIP-seq
MIRT1257933	hsa-miR-4738-3p	CLIP-seq
MIRT1257934	hsa-miR-4748	CLIP-seq
MIRT1257935	hsa-miR-4771	CLIP-seq
MIRT1257936	hsa-miR-4775	CLIP-seq
MIRT1257937	hsa-miR-4790-3p	CLIP-seq
MIRT1257938	hsa-miR-4797-5p	CLIP-seq
MIRT1257939	hsa-miR-579	CLIP-seq
MIRT1257940	hsa-miR-582-5p	CLIP-seq
MIRT1257941	hsa-miR-587	CLIP-seq
MIRT1257942	hsa-miR-613	CLIP-seq
MIRT1257943	hsa-miR-642b	CLIP-seq
MIRT1257944	hsa-miR-656	CLIP-seq
MIRT1257945	hsa-miR-664	CLIP-seq
MIRT1257946	hsa-miR-944	CLIP-seq
MIRT1257908	hsa-miR-1	CLIP-seq
MIRT1257909	hsa-miR-1202	CLIP-seq
MIRT1257947	hsa-miR-1254	CLIP-seq
MIRT1257948	hsa-miR-1270	CLIP-seq
MIRT1257949	hsa-miR-1323	CLIP-seq
MIRT1257950	hsa-miR-197	CLIP-seq
MIRT1257913	hsa-miR-2052	CLIP-seq
MIRT1257914	hsa-miR-2054	CLIP-seq
MIRT1257915	hsa-miR-206	CLIP-seq
MIRT1257951	hsa-miR-2113	CLIP-seq
MIRT1257952	hsa-miR-218	CLIP-seq
MIRT1257916	hsa-miR-2276	CLIP-seq
MIRT1257953	hsa-miR-3116	CLIP-seq
MIRT1257918	hsa-miR-3120-3p	CLIP-seq
MIRT1257954	hsa-miR-3156-5p	CLIP-seq
MIRT1257955	hsa-miR-3187-3p	CLIP-seq
MIRT1257956	hsa-miR-3199	CLIP-seq
MIRT1257957	hsa-miR-338-5p	CLIP-seq
MIRT1257958	hsa-miR-3613-3p	CLIP-seq
MIRT1257959	hsa-miR-361-3p	CLIP-seq
MIRT1257960	hsa-miR-3664-5p	CLIP-seq
MIRT1257920	hsa-miR-3673	CLIP-seq
MIRT1257921	hsa-miR-3692	CLIP-seq
MIRT1257922	hsa-miR-3972	CLIP-seq
MIRT1257961	hsa-miR-4254	CLIP-seq
MIRT1257962	hsa-miR-4318	CLIP-seq
MIRT1257923	hsa-miR-4328	CLIP-seq
MIRT1257963	hsa-miR-4422	CLIP-seq
MIRT1257964	hsa-miR-4529-5p	CLIP-seq
MIRT1257927	hsa-miR-4540	CLIP-seq
MIRT1257965	hsa-miR-4648	CLIP-seq
MIRT1257966	hsa-miR-4654	CLIP-seq
MIRT1257967	hsa-miR-4683	CLIP-seq
MIRT1257968	hsa-miR-4699-5p	CLIP-seq
MIRT1257969	hsa-miR-4714-5p	CLIP-seq
MIRT1257970	hsa-miR-4769-5p	CLIP-seq
MIRT1257936	hsa-miR-4775	CLIP-seq
MIRT1257937	hsa-miR-4790-3p	CLIP-seq
MIRT1257971	hsa-miR-495	CLIP-seq
MIRT1257972	hsa-miR-520d-5p	CLIP-seq
MIRT1257973	hsa-miR-524-5p	CLIP-seq
MIRT1257974	hsa-miR-548o	CLIP-seq
MIRT1257940	hsa-miR-582-5p	CLIP-seq
MIRT1257941	hsa-miR-587	CLIP-seq
MIRT1257975	hsa-miR-607	CLIP-seq
MIRT1257942	hsa-miR-613	CLIP-seq
MIRT1257976	hsa-miR-620	CLIP-seq
MIRT1257977	hsa-miR-636	CLIP-seq
MIRT1257978	hsa-miR-767-3p	CLIP-seq
MIRT1257979	hsa-miR-888	CLIP-seq
MIRT1257908	hsa-miR-1	CLIP-seq
MIRT2075986	hsa-miR-101	CLIP-seq
MIRT2075987	hsa-miR-1296	CLIP-seq
MIRT2075988	hsa-miR-1321	CLIP-seq
MIRT2075989	hsa-miR-144	CLIP-seq
MIRT1257950	hsa-miR-197	CLIP-seq
MIRT1257911	hsa-miR-19a	CLIP-seq
MIRT1257912	hsa-miR-19b	CLIP-seq
MIRT1257913	hsa-miR-2052	CLIP-seq
MIRT1257914	hsa-miR-2054	CLIP-seq
MIRT1257915	hsa-miR-206	CLIP-seq
MIRT1257916	hsa-miR-2276	CLIP-seq
MIRT2075990	hsa-miR-2682	CLIP-seq
MIRT2075991	hsa-miR-2909	CLIP-seq
MIRT1257918	hsa-miR-3120-3p	CLIP-seq
MIRT2075992	hsa-miR-3126-5p	CLIP-seq
MIRT2075993	hsa-miR-3152-5p	CLIP-seq
MIRT2075994	hsa-miR-3180-5p	CLIP-seq
MIRT1257955	hsa-miR-3187-3p	CLIP-seq
MIRT2075995	hsa-miR-3194-3p	CLIP-seq
MIRT1257956	hsa-miR-3199	CLIP-seq
MIRT2075996	hsa-miR-330-3p	CLIP-seq
MIRT2075997	hsa-miR-34a	CLIP-seq
MIRT2075998	hsa-miR-34c-5p	CLIP-seq
MIRT1257920	hsa-miR-3673	CLIP-seq
MIRT1257921	hsa-miR-3692	CLIP-seq
MIRT2075999	hsa-miR-4292	CLIP-seq
MIRT2076000	hsa-miR-4308	CLIP-seq
MIRT1257962	hsa-miR-4318	CLIP-seq
MIRT1257923	hsa-miR-4328	CLIP-seq
MIRT2076001	hsa-miR-4419a	CLIP-seq
MIRT2076002	hsa-miR-4433	CLIP-seq
MIRT2076003	hsa-miR-4459	CLIP-seq
MIRT2076004	hsa-miR-4461	CLIP-seq
MIRT1257924	hsa-miR-4464	CLIP-seq
MIRT2076005	hsa-miR-4473	CLIP-seq
MIRT2076006	hsa-miR-4477b	CLIP-seq
MIRT2076007	hsa-miR-449a	CLIP-seq
MIRT2076008	hsa-miR-449b	CLIP-seq
MIRT2076009	hsa-miR-449c	CLIP-seq
MIRT1257926	hsa-miR-4502	CLIP-seq
MIRT2076010	hsa-miR-4504	CLIP-seq
MIRT2076011	hsa-miR-4510	CLIP-seq
MIRT1257964	hsa-miR-4529-5p	CLIP-seq
MIRT1257927	hsa-miR-4540	CLIP-seq
MIRT1257928	hsa-miR-455-5p	CLIP-seq
MIRT1257965	hsa-miR-4648	CLIP-seq
MIRT1257966	hsa-miR-4654	CLIP-seq
MIRT2076012	hsa-miR-4728-5p	CLIP-seq
MIRT2076013	hsa-miR-4739	CLIP-seq
MIRT2076014	hsa-miR-4742-3p	CLIP-seq
MIRT1257934	hsa-miR-4748	CLIP-seq
MIRT2076015	hsa-miR-4756-5p	CLIP-seq
MIRT2076016	hsa-miR-4768-3p	CLIP-seq
MIRT1257970	hsa-miR-4769-5p	CLIP-seq
MIRT2076017	hsa-miR-4774-3p	CLIP-seq
MIRT1257936	hsa-miR-4775	CLIP-seq
MIRT1257937	hsa-miR-4790-3p	CLIP-seq
MIRT2076018	hsa-miR-512-3p	CLIP-seq
MIRT2076019	hsa-miR-520a-5p	CLIP-seq
MIRT2076020	hsa-miR-520f	CLIP-seq
MIRT2076021	hsa-miR-525-5p	CLIP-seq
MIRT2076022	hsa-miR-549	CLIP-seq
MIRT1257939	hsa-miR-579	CLIP-seq
MIRT1257942	hsa-miR-613	CLIP-seq
MIRT1257979	hsa-miR-888	CLIP-seq
MIRT1257946	hsa-miR-944	CLIP-seq
MIRT1257951	hsa-miR-2113	CLIP-seq
MIRT2302607	hsa-miR-103a	CLIP-seq
MIRT2302608	hsa-miR-107	CLIP-seq
MIRT2302609	hsa-miR-1301	CLIP-seq
MIRT1257918	hsa-miR-3120-3p	CLIP-seq
MIRT2302610	hsa-miR-3125	CLIP-seq
MIRT2302611	hsa-miR-3129-3p	CLIP-seq
MIRT1257955	hsa-miR-3187-3p	CLIP-seq
MIRT2302612	hsa-miR-3916	CLIP-seq
MIRT2302613	hsa-miR-4302	CLIP-seq
MIRT1257924	hsa-miR-4464	CLIP-seq
MIRT2302614	hsa-miR-4519	CLIP-seq
MIRT1257964	hsa-miR-4529-5p	CLIP-seq
MIRT1257927	hsa-miR-4540	CLIP-seq
MIRT1257934	hsa-miR-4748	CLIP-seq
MIRT2302615	hsa-miR-5047	CLIP-seq
MIRT1257941	hsa-miR-587	CLIP-seq
MIRT2302616	hsa-miR-605	CLIP-seq
MIRT1257918	hsa-miR-3120-3p	CLIP-seq
MIRT1257955	hsa-miR-3187-3p	CLIP-seq
MIRT1257957	hsa-miR-338-5p	CLIP-seq
MIRT1257964	hsa-miR-4529-5p	CLIP-seq
MIRT2302616	hsa-miR-605	CLIP-seq
MIRT1257943	hsa-miR-642b	CLIP-seq

Gene ontology (GO) Show/Hide all (29)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000159	Component	Protein phosphatase type 2A complex	IBA
GO:0000159	Component	Protein phosphatase type 2A complex	IDA	17245430
GO:0000159	Component	Protein phosphatase type 2A complex	IEA
GO:0000159	Component	Protein phosphatase type 2A complex	IMP	21075214
GO:0000775	Component	Chromosome, centromeric region	IEA
GO:0005515	Function	Protein binding	IPI	7592815, 9847399, 15380617, 16097049, 16541025, 17245430, 17540176, 18782753, 21878643, 24157919, 26496610, 27880917, 28330616, 28514442, 30595372, 32296183, 32707033, 32814053, 33961781, 35271311, 37219487
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005694	Component	Chromosome	IEA
GO:0005737	Component	Cytoplasm	IDA	21075214
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	8703017
GO:0005813	Component	Centrosome	IDA	24157919
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IDA	15569306
GO:0007165	Process	Signal transduction	IEA
GO:0019210	Function	Kinase inhibitor activity	IMP	21075214
GO:0019888	Function	Protein phosphatase regulator activity	IDA	24157919
GO:0019888	Function	Protein phosphatase regulator activity	IEA
GO:0019888	Function	Protein phosphatase regulator activity	TAS	8703017
GO:0019900	Function	Kinase binding	IPI	21075214
GO:0030018	Component	Z disc	IDA	19131648
GO:0030018	Component	Z disc	IEA
GO:0031430	Component	M band	IEA
GO:0031430	Component	M band	ISS	18782775
GO:0072542	Function	Protein phosphatase activator activity	IMP	21075214
GO:1903077	Process	Negative regulation of protein localization to plasma membrane	IMP	21075214

Other IDs

• MIM: 601643
• HGNC: 9309
• e!Ensembl: ENSG00000066027

Protein

• UniProt ID: Q15172
• Protein name: Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit alpha isoform (PP2A B subunit isoform B'-alpha) (PP2A B subunit isoform B56-alpha) (PP2A B subunit isoform PR61-alpha) (PR61alpha) (PP2A B subunit isoform R5-alpha)
• Protein function: The B regulatory subunit might modulate substrate selectivity and catalytic activity, and might also direct the localization of the catalytic enzyme to a particular subcellular compartment.
• PDB: 6NTS , 8SZK
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01603	B56	56 → 462	Protein phosphatase 2A regulatory B subunit (B56 family)	Family

• Tissue specificity: TISSUE SPECIFICITY: Widely expressed with the highest expression in heart and skeletal muscle.
• Sequence:

  MSSSSPPAGAASAAISASEKVDGFTRKSVRKAQRQKRSQGSSQFRSQGSQAELHPLPQLK
  DATSNEQQELFCQKLQQCCILFDFMDSVSDLKSKEIKRATLNELVEYVSTNRGVIVESAY
  SDIVKMISANIFRTLPPSDNPDFDPEEDEPTLEASWPHIQLVYEFFLRFLESPDFQPSIA
  KRYIDQKFVQQLLELFDSEDPRERDFLKTVLHRIYGKFLGLRAFIRKQINNIFLRFIYET
  EHFNGVAELLEILGSIINGFALPLKAEHKQFLMKVLIPMHTAKGLALFHAQLAYCVVQFL
  EKDTTLTEPVIRGLLKFWPKTCSQKEVMFLGEIEEILDVIEPTQFKKIEEPLFKQISKCV
  SSSHFQVAERALYFWNNEYILSLIEENIDKILPIMFASLYKISKEHWNPTIVALVYNVLK
  TLMEMNGKLFDDLTSSYKAERQREKKKELEREELWKKLEELKLKKALEKQNSAYNMHSIL
  SNTSAE

• Sequence length: 486

Pathways

KEGG Pathway	Reactome Pathway
mRNA surveillance pathway	Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal
Sphingolipid signaling pathway	Degradation of beta-catenin by the destruction complex
Cell cycle	Beta-catenin phosphorylation cascade
Oocyte meiosis	Separation of Sister Chromatids
PI3K-Akt signaling pathway	Resolution of Sister Chromatid Cohesion
AMPK signaling pathway	CTLA4 inhibitory signaling
Adrenergic signaling in cardiomyocytes	Platelet sensitization by LDL
T cell receptor signaling pathway	Disassembly of the destruction complex and recruitment of AXIN to the membrane
Dopaminergic synapse	Misspliced GSK3beta mutants stabilize beta-catenin
Human papillomavirus infection	S33 mutants of beta-catenin aren't phosphorylated
	S37 mutants of beta-catenin aren't phosphorylated
	S45 mutants of beta-catenin aren't phosphorylated
	T41 mutants of beta-catenin aren't phosphorylated
	APC truncation mutants have impaired AXIN binding
	AXIN missense mutants destabilize the destruction complex
	Truncations of AMER1 destabilize the destruction complex
	RHO GTPases Activate Formins
	RAF activation
	Negative regulation of MAPK pathway
	PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling
	Mitotic Prometaphase
	EML4 and NUDC in mitotic spindle formation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
EMPHYSEMA	—	CTD	22223484	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MACULAR TELANGIECTASIA TYPE 2	—	GWAS catalog	33654266	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (12)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Arrhythmias Cardiac	Cardiac arrhythmias	Pubtator	33014188	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	32188705	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Merkel Cell	Merkel cell carcinoma	Pubtator	25631078	Inhibit	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	33014188	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	36455198	Associate	★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	28849187		★☆☆☆☆ Found in Text Mining only
Liver Failure, Acute	Liver failure	BEFREE	26986512		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	28849187		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	29175459		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	21822300	Inhibit	★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	28849187	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	29175459		★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

PPP2R5E 30 shared pathwaysmRNA surveillance pathway, Sphingolipid signaling pathway, Cell cycle, Oocyte meiosis, AMPK signaling pathway, Adrenergic signaling in cardiomyocytes, T cell receptor signaling pathway, Dopaminergic synapse, CTLA4 inhibitory signaling, Beta-catenin phosphorylation cascade, Disassembly of the destruction complex and recruitment of AXIN to the membrane, Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal +18 more Related via 30 shared pathways including mRNA surveillance pathway, Sphingolipid signaling pathway. PPP2R5B 30 shared pathwaysmRNA surveillance pathway, Sphingolipid signaling pathway, Cell cycle, Oocyte meiosis, AMPK signaling pathway, Adrenergic signaling in cardiomyocytes, T cell receptor signaling pathway, Dopaminergic synapse, CTLA4 inhibitory signaling, Beta-catenin phosphorylation cascade, Disassembly of the destruction complex and recruitment of AXIN to the membrane, Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal +18 more Related via 30 shared pathways including mRNA surveillance pathway, Sphingolipid signaling pathway. PPP2R5C 30 shared pathwaysmRNA surveillance pathway, Sphingolipid signaling pathway, Cell cycle, Oocyte meiosis, AMPK signaling pathway, Adrenergic signaling in cardiomyocytes, T cell receptor signaling pathway, Dopaminergic synapse, CTLA4 inhibitory signaling, Beta-catenin phosphorylation cascade, Disassembly of the destruction complex and recruitment of AXIN to the membrane, Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal +18 more Related via 30 shared pathways including mRNA surveillance pathway, Sphingolipid signaling pathway. PPP2R5D 30 shared pathwaysmRNA surveillance pathway, Sphingolipid signaling pathway, Cell cycle, Oocyte meiosis, AMPK signaling pathway, Adrenergic signaling in cardiomyocytes, T cell receptor signaling pathway, Dopaminergic synapse, CTLA4 inhibitory signaling, Beta-catenin phosphorylation cascade, Disassembly of the destruction complex and recruitment of AXIN to the membrane, Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal +18 more Related via 30 shared pathways including mRNA surveillance pathway, Sphingolipid signaling pathway. PPP2R1B 30 shared pathwaysmRNA surveillance pathway, Sphingolipid signaling pathway, Cell cycle, Oocyte meiosis, AMPK signaling pathway, Adrenergic signaling in cardiomyocytes, T cell receptor signaling pathway, Dopaminergic synapse, CTLA4 inhibitory signaling, Beta-catenin phosphorylation cascade, Disassembly of the destruction complex and recruitment of AXIN to the membrane, Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal +18 more Related via 30 shared pathways including mRNA surveillance pathway, Sphingolipid signaling pathway.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
PPP2R5E	0	[]	30	["mRNA surveillance pathway","Sphingolipid signaling pathway","Cell cycle","Oocyte meiosis","AMPK signaling pathway","Adrenergic signaling in cardiomyocytes","T cell receptor signaling pathway","Dopaminergic synapse","CTLA4 inhibitory signaling","Beta-catenin phosphorylation cascade","Disassembly of the destruction complex and recruitment of AXIN to the membrane","Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal"]	0	[]
PPP2R5B	0	[]	30	["mRNA surveillance pathway","Sphingolipid signaling pathway","Cell cycle","Oocyte meiosis","AMPK signaling pathway","Adrenergic signaling in cardiomyocytes","T cell receptor signaling pathway","Dopaminergic synapse","CTLA4 inhibitory signaling","Beta-catenin phosphorylation cascade","Disassembly of the destruction complex and recruitment of AXIN to the membrane","Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal"]	0	[]
PPP2R5C	0	[]	30	["mRNA surveillance pathway","Sphingolipid signaling pathway","Cell cycle","Oocyte meiosis","AMPK signaling pathway","Adrenergic signaling in cardiomyocytes","T cell receptor signaling pathway","Dopaminergic synapse","CTLA4 inhibitory signaling","Beta-catenin phosphorylation cascade","Disassembly of the destruction complex and recruitment of AXIN to the membrane","Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal"]	0	[]
PPP2R5D	0	[]	30	["mRNA surveillance pathway","Sphingolipid signaling pathway","Cell cycle","Oocyte meiosis","AMPK signaling pathway","Adrenergic signaling in cardiomyocytes","T cell receptor signaling pathway","Dopaminergic synapse","CTLA4 inhibitory signaling","Beta-catenin phosphorylation cascade","Disassembly of the destruction complex and recruitment of AXIN to the membrane","Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal"]	0	[]
PPP2R1B	0	[]	30	["mRNA surveillance pathway","Sphingolipid signaling pathway","Cell cycle","Oocyte meiosis","AMPK signaling pathway","Adrenergic signaling in cardiomyocytes","T cell receptor signaling pathway","Dopaminergic synapse","CTLA4 inhibitory signaling","Beta-catenin phosphorylation cascade","Disassembly of the destruction complex and recruitment of AXIN to the membrane","Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal"]	0	[]

Diseases Linked via Similar Genes

Chromosomal instability Linked via 2 of 5 related genesPPP2R5E, PPP2R5C Neurodevelopmental disorder Linked via 2 of 5 related genesPPP2R5C, PPP2R5D Global developmental delay Linked via 2 of 5 related genesPPP2R5C, PPP2R5D Houge janssens syndrome Linked via 2 of 5 related genesPPP2R5C, PPP2R5D Intellectual developmental disorder Linked via 2 of 5 related genesPPP2R5C, PPP2R5D

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Chromosomal instability	2	["PPP2R5E","PPP2R5C"]
Neurodevelopmental disorder	2	["PPP2R5C","PPP2R5D"]
Global developmental delay	2	["PPP2R5C","PPP2R5D"]
Houge janssens syndrome	2	["PPP2R5C","PPP2R5D"]
Intellectual developmental disorder	2	["PPP2R5C","PPP2R5D"]