PPP1R9A (protein phosphatase 1 regulatory subunit 9A)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 55607
• Gene name: Protein phosphatase 1 regulatory subunit 9A
• Gene symbol: PPP1R9A
• Synonyms (NCBI Gene): NRB1, NRBI, Neurabin-I
• Chromosome: 7
• Chromosome location: 7q21.3
• Summary: This gene is imprinted, and located in a cluster of imprinted genes on chromosome 7q12. This gene is transcribed in both neuronal and multiple embryonic tissues, and it is maternally expressed mainly in embryonic skeletal muscle tissues and biallelically

miRNA Show/Hide all (165)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018967	hsa-miR-335-5p	Microarray	18185580
MIRT020286	hsa-miR-130b-3p	Sequencing	20371350
MIRT028245	hsa-miR-33a-5p	Sequencing	20371350
MIRT047338	hsa-miR-181a-5p	CLASH	23622248
MIRT450336	hsa-miR-3121-3p	PAR-CLIP	22100165
MIRT450336	hsa-miR-3121-3p	PAR-CLIP	22100165
MIRT1257012	hsa-miR-1253	CLIP-seq
MIRT1257013	hsa-miR-1305	CLIP-seq
MIRT1257014	hsa-miR-2114	CLIP-seq
MIRT1257015	hsa-miR-3128	CLIP-seq
MIRT1257016	hsa-miR-3129-3p	CLIP-seq
MIRT1257017	hsa-miR-3147	CLIP-seq
MIRT1257018	hsa-miR-3664-5p	CLIP-seq
MIRT1257019	hsa-miR-3689a-3p	CLIP-seq
MIRT1257020	hsa-miR-3689c	CLIP-seq
MIRT1257021	hsa-miR-4425	CLIP-seq
MIRT1257022	hsa-miR-4714-5p	CLIP-seq
MIRT1257023	hsa-miR-4720-5p	CLIP-seq
MIRT1257024	hsa-miR-4728-5p	CLIP-seq
MIRT1257025	hsa-miR-4747-5p	CLIP-seq
MIRT1257026	hsa-miR-4799-3p	CLIP-seq
MIRT1257027	hsa-miR-498	CLIP-seq
MIRT1257028	hsa-miR-513a-3p	CLIP-seq
MIRT1257029	hsa-miR-548p	CLIP-seq
MIRT1257030	hsa-miR-890	CLIP-seq
MIRT1257013	hsa-miR-1305	CLIP-seq
MIRT1257031	hsa-miR-149	CLIP-seq
MIRT1257032	hsa-miR-1912	CLIP-seq
MIRT1257033	hsa-miR-216b	CLIP-seq
MIRT1257034	hsa-miR-3064-5p	CLIP-seq
MIRT1257035	hsa-miR-3126-3p	CLIP-seq
MIRT1257036	hsa-miR-3127-5p	CLIP-seq
MIRT1257017	hsa-miR-3147	CLIP-seq
MIRT1257037	hsa-miR-3148	CLIP-seq
MIRT1257038	hsa-miR-3153	CLIP-seq
MIRT1257039	hsa-miR-3671	CLIP-seq
MIRT1257019	hsa-miR-3689a-3p	CLIP-seq
MIRT1257020	hsa-miR-3689c	CLIP-seq
MIRT1257040	hsa-miR-3689d	CLIP-seq
MIRT1257041	hsa-miR-3918	CLIP-seq
MIRT1257021	hsa-miR-4425	CLIP-seq
MIRT1257042	hsa-miR-4446-3p	CLIP-seq
MIRT1257043	hsa-miR-4506	CLIP-seq
MIRT1257044	hsa-miR-4668-5p	CLIP-seq
MIRT1257045	hsa-miR-4694-5p	CLIP-seq
MIRT1257046	hsa-miR-4698	CLIP-seq
MIRT1257024	hsa-miR-4728-5p	CLIP-seq
MIRT1257047	hsa-miR-4731-5p	CLIP-seq
MIRT1257048	hsa-miR-4732-3p	CLIP-seq
MIRT1257049	hsa-miR-4794	CLIP-seq
MIRT1257050	hsa-miR-486-3p	CLIP-seq
MIRT1257051	hsa-miR-516a-3p	CLIP-seq
MIRT1257052	hsa-miR-548aa	CLIP-seq
MIRT1257053	hsa-miR-548ac	CLIP-seq
MIRT1257054	hsa-miR-548d-3p	CLIP-seq
MIRT1257055	hsa-miR-548z	CLIP-seq
MIRT1257056	hsa-miR-556-3p	CLIP-seq
MIRT1257057	hsa-miR-607	CLIP-seq
MIRT1257058	hsa-miR-1293	CLIP-seq
MIRT1257059	hsa-miR-139-5p	CLIP-seq
MIRT1257032	hsa-miR-1912	CLIP-seq
MIRT1257060	hsa-miR-2355-5p	CLIP-seq
MIRT1257061	hsa-miR-2681	CLIP-seq
MIRT1257062	hsa-miR-2682	CLIP-seq
MIRT1257063	hsa-miR-3125	CLIP-seq
MIRT1257015	hsa-miR-3128	CLIP-seq
MIRT1257064	hsa-miR-3130-5p	CLIP-seq
MIRT1257065	hsa-miR-3140-3p	CLIP-seq
MIRT1257038	hsa-miR-3153	CLIP-seq
MIRT1257066	hsa-miR-3647-3p	CLIP-seq
MIRT1257067	hsa-miR-3652	CLIP-seq
MIRT1257018	hsa-miR-3664-5p	CLIP-seq
MIRT1257068	hsa-miR-3916	CLIP-seq
MIRT1257069	hsa-miR-3925-5p	CLIP-seq
MIRT1257070	hsa-miR-3929	CLIP-seq
MIRT1257071	hsa-miR-4419b	CLIP-seq
MIRT1257072	hsa-miR-4430	CLIP-seq
MIRT1257073	hsa-miR-4433	CLIP-seq
MIRT1257074	hsa-miR-4459	CLIP-seq
MIRT1257075	hsa-miR-4478	CLIP-seq
MIRT1257076	hsa-miR-4482	CLIP-seq
MIRT1257077	hsa-miR-4483	CLIP-seq
MIRT1257078	hsa-miR-4496	CLIP-seq
MIRT1257079	hsa-miR-449c	CLIP-seq
MIRT1257080	hsa-miR-4504	CLIP-seq
MIRT1257081	hsa-miR-4505	CLIP-seq
MIRT1257043	hsa-miR-4506	CLIP-seq
MIRT1257082	hsa-miR-4651	CLIP-seq
MIRT1257044	hsa-miR-4668-5p	CLIP-seq
MIRT1257022	hsa-miR-4714-5p	CLIP-seq
MIRT1257023	hsa-miR-4720-5p	CLIP-seq
MIRT1257047	hsa-miR-4731-5p	CLIP-seq
MIRT1257048	hsa-miR-4732-3p	CLIP-seq
MIRT1257083	hsa-miR-4768-3p	CLIP-seq
MIRT1257026	hsa-miR-4799-3p	CLIP-seq
MIRT1257084	hsa-miR-542-3p	CLIP-seq
MIRT1257085	hsa-miR-608	CLIP-seq
MIRT1257086	hsa-miR-637	CLIP-seq
MIRT1257087	hsa-miR-647	CLIP-seq
MIRT1257088	hsa-miR-665	CLIP-seq
MIRT1257089	hsa-miR-758	CLIP-seq
MIRT1257090	hsa-miR-940	CLIP-seq
MIRT1257013	hsa-miR-1305	CLIP-seq
MIRT2075696	hsa-miR-136	CLIP-seq
MIRT2075697	hsa-miR-3185	CLIP-seq
MIRT2075698	hsa-miR-3607-3p	CLIP-seq
MIRT1257039	hsa-miR-3671	CLIP-seq
MIRT2075699	hsa-miR-3686	CLIP-seq
MIRT2075700	hsa-miR-409-3p	CLIP-seq
MIRT2075701	hsa-miR-432	CLIP-seq
MIRT2075702	hsa-miR-4328	CLIP-seq
MIRT1257078	hsa-miR-4496	CLIP-seq
MIRT2075703	hsa-miR-4709-3p	CLIP-seq
MIRT2075704	hsa-miR-4712-5p	CLIP-seq
MIRT1257083	hsa-miR-4768-3p	CLIP-seq
MIRT1257052	hsa-miR-548aa	CLIP-seq
MIRT2075705	hsa-miR-570	CLIP-seq
MIRT1257057	hsa-miR-607	CLIP-seq
MIRT2075706	hsa-miR-653	CLIP-seq
MIRT1257088	hsa-miR-665	CLIP-seq
MIRT2075707	hsa-miR-770-5p	CLIP-seq
MIRT2302299	hsa-miR-1200	CLIP-seq
MIRT2302300	hsa-miR-3168	CLIP-seq
MIRT2302301	hsa-miR-515-5p	CLIP-seq
MIRT2302302	hsa-miR-1207-5p	CLIP-seq
MIRT2302303	hsa-miR-1304	CLIP-seq
MIRT1257032	hsa-miR-1912	CLIP-seq
MIRT2302304	hsa-miR-2467-5p	CLIP-seq
MIRT1257038	hsa-miR-3153	CLIP-seq
MIRT2075697	hsa-miR-3185	CLIP-seq
MIRT2302305	hsa-miR-3188	CLIP-seq
MIRT2302306	hsa-miR-3617	CLIP-seq
MIRT2302307	hsa-miR-3907	CLIP-seq
MIRT2302308	hsa-miR-3975	CLIP-seq
MIRT2075700	hsa-miR-409-3p	CLIP-seq
MIRT1257073	hsa-miR-4433	CLIP-seq
MIRT1257043	hsa-miR-4506	CLIP-seq
MIRT1257044	hsa-miR-4668-5p	CLIP-seq
MIRT2075703	hsa-miR-4709-3p	CLIP-seq
MIRT1257048	hsa-miR-4732-3p	CLIP-seq
MIRT2302309	hsa-miR-4736	CLIP-seq
MIRT2302310	hsa-miR-4763-3p	CLIP-seq
MIRT2302311	hsa-miR-485-5p	CLIP-seq
MIRT2075705	hsa-miR-570	CLIP-seq
MIRT2302312	hsa-miR-641	CLIP-seq
MIRT2075706	hsa-miR-653	CLIP-seq
MIRT1257088	hsa-miR-665	CLIP-seq
MIRT1257032	hsa-miR-1912	CLIP-seq
MIRT1257038	hsa-miR-3153	CLIP-seq
MIRT1257043	hsa-miR-4506	CLIP-seq
MIRT1257044	hsa-miR-4668-5p	CLIP-seq
MIRT1257048	hsa-miR-4732-3p	CLIP-seq
MIRT2599071	hsa-miR-128	CLIP-seq
MIRT2599072	hsa-miR-155	CLIP-seq
MIRT2599073	hsa-miR-338-5p	CLIP-seq
MIRT2599074	hsa-miR-365	CLIP-seq
MIRT2599075	hsa-miR-4457	CLIP-seq
MIRT2599076	hsa-miR-4480	CLIP-seq
MIRT2599077	hsa-miR-4731-3p	CLIP-seq
MIRT2599078	hsa-miR-4801	CLIP-seq
MIRT2599079	hsa-miR-513b	CLIP-seq
MIRT2599080	hsa-miR-587	CLIP-seq
MIRT2599071	hsa-miR-128	CLIP-seq
MIRT2599075	hsa-miR-4457	CLIP-seq
MIRT2599079	hsa-miR-513b	CLIP-seq

Gene ontology (GO) Show/Hide all (23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003779	Function	Actin binding	IEA
GO:0005515	Function	Protein binding	IPI	17464283
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0007015	Process	Actin filament organization	IBA
GO:0007015	Process	Actin filament organization	IEA
GO:0007399	Process	Nervous system development	IEA
GO:0014069	Component	Postsynaptic density	IBA
GO:0015629	Component	Actin cytoskeleton	IBA
GO:0019722	Process	Calcium-mediated signaling	IBA
GO:0019722	Process	Calcium-mediated signaling	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0030175	Component	Filopodium	IEA
GO:0030425	Component	Dendrite	IBA
GO:0030864	Component	Cortical actin cytoskeleton	IEA
GO:0031175	Process	Neuron projection development	IBA
GO:0043005	Component	Neuron projection	IEA
GO:0043197	Component	Dendritic spine	IEA
GO:0045202	Component	Synapse	IEA
GO:0050804	Process	Modulation of chemical synaptic transmission	IEA
GO:0051015	Function	Actin filament binding	IBA
GO:0120025	Component	Plasma membrane bounded cell projection	IEA

Other IDs

• MIM: 602468
• HGNC: 14946
• e!Ensembl: ENSG00000158528

Protein

• UniProt ID: Q9ULJ8
• Protein name: Neurabin-1 (Neurabin-I) (Neural tissue-specific F-actin-binding protein I) (Protein phosphatase 1 regulatory subunit 9A)
• Protein function: Binds to actin filaments (F-actin) and shows cross-linking activity. Binds along the sides of the F-actin. May be involved in neurite formation. Inhibits protein phosphatase 1-alpha activity (By similarity).
• PDB: 1WF8
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00595	PDZ	504 → 589	PDZ domain	Domain
  PF07647	SAM_2	985 → 1049	SAM domain (Sterile alpha motif)	Domain
  PF17817	PDZ_5	434 → 497	PDZ domain	Domain

• Sequence:

  MLKTESSGERTTLRSASPHRNAYRTEFQALKSTFDKPKSDGEQKTKEGEGSQQSRGRKYG
  SNVNRIKNLFMQMGMEPNENAAVIAKTRGKGGHSSPQRRMKPKEFLEKTDGSVVKLESSV
  SERISRFDTMYDGPSYSKFTETRKMFERSVHESGQNNRYSPKKEKAGGSEPQDEWGGSKS
  NRGSTDSLDSLSSRTEAVSPTVSQLSAVFENTDSPSAIISEKAENNEYSVTGHYPLNLPS
  VTVTNLDTFGHLKDSNSWPPSNKRGVDTEDAHKSNATPVPEVASKSTSLASIPGEEIQQS
  KEPEDSTSNQQTPDSIDKDGPEEPCAESKAMPKSEIPSPQSQLLEDAEANLVGREAAKQQ
  RKELAGGDFTSPDASASSCGKEVPEDSNNFDGSHVYMHSDYNVYRVRSRYNSDWGETGTE
  QDEEEDSDENSYYQPDMEYSEIVGLPEEEEIPANRKIKFSSAPIKVFNTYSNEDYDRRND
  EVDPVAASAEYELEKRVEKLELFPVELEKDEDGLGISIIGMGVGADAGLEKLGIFVKTVT
  EGGAAQRDGRIQVNDQIVEVDGISLVGVTQNFAATVLRNTKGNVRFVIGREKPGQVSEVA
  QLISQTLEQERRQRELLEQHYAQYDADDDETGEYATDEEEDEVGPVLPGSDMAIEVFELP
  ENEDMFSPSELDTSKLSHKFKELQIKHAVTEAEIQKLKTKLQAAENEKVRWELEKTQLQQ
  NIEENKERMLKLESYWIEAQTLCHTVNEHLKETQSQYQALEKKYNKAKKLIKDFQQKELD
  FIKRQEAERKKIEDLEKAHLVEVQGLQVRIRDLEAEVFRLLKQNGTQVNNNNNIFERRTS
  LGEVSKGDTMENLDGKQTSCQDGLSQDLNEAVPETERLDSKALKTRAQLSVKNRRQRPSR
  TRLYDSVSSTDGEDSLERKNFTFNDDFSPSSTSSADLSGLGAEPKTPGLSQSLALSSDES
  LDMIDDEILDDGQSPKHSQCQNRAVQEWSVQQVSHWLMSLNLEQYVSEFSAQNITGEQLL
  QLDGNKLKALGMTASQDRAVVKKKLKEMKMSLEKARKAQEKMEKQREKLRRKEQEQMQRK
  SKKTEKMTSTTAEGAGEQ

• Sequence length: 1098

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (15)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Acute myeloid leukemia	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	35915156	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	GWAS catalog	40262193	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	35835914	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEONECROSIS	—	GWAS catalog	26265699	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PPP1R9A-related disorder	Benign; Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	38538606	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	38538606	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHIATRIC DISORDER	—	GWAS catalog	38469033	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (7)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Bipolar Disorder	Bipolar Disorder	BEFREE	25757715		★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	27363808	Associate	★☆☆☆☆ Found in Text Mining only
Neurodevelopmental Disorders	Neurodevelopmental Disorders	BEFREE	27363808		★☆☆☆☆ Found in Text Mining only
Primary central nervous system lymphoma	Central Nervous System Lymphoma	BEFREE	30249786		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	24513574	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	25757715		★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	26810418	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

HIVEP3 2 shared diseasesOsteonecrosis, Psychiatric disorders 2 shared evidence sourcesGWAS catalog (Osteonecrosis), GWAS catalog (Psychiatric disorders) Related via 2 shared diseases including Osteonecrosis, Psychiatric disorders — evidence mostly GWAS catalog. KCNG2 1 shared diseasePsychiatric disorders 2 shared evidence sourcesGWAS catalog (Endometriosis), GWAS catalog (Psychiatric disorders) Related via 1 shared disease including Psychiatric disorders — evidence mostly GWAS catalog. LRFN5 2 shared diseasesOsteonecrosis, Psychiatric disorders 2 shared evidence sourcesGWAS catalog (Osteonecrosis), GWAS catalog (Psychiatric disorders) Related via 2 shared diseases including Osteonecrosis, Psychiatric disorders — evidence mostly GWAS catalog. TSPAN9 1 shared diseasePsychiatric disorders 2 shared evidence sourcesGWAS catalog (Endometriosis), GWAS catalog (Psychiatric disorders) Related via 1 shared disease including Psychiatric disorders — evidence mostly GWAS catalog. RABGAP1L 1 shared diseasePsychiatric disorders 2 shared evidence sourcesGWAS catalog (Endometriosis), GWAS catalog (Psychiatric disorders) Related via 1 shared disease including Psychiatric disorders — evidence mostly GWAS catalog.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
HIVEP3	2	["Osteonecrosis","Psychiatric disorders"]	0	[]	2	["GWAS catalog (Osteonecrosis)","GWAS catalog (Psychiatric disorders)"]
KCNG2	1	["Psychiatric disorders"]	0	[]	2	["GWAS catalog (Endometriosis)","GWAS catalog (Psychiatric disorders)"]
LRFN5	2	["Osteonecrosis","Psychiatric disorders"]	0	[]	2	["GWAS catalog (Osteonecrosis)","GWAS catalog (Psychiatric disorders)"]
TSPAN9	1	["Psychiatric disorders"]	0	[]	2	["GWAS catalog (Endometriosis)","GWAS catalog (Psychiatric disorders)"]
RABGAP1L	1	["Psychiatric disorders"]	0	[]	2	["GWAS catalog (Endometriosis)","GWAS catalog (Psychiatric disorders)"]

Diseases Linked via Similar Genes

Major depressive disorder Linked via 4 of 5 related genesKCNG2, LRFN5, TSPAN9, RABGAP1L Metabolic syndrome Linked via 3 of 5 related genesHIVEP3, LRFN5, RABGAP1L Diabetes mellitus type 2 Linked via 3 of 5 related genesHIVEP3, LRFN5, RABGAP1L Neurotic disorder Linked via 3 of 5 related genesKCNG2, LRFN5, RABGAP1L Schizophrenia Linked via 3 of 5 related genesKCNG2, LRFN5, RABGAP1L

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Major depressive disorder	4	["KCNG2","LRFN5","TSPAN9","RABGAP1L"]
Metabolic syndrome	3	["HIVEP3","LRFN5","RABGAP1L"]
Diabetes mellitus type 2	3	["HIVEP3","LRFN5","RABGAP1L"]
Neurotic disorder	3	["KCNG2","LRFN5","RABGAP1L"]
Schizophrenia	3	["KCNG2","LRFN5","RABGAP1L"]