Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	145581
Gene name	Leucine rich repeat and fibronectin type III domain containing 5
Gene symbol	LRFN5
Synonyms (NCBI Gene)	C14orf146FIGLER8SALM5
Chromosome	14
Chromosome location	14q21.1
Summary	This gene encodes a protein that belongs to the leucine-rich repeat and fibronectin type III domain-containing family of proteins. A similar protein in mouse, a glycosylated transmembrane protein, is thought to function in presynaptic differentiation. [pr

33 Show/Hide all (33)

miRTarBase ID	miRNA	Experiments
MIRT1117556	hsa-miR-4282	CLIP-seq
MIRT1117557	hsa-miR-4717-5p	CLIP-seq
MIRT2033201	hsa-miR-106a	CLIP-seq
MIRT2033202	hsa-miR-106b	CLIP-seq
MIRT2033203	hsa-miR-1193	CLIP-seq
MIRT2033204	hsa-miR-139-5p	CLIP-seq
MIRT2033205	hsa-miR-17	CLIP-seq
MIRT2033206	hsa-miR-20a	CLIP-seq
MIRT2033207	hsa-miR-20b	CLIP-seq
MIRT2033208	hsa-miR-2681	CLIP-seq
MIRT2033209	hsa-miR-3065-5p	CLIP-seq
MIRT2033210	hsa-miR-3609	CLIP-seq
MIRT2033211	hsa-miR-3689a-5p	CLIP-seq
MIRT2033212	hsa-miR-3689b	CLIP-seq
MIRT2033213	hsa-miR-3689e	CLIP-seq
MIRT2033214	hsa-miR-3689f	CLIP-seq
MIRT2033215	hsa-miR-421	CLIP-seq
MIRT2033216	hsa-miR-4272	CLIP-seq
MIRT1117556	hsa-miR-4282	CLIP-seq
MIRT2033217	hsa-miR-4426	CLIP-seq
MIRT2033218	hsa-miR-4647	CLIP-seq
MIRT2033219	hsa-miR-4659a-3p	CLIP-seq
MIRT2033220	hsa-miR-4659b-3p	CLIP-seq
MIRT2033221	hsa-miR-4662b	CLIP-seq
MIRT1117557	hsa-miR-4717-5p	CLIP-seq
MIRT2033222	hsa-miR-4796-3p	CLIP-seq
MIRT2033223	hsa-miR-490-5p	CLIP-seq
MIRT2033224	hsa-miR-5096	CLIP-seq
MIRT2033225	hsa-miR-519d	CLIP-seq
MIRT2033226	hsa-miR-548ah	CLIP-seq
MIRT2033227	hsa-miR-622	CLIP-seq
MIRT2033228	hsa-miR-659	CLIP-seq
MIRT2033229	hsa-miR-93	CLIP-seq

17 Show/Hide all (17)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	27152329
GO:0009986	Component	Cell surface	IBA
GO:0009986	Component	Cell surface	IEA
GO:0016020	Component	Membrane	IEA
GO:0043031	Process	Negative regulation of macrophage activation	IEA
GO:0043031	Process	Negative regulation of macrophage activation	ISS
GO:0050728	Process	Negative regulation of inflammatory response	IDA	27152329
GO:0098839	Component	Postsynaptic density membrane	IBA
GO:0098839	Component	Postsynaptic density membrane	IEA
GO:0098978	Component	Glutamatergic synapse	IBA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0098982	Component	GABA-ergic synapse	IBA
GO:0098982	Component	GABA-ergic synapse	IEA
GO:0099560	Process	Synaptic membrane adhesion	IBA
GO:0099560	Process	Synaptic membrane adhesion	IEA
GO:1905606	Process	Regulation of presynapse assembly	IBA
GO:1905606	Process	Regulation of presynapse assembly	IEA

MIM	HGNC	e!Ensembl
612811	20360	ENSG00000165379

Q96NI6

Protein name

Leucine-rich repeat and fibronectin type-III domain-containing protein 5

Protein function

Cell adhesion molecule that mediates homophilic cell-cell adhesion in a Ca(2+)-independent manner. Promotes neurite outgrowth in hippocampal neurons.

PDB

5XNP , 5XNQ , 5XWS , 5XWT

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07679	I-set	287 → 374	Immunoglobulin I-set domain	Domain
PF13306	LRR_5	56 → 213	BspA type Leucine rich repeat region (6 copies)	Repeat

Sequence

MEKILFYLFLIGIAVKAQICPKRCVCQILSPNLATLCAKKGLLFVPPNIDRRTVELRLAD
NFVTNIKRKDFANMTSLVDLTLSRNTISFITPHAFADLRNLRALHLNSNRLTKITNDMFS
GLSNLHHLILNNNQLTLISSTAFDDVFALEELDLSYNNLETIPWDAVEKMVSLHTLSLDH
NMIDNIPKGTFSHLHKMTRLDVTSNKLQKLPPDPLFQRAQVLATSGIISPSTFALSFGGN
PLHCNCELLWLRRLSREDDLETCASPPLLTGRYFWSIPEEEFLCEPPLITRHTHEMRVLE
GQRATLRCKARGDPEPAIHWISPEGKLISNATRSLVYDNGTLDILITTVKDTGAFTCIAS
NPAGEATQIVDLHIIKLPHLLNSTNHIHEPDPGSSDISTSTKSGSNTSSSNGDTKLSQDK
IVVAEATSSTALLKFNFQRNIPGIRMFQIQYNGTYDDTLVYRMIPPTSKTFLVNNLAAGT
MYDLCVLAIYDDGITSLTATRVVGCIQFTTEQDYVRCHFMQSQFLGGTMIIIIGGIIVAS
VLVFIIILMIRYKVCNNNGQHKVTKVSNVYSQTNGAQIQGCSVTLPQSVSKQAVGHEENA
QCCKATSDNVIQSSETCSSQDSSTTTSALPPSWTSSTSVSQKQKRKTGTKPSTEPQNEAV
TNVESQNTNRNNSTALQLASRPPDSVTEGPTSKRAHIKPNALLTNVDQIVQETQRLELI

Sequence length

719

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (28)
ANOREXIA NERVOSA	—	GWAS catalog	31835028, 36137488	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANXIETY DISORDER	—	GWAS catalog	39024449, 39294497	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	31835028	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	31835028	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	31835028	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	36810956	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CERVICAL CANCER	—	GWAS catalog	31488892	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CERVICAL CARCINOMA	—	GWAS catalog	31488892	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	34794066	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GENERALIZED ANXIETY DISORDER	—	GWAS catalog	35181757	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	36810956	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	35835914	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IRRITABLE BOWEL SYNDROME	—	GWAS catalog	36753304, 37085903	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LRFN5-related disorder	Benign; Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	29662059, 29700475, 30643256, 31835028, 33479212, 34045744, 34586374, 34634379, 36753304, 41233554	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL OR BEHAVIOURAL DISORDER	—	GWAS catalog	39024449	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	39349817	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIGRAINE DISORDER	—	GWAS catalog	35115687	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROTIC DISORDER	—	GWAS catalog	30643256	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	36137488	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBSESSIVE-COMPULSIVE DISORDER	—	GWAS catalog	31835028, 36137488	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEONECROSIS	—	GWAS catalog	36651668	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POST-TRAUMATIC STRESS DISORDER	—	GWAS catalog	35181757, 38637617	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHIATRIC DISORDER	—	GWAS catalog	38469033	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	31835028	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TOURETTE SYNDROME	—	GWAS catalog	31835028	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	39349817	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (9)
Autism Spectrum Disorder	Autism	Pubtator	31152157	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	31152157		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	21736948, 29348579		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	25690665, 31748543		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	GWASCAT_DG	29662059, 29700475		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myopia	Myopia	GWASCAT_DG	27182965		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pervasive Development Disorder	Autism spectrum disorder	BEFREE	31152157		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	35578189	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	25690665, 31748543		★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
SORCS3	7	["Anorexia nervosa","Anxiety disorder","Tourette syndrome","Irritable bowel syndrome","Obsessive-compulsive disorder","Post-traumatic stress disorder","Psychiatric disorders"]	[]	7	["GWAS catalog (Anorexia nervosa)","GWAS catalog (Anxiety disorder)","GWAS catalog (Irritable bowel syndrome)","GWAS catalog (Obsessive-compulsive disorder)","GWAS catalog (Post-traumatic stress disorder)","GWAS catalog (Psychiatric disorders)","GWAS catalog (Tourette syndrome)"]
IGSF9B	5	["Anorexia nervosa","Anxiety disorder","Generalized anxiety disorder","Tourette syndrome","Obsessive-compulsive disorder"]	[]	5	["GWAS catalog (Anorexia nervosa)","GWAS catalog (Anxiety disorder)","GWAS catalog (Generalized anxiety disorder)","GWAS catalog (Obsessive-compulsive disorder)","GWAS catalog (Tourette syndrome)"]
ANKS1B	5	["Anorexia nervosa","Generalized anxiety disorder","Tourette syndrome","Obsessive-compulsive disorder","Psychiatric disorders"]	[]	5	["GWAS catalog (Anorexia nervosa)","GWAS catalog (Generalized anxiety disorder)","GWAS catalog (Obsessive-compulsive disorder)","GWAS catalog (Psychiatric disorders)","GWAS catalog (Tourette syndrome)"]
FAM120A	5	["Anorexia nervosa","Generalized anxiety disorder","Tourette syndrome","Irritable bowel syndrome","Post-traumatic stress disorder"]	[]	4	["GWAS catalog (Anorexia nervosa)","GWAS catalog (Generalized anxiety disorder)","GWAS catalog (Irritable bowel syndrome)","GWAS catalog (Post-traumatic stress disorder)"]
ITIH3	4	["Anorexia nervosa","Tourette syndrome","Obsessive-compulsive disorder","Psychiatric disorders"]	[]	4	["GWAS catalog (Anorexia nervosa)","GWAS catalog (Obsessive-compulsive disorder)","GWAS catalog (Psychiatric disorders)","GWAS catalog (Tourette syndrome)"]

LRFN5 (leucine rich repeat and fibronectin type III domain containing 5)

Bookmark This Gene