POLR2L (RNA polymerase II, I and III subunit L)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 5441
• Gene name: RNA polymerase II, I and III subunit L
• Gene symbol: POLR2L
• Synonyms (NCBI Gene): RBP10, RPABC5, RPB10, RPB10beta, RPB7.6, hRPB7.6
• Chromosome: 11
• Chromosome location: 11p15.5
• Summary: This gene encodes a subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. The product of this gene contains four conserved cysteines characteristic of an atypical zinc-binding domain. Like its counterpart i

miRNA Show/Hide all (178)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022925	hsa-miR-124-3p	Proteomics;Microarray	18668037
MIRT032392	hsa-let-7b-5p	Proteomics	18668040
MIRT049695	hsa-miR-92a-3p	CLASH	23622248
MIRT043387	hsa-miR-331-3p	CLASH	23622248
MIRT042647	hsa-miR-423-3p	CLASH	23622248
MIRT037575	hsa-miR-744-5p	CLASH	23622248
MIRT1249082	hsa-miR-1193	CLIP-seq
MIRT1249083	hsa-miR-1205	CLIP-seq
MIRT1249084	hsa-miR-1243	CLIP-seq
MIRT1249085	hsa-miR-1281	CLIP-seq
MIRT1249086	hsa-miR-1293	CLIP-seq
MIRT1249087	hsa-miR-140-5p	CLIP-seq
MIRT1249088	hsa-miR-1909	CLIP-seq
MIRT1249089	hsa-miR-1976	CLIP-seq
MIRT1249090	hsa-miR-3065-3p	CLIP-seq
MIRT1249091	hsa-miR-3180-5p	CLIP-seq
MIRT738954	hsa-miR-329	CLIP-seq
MIRT1249092	hsa-miR-342-5p	CLIP-seq
MIRT1249093	hsa-miR-3545-5p	CLIP-seq
MIRT738955	hsa-miR-362-3p	CLIP-seq
MIRT1249094	hsa-miR-3654	CLIP-seq
MIRT1249095	hsa-miR-3656	CLIP-seq
MIRT1249096	hsa-miR-3667-3p	CLIP-seq
MIRT738953	hsa-miR-3941	CLIP-seq
MIRT738948	hsa-miR-4267	CLIP-seq
MIRT1249097	hsa-miR-4460	CLIP-seq
MIRT1249098	hsa-miR-4481	CLIP-seq
MIRT1249099	hsa-miR-4483	CLIP-seq
MIRT738949	hsa-miR-4645-5p	CLIP-seq
MIRT1249100	hsa-miR-4664-5p	CLIP-seq
MIRT738950	hsa-miR-4673	CLIP-seq
MIRT1249101	hsa-miR-4727-3p	CLIP-seq
MIRT1249102	hsa-miR-4738-5p	CLIP-seq
MIRT1249103	hsa-miR-4745-5p	CLIP-seq
MIRT738951	hsa-miR-4755-3p	CLIP-seq
MIRT1249104	hsa-miR-4766-5p	CLIP-seq
MIRT1249105	hsa-miR-520a-5p	CLIP-seq
MIRT1249106	hsa-miR-525-5p	CLIP-seq
MIRT738952	hsa-miR-603	CLIP-seq
MIRT1249107	hsa-miR-759	CLIP-seq
MIRT1249108	hsa-miR-885-3p	CLIP-seq
MIRT738954	hsa-miR-329	CLIP-seq
MIRT738955	hsa-miR-362-3p	CLIP-seq
MIRT738953	hsa-miR-3941	CLIP-seq
MIRT738948	hsa-miR-4267	CLIP-seq
MIRT738949	hsa-miR-4645-5p	CLIP-seq
MIRT738950	hsa-miR-4673	CLIP-seq
MIRT738951	hsa-miR-4755-3p	CLIP-seq
MIRT738952	hsa-miR-603	CLIP-seq
MIRT1249084	hsa-miR-1243	CLIP-seq
MIRT2073543	hsa-miR-1266	CLIP-seq
MIRT2073544	hsa-miR-1286	CLIP-seq
MIRT2073545	hsa-miR-149	CLIP-seq
MIRT1249090	hsa-miR-3065-3p	CLIP-seq
MIRT2073546	hsa-miR-3127-5p	CLIP-seq
MIRT738954	hsa-miR-329	CLIP-seq
MIRT738955	hsa-miR-362-3p	CLIP-seq
MIRT1249094	hsa-miR-3654	CLIP-seq
MIRT1249095	hsa-miR-3656	CLIP-seq
MIRT2073547	hsa-miR-3918	CLIP-seq
MIRT2073548	hsa-miR-3937	CLIP-seq
MIRT738953	hsa-miR-3941	CLIP-seq
MIRT738948	hsa-miR-4267	CLIP-seq
MIRT2073549	hsa-miR-4452	CLIP-seq
MIRT1249098	hsa-miR-4481	CLIP-seq
MIRT2073550	hsa-miR-4508	CLIP-seq
MIRT2073551	hsa-miR-4518	CLIP-seq
MIRT2073552	hsa-miR-4641	CLIP-seq
MIRT738949	hsa-miR-4645-5p	CLIP-seq
MIRT738950	hsa-miR-4673	CLIP-seq
MIRT1249103	hsa-miR-4745-5p	CLIP-seq
MIRT738951	hsa-miR-4755-3p	CLIP-seq
MIRT2073553	hsa-miR-486-3p	CLIP-seq
MIRT1249105	hsa-miR-520a-5p	CLIP-seq
MIRT1249106	hsa-miR-525-5p	CLIP-seq
MIRT2073554	hsa-miR-574-3p	CLIP-seq
MIRT738952	hsa-miR-603	CLIP-seq
MIRT1249107	hsa-miR-759	CLIP-seq
MIRT1249084	hsa-miR-1243	CLIP-seq
MIRT2300529	hsa-miR-1245	CLIP-seq
MIRT2073543	hsa-miR-1266	CLIP-seq
MIRT2300530	hsa-miR-150	CLIP-seq
MIRT1249089	hsa-miR-1976	CLIP-seq
MIRT1249090	hsa-miR-3065-3p	CLIP-seq
MIRT2073546	hsa-miR-3127-5p	CLIP-seq
MIRT1249091	hsa-miR-3180-5p	CLIP-seq
MIRT738954	hsa-miR-329	CLIP-seq
MIRT738955	hsa-miR-362-3p	CLIP-seq
MIRT1249094	hsa-miR-3654	CLIP-seq
MIRT1249096	hsa-miR-3667-3p	CLIP-seq
MIRT2073547	hsa-miR-3918	CLIP-seq
MIRT738953	hsa-miR-3941	CLIP-seq
MIRT738948	hsa-miR-4267	CLIP-seq
MIRT2300531	hsa-miR-4312	CLIP-seq
MIRT2073549	hsa-miR-4452	CLIP-seq
MIRT1249098	hsa-miR-4481	CLIP-seq
MIRT2073551	hsa-miR-4518	CLIP-seq
MIRT2073552	hsa-miR-4641	CLIP-seq
MIRT738949	hsa-miR-4645-5p	CLIP-seq
MIRT738950	hsa-miR-4673	CLIP-seq
MIRT2300532	hsa-miR-4722-3p	CLIP-seq
MIRT1249103	hsa-miR-4745-5p	CLIP-seq
MIRT738951	hsa-miR-4755-3p	CLIP-seq
MIRT2300533	hsa-miR-4757-5p	CLIP-seq
MIRT1249105	hsa-miR-520a-5p	CLIP-seq
MIRT1249106	hsa-miR-525-5p	CLIP-seq
MIRT738952	hsa-miR-603	CLIP-seq
MIRT1249107	hsa-miR-759	CLIP-seq
MIRT1249082	hsa-miR-1193	CLIP-seq
MIRT1249084	hsa-miR-1243	CLIP-seq
MIRT1249087	hsa-miR-140-5p	CLIP-seq
MIRT2597324	hsa-miR-3174	CLIP-seq
MIRT1249091	hsa-miR-3180-5p	CLIP-seq
MIRT738954	hsa-miR-329	CLIP-seq
MIRT1249093	hsa-miR-3545-5p	CLIP-seq
MIRT2597325	hsa-miR-3616-3p	CLIP-seq
MIRT738955	hsa-miR-362-3p	CLIP-seq
MIRT2597326	hsa-miR-3649	CLIP-seq
MIRT1249094	hsa-miR-3654	CLIP-seq
MIRT1249096	hsa-miR-3667-3p	CLIP-seq
MIRT2597327	hsa-miR-3913-3p	CLIP-seq
MIRT738953	hsa-miR-3941	CLIP-seq
MIRT738948	hsa-miR-4267	CLIP-seq
MIRT2597328	hsa-miR-4446-3p	CLIP-seq
MIRT1249097	hsa-miR-4460	CLIP-seq
MIRT1249098	hsa-miR-4481	CLIP-seq
MIRT2597329	hsa-miR-4492	CLIP-seq
MIRT2597330	hsa-miR-4498	CLIP-seq
MIRT2597331	hsa-miR-4505	CLIP-seq
MIRT738949	hsa-miR-4645-5p	CLIP-seq
MIRT738950	hsa-miR-4673	CLIP-seq
MIRT2597332	hsa-miR-4721	CLIP-seq
MIRT1249101	hsa-miR-4727-3p	CLIP-seq
MIRT1249103	hsa-miR-4745-5p	CLIP-seq
MIRT738951	hsa-miR-4755-3p	CLIP-seq
MIRT1249104	hsa-miR-4766-5p	CLIP-seq
MIRT2597333	hsa-miR-489	CLIP-seq
MIRT1249105	hsa-miR-520a-5p	CLIP-seq
MIRT1249106	hsa-miR-525-5p	CLIP-seq
MIRT738952	hsa-miR-603	CLIP-seq
MIRT1249107	hsa-miR-759	CLIP-seq
MIRT2597334	hsa-miR-762	CLIP-seq
MIRT2597335	hsa-miR-921	CLIP-seq
MIRT1249082	hsa-miR-1193	CLIP-seq
MIRT1249084	hsa-miR-1243	CLIP-seq
MIRT1249087	hsa-miR-140-5p	CLIP-seq
MIRT2597324	hsa-miR-3174	CLIP-seq
MIRT1249091	hsa-miR-3180-5p	CLIP-seq
MIRT738954	hsa-miR-329	CLIP-seq
MIRT1249093	hsa-miR-3545-5p	CLIP-seq
MIRT2597325	hsa-miR-3616-3p	CLIP-seq
MIRT738955	hsa-miR-362-3p	CLIP-seq
MIRT2597326	hsa-miR-3649	CLIP-seq
MIRT1249094	hsa-miR-3654	CLIP-seq
MIRT1249096	hsa-miR-3667-3p	CLIP-seq
MIRT2597327	hsa-miR-3913-3p	CLIP-seq
MIRT738953	hsa-miR-3941	CLIP-seq
MIRT738948	hsa-miR-4267	CLIP-seq
MIRT2597328	hsa-miR-4446-3p	CLIP-seq
MIRT1249097	hsa-miR-4460	CLIP-seq
MIRT1249098	hsa-miR-4481	CLIP-seq
MIRT2597329	hsa-miR-4492	CLIP-seq
MIRT2597330	hsa-miR-4498	CLIP-seq
MIRT2597331	hsa-miR-4505	CLIP-seq
MIRT738949	hsa-miR-4645-5p	CLIP-seq
MIRT738950	hsa-miR-4673	CLIP-seq
MIRT2597332	hsa-miR-4721	CLIP-seq
MIRT1249101	hsa-miR-4727-3p	CLIP-seq
MIRT1249103	hsa-miR-4745-5p	CLIP-seq
MIRT738951	hsa-miR-4755-3p	CLIP-seq
MIRT1249104	hsa-miR-4766-5p	CLIP-seq
MIRT2597333	hsa-miR-489	CLIP-seq
MIRT1249105	hsa-miR-520a-5p	CLIP-seq
MIRT1249106	hsa-miR-525-5p	CLIP-seq
MIRT738952	hsa-miR-603	CLIP-seq
MIRT1249107	hsa-miR-759	CLIP-seq
MIRT2597334	hsa-miR-762	CLIP-seq
MIRT2597335	hsa-miR-921	CLIP-seq

Gene ontology (GO) Show/Hide all (29)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000428	Component	DNA-directed RNA polymerase complex	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003899	Function	DNA-directed RNA polymerase activity	IBA
GO:0003899	Function	DNA-directed RNA polymerase activity	IEA
GO:0003899	Function	DNA-directed RNA polymerase activity	TAS	8524256
GO:0005515	Function	Protein binding	IPI	21988832, 24981860, 25416956, 28514442, 32296183, 33961781
GO:0005634	Component	Nucleus	IDA	9852112
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005665	Component	RNA polymerase II, core complex	IBA
GO:0005665	Component	RNA polymerase II, core complex	IDA	9852112
GO:0005665	Component	RNA polymerase II, core complex	IEA
GO:0005666	Component	RNA polymerase III complex	IBA
GO:0005666	Component	RNA polymerase III complex	IDA	33335104, 34675218
GO:0005730	Component	Nucleolus	IEA
GO:0005736	Component	RNA polymerase I complex	IBA
GO:0005736	Component	RNA polymerase I complex	IDA	34671025, 36271492
GO:0005829	Component	Cytosol	TAS
GO:0006351	Process	DNA-templated transcription	IEA
GO:0006356	Process	Regulation of transcription by RNA polymerase I	TAS	8786124
GO:0006360	Process	Transcription by RNA polymerase I	IBA
GO:0006366	Process	Transcription by RNA polymerase II	IBA
GO:0006366	Process	Transcription by RNA polymerase II	IDA	9852112
GO:0008270	Function	Zinc ion binding	IBA
GO:0008270	Function	Zinc ion binding	IDA	34675218
GO:0008270	Function	Zinc ion binding	IEA
GO:0042797	Process	TRNA transcription by RNA polymerase III	IBA
GO:0046872	Function	Metal ion binding	IEA

Other IDs

• MIM: 601189
• HGNC: 9199
• e!Ensembl: ENSG00000177700

Protein

• UniProt ID: P62875
• Protein name: DNA-directed RNA polymerases I, II, and III subunit RPABC5 (RNA polymerases I, II, and III subunit ABC5) (DNA-directed RNA polymerase III subunit L) (RNA polymerase II 7.6 kDa subunit) (RPB7.6) (RPB10 homolog)
• Protein function: DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I, II and III which synthesize ribosomal RNA precursors, mRNA precursors and
• PDB: 5IY6 , 5IY7 , 5IY8 , 5IY9 , 5IYA , 5IYB , 5IYC , 5IYD , 6DRD , 6O9L , 6XRE , 7A6H , 7AE1 , 7AE3 , 7AEA , 7AST , 7D58 , 7D59 , 7DN3 , 7DU2 , 7FJI , 7FJJ , 7LBM , 7OB9 , 7OBA , 7OBB , 7VBA , 7VBB , 7VBC , 8A43 , 8ITY , 8IUE , 8IUH , 9EHZ , 9EI1 , 9EI3 , 9EI4 , 9FSO , 9FSP , 9FSQ , 9FSR , 9FSS
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01194	RNA_pol_N	1 → 59	RNA polymerases N / 8 kDa subunit	Domain

• Sequence:

  MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLL
  NYAPLEK

• Sequence length: 67

Pathways

KEGG Pathway	Reactome Pathway
RNA polymerase	Formation of RNA Pol II elongation complex
Nucleotide excision repair	Formation of the Early Elongation Complex
Cytosolic DNA-sensing pathway	Formation of HIV-1 elongation complex containing HIV-1 Tat
Huntington disease	Viral Messenger RNA Synthesis
	Cytosolic sensors of pathogen-associated DNA
	MicroRNA (miRNA) biogenesis
	B-WICH complex positively regulates rRNA expression
	Transcriptional regulation by small RNAs
	RNA Polymerase II Pre-transcription Events
	Formation of TC-NER Pre-Incision Complex
	Transcription-Coupled Nucleotide Excision Repair (TC-NER)
	Dual incision in TC-NER
	Gap-filling DNA repair synthesis and ligation in TC-NER
	TP53 Regulates Transcription of DNA Repair Genes
	FGFR2 alternative splicing
	RNA polymerase II transcribes snRNA genes
	mRNA Capping
	mRNA Splicing - Major Pathway
	mRNA Splicing - Minor Pathway
	Processing of Capped Intron-Containing Pre-mRNA
	RNA Polymerase I Transcription Initiation
	RNA Polymerase I Promoter Escape
	RNA Polymerase II Promoter Escape
	RNA Polymerase II Transcription Pre-Initiation And Promoter Opening
	RNA Polymerase I Transcription Termination
	RNA Polymerase II Transcription Initiation
	RNA Polymerase II Transcription Elongation
	RNA Polymerase II Transcription Initiation And Promoter Clearance
	RNA Polymerase III Transcription Initiation From Type 1 Promoter
	RNA Polymerase III Transcription Initiation From Type 2 Promoter
	RNA Polymerase III Transcription Initiation From Type 3 Promoter
	RNA Pol II CTD phosphorylation and interaction with CE
	Estrogen-dependent gene expression

Related Genes

Sort by: Blended Diseases Pathways Evidence source

POLR2E 36 shared pathwaysRNA polymerase, Nucleotide excision repair, Cytosolic DNA-sensing pathway, Formation of RNA Pol II elongation complex , RNA Polymerase II Pre-transcription Events, TP53 Regulates Transcription of DNA Repair Genes, RNA Polymerase II Transcription Elongation, Formation of TC-NER Pre-Incision Complex, Transcription-Coupled Nucleotide Excision Repair (TC-NER), Dual incision in TC-NER, Gap-filling DNA repair synthesis and ligation in TC-NER, mRNA Splicing - Major Pathway +24 more Related via 36 shared pathways including RNA polymerase, Nucleotide excision repair. POLR2F 36 shared pathwaysRNA polymerase, Nucleotide excision repair, Cytosolic DNA-sensing pathway, Formation of RNA Pol II elongation complex , RNA Polymerase II Pre-transcription Events, TP53 Regulates Transcription of DNA Repair Genes, RNA Polymerase II Transcription Elongation, Formation of TC-NER Pre-Incision Complex, Transcription-Coupled Nucleotide Excision Repair (TC-NER), Dual incision in TC-NER, Gap-filling DNA repair synthesis and ligation in TC-NER, mRNA Splicing - Major Pathway +24 more Related via 36 shared pathways including RNA polymerase, Nucleotide excision repair. POLR2H 36 shared pathwaysRNA polymerase, Nucleotide excision repair, Cytosolic DNA-sensing pathway, Formation of RNA Pol II elongation complex , RNA Polymerase II Pre-transcription Events, TP53 Regulates Transcription of DNA Repair Genes, RNA Polymerase II Transcription Elongation, Formation of TC-NER Pre-Incision Complex, Transcription-Coupled Nucleotide Excision Repair (TC-NER), Dual incision in TC-NER, Gap-filling DNA repair synthesis and ligation in TC-NER, mRNA Splicing - Major Pathway +24 more Related via 36 shared pathways including RNA polymerase, Nucleotide excision repair. POLR2K 36 shared pathwaysRNA polymerase, Nucleotide excision repair, Cytosolic DNA-sensing pathway, Formation of RNA Pol II elongation complex , RNA Polymerase II Pre-transcription Events, TP53 Regulates Transcription of DNA Repair Genes, RNA Polymerase II Transcription Elongation, Formation of TC-NER Pre-Incision Complex, Transcription-Coupled Nucleotide Excision Repair (TC-NER), Dual incision in TC-NER, Gap-filling DNA repair synthesis and ligation in TC-NER, mRNA Splicing - Major Pathway +24 more Related via 36 shared pathways including RNA polymerase, Nucleotide excision repair. POLR2A 27 shared pathwaysRNA polymerase, Nucleotide excision repair, Formation of RNA Pol II elongation complex , RNA Polymerase II Pre-transcription Events, TP53 Regulates Transcription of DNA Repair Genes, RNA Polymerase II Transcription Elongation, Formation of TC-NER Pre-Incision Complex, Transcription-Coupled Nucleotide Excision Repair (TC-NER), Dual incision in TC-NER, Gap-filling DNA repair synthesis and ligation in TC-NER, mRNA Splicing - Major Pathway, mRNA Splicing - Minor Pathway +15 more Related via 27 shared pathways including RNA polymerase, Nucleotide excision repair.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
POLR2E	0	[]	36	["RNA polymerase","Nucleotide excision repair","Cytosolic DNA-sensing pathway","Formation of RNA Pol II elongation complex ","RNA Polymerase II Pre-transcription Events","TP53 Regulates Transcription of DNA Repair Genes","RNA Polymerase II Transcription Elongation","Formation of TC-NER Pre-Incision Complex","Transcription-Coupled Nucleotide Excision Repair (TC-NER)","Dual incision in TC-NER","Gap-filling DNA repair synthesis and ligation in TC-NER","mRNA Splicing - Major Pathway"]	0	[]
POLR2F	0	[]	36	["RNA polymerase","Nucleotide excision repair","Cytosolic DNA-sensing pathway","Formation of RNA Pol II elongation complex ","RNA Polymerase II Pre-transcription Events","TP53 Regulates Transcription of DNA Repair Genes","RNA Polymerase II Transcription Elongation","Formation of TC-NER Pre-Incision Complex","Transcription-Coupled Nucleotide Excision Repair (TC-NER)","Dual incision in TC-NER","Gap-filling DNA repair synthesis and ligation in TC-NER","mRNA Splicing - Major Pathway"]	0	[]
POLR2H	0	[]	36	["RNA polymerase","Nucleotide excision repair","Cytosolic DNA-sensing pathway","Formation of RNA Pol II elongation complex ","RNA Polymerase II Pre-transcription Events","TP53 Regulates Transcription of DNA Repair Genes","RNA Polymerase II Transcription Elongation","Formation of TC-NER Pre-Incision Complex","Transcription-Coupled Nucleotide Excision Repair (TC-NER)","Dual incision in TC-NER","Gap-filling DNA repair synthesis and ligation in TC-NER","mRNA Splicing - Major Pathway"]	0	[]
POLR2K	0	[]	36	["RNA polymerase","Nucleotide excision repair","Cytosolic DNA-sensing pathway","Formation of RNA Pol II elongation complex ","RNA Polymerase II Pre-transcription Events","TP53 Regulates Transcription of DNA Repair Genes","RNA Polymerase II Transcription Elongation","Formation of TC-NER Pre-Incision Complex","Transcription-Coupled Nucleotide Excision Repair (TC-NER)","Dual incision in TC-NER","Gap-filling DNA repair synthesis and ligation in TC-NER","mRNA Splicing - Major Pathway"]	0	[]
POLR2A	0	[]	27	["RNA polymerase","Nucleotide excision repair","Formation of RNA Pol II elongation complex ","RNA Polymerase II Pre-transcription Events","TP53 Regulates Transcription of DNA Repair Genes","RNA Polymerase II Transcription Elongation","Formation of TC-NER Pre-Incision Complex","Transcription-Coupled Nucleotide Excision Repair (TC-NER)","Dual incision in TC-NER","Gap-filling DNA repair synthesis and ligation in TC-NER","mRNA Splicing - Major Pathway","mRNA Splicing - Minor Pathway"]	0	[]

Diseases Linked via Similar Genes

Alzheimer disease Linked via 1 of 5 related genesPOLR2E Autism Linked via 1 of 5 related genesPOLR2E Small vessel stroke Linked via 1 of 5 related genesPOLR2E Charcot-marie-tooth disease Linked via 1 of 5 related genesPOLR2F Hearing loss Linked via 1 of 5 related genesPOLR2F

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Alzheimer disease	1	["POLR2E"]
Autism	1	["POLR2E"]
Small vessel stroke	1	["POLR2E"]
Charcot-marie-tooth disease	1	["POLR2F"]
Hearing loss	1	["POLR2F"]