POLR2H (RNA polymerase II, I and III subunit H)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 5437
• Gene name: RNA polymerase II, I and III subunit H
• Gene symbol: POLR2H
• Synonyms (NCBI Gene): RPABC3, RPB17, RPB8
• Chromosome: 3
• Chromosome location: 3q27.1
• Summary: The three eukaryotic RNA polymerases are complex multisubunit enzymes that play a central role in the transcription of nuclear genes. This gene encodes an essential and highly conserved subunit of RNA polymerase II that is shared by the other two eukaryot

miRNA Show/Hide all (80)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029504	hsa-miR-26b-5p	Microarray	19088304
MIRT032336	hsa-let-7b-5p	Proteomics	18668040
MIRT047603	hsa-miR-10a-5p	CLASH	23622248
MIRT1248796	hsa-miR-150	CLIP-seq
MIRT1248797	hsa-miR-223	CLIP-seq
MIRT1248798	hsa-miR-27a	CLIP-seq
MIRT1248799	hsa-miR-27b	CLIP-seq
MIRT1248800	hsa-miR-3156-3p	CLIP-seq
MIRT1248801	hsa-miR-3184	CLIP-seq
MIRT1248802	hsa-miR-320a	CLIP-seq
MIRT1248803	hsa-miR-320b	CLIP-seq
MIRT1248804	hsa-miR-320c	CLIP-seq
MIRT1248805	hsa-miR-320d	CLIP-seq
MIRT1248806	hsa-miR-3920	CLIP-seq
MIRT1248807	hsa-miR-423-5p	CLIP-seq
MIRT1248808	hsa-miR-4301	CLIP-seq
MIRT1248809	hsa-miR-4328	CLIP-seq
MIRT1248810	hsa-miR-4429	CLIP-seq
MIRT1248811	hsa-miR-4688	CLIP-seq
MIRT1248812	hsa-miR-4711-3p	CLIP-seq
MIRT1248813	hsa-miR-4713-5p	CLIP-seq
MIRT1248814	hsa-miR-4728-5p	CLIP-seq
MIRT1248815	hsa-miR-4762-3p	CLIP-seq
MIRT1248816	hsa-miR-4766-5p	CLIP-seq
MIRT1248817	hsa-miR-4775	CLIP-seq
MIRT1248818	hsa-miR-486-3p	CLIP-seq
MIRT1248819	hsa-miR-511	CLIP-seq
MIRT1248820	hsa-miR-513a-5p	CLIP-seq
MIRT1248821	hsa-miR-532-3p	CLIP-seq
MIRT1248822	hsa-miR-548a-5p	CLIP-seq
MIRT1248823	hsa-miR-548ab	CLIP-seq
MIRT1248824	hsa-miR-548ak	CLIP-seq
MIRT1248825	hsa-miR-548b-5p	CLIP-seq
MIRT1248826	hsa-miR-548c-3p	CLIP-seq
MIRT1248827	hsa-miR-548c-5p	CLIP-seq
MIRT1248828	hsa-miR-548d-5p	CLIP-seq
MIRT1248829	hsa-miR-548h	CLIP-seq
MIRT1248830	hsa-miR-548i	CLIP-seq
MIRT1248831	hsa-miR-548j	CLIP-seq
MIRT1248832	hsa-miR-548n	CLIP-seq
MIRT1248833	hsa-miR-548w	CLIP-seq
MIRT1248834	hsa-miR-548y	CLIP-seq
MIRT1248835	hsa-miR-559	CLIP-seq
MIRT1248836	hsa-miR-561	CLIP-seq
MIRT1248837	hsa-miR-579	CLIP-seq
MIRT1248838	hsa-miR-622	CLIP-seq
MIRT1248839	hsa-miR-664	CLIP-seq
MIRT1248840	hsa-miR-892a	CLIP-seq
MIRT1248796	hsa-miR-150	CLIP-seq
MIRT1248800	hsa-miR-3156-3p	CLIP-seq
MIRT1248808	hsa-miR-4301	CLIP-seq
MIRT1248813	hsa-miR-4713-5p	CLIP-seq
MIRT1248821	hsa-miR-532-3p	CLIP-seq
MIRT1248840	hsa-miR-892a	CLIP-seq
MIRT2597236	hsa-miR-3155	CLIP-seq
MIRT2597237	hsa-miR-3155b	CLIP-seq
MIRT2597238	hsa-miR-3164	CLIP-seq
MIRT2597239	hsa-miR-365	CLIP-seq
MIRT2597240	hsa-miR-3661	CLIP-seq
MIRT2597241	hsa-miR-3937	CLIP-seq
MIRT2597242	hsa-miR-4252	CLIP-seq
MIRT2597243	hsa-miR-4641	CLIP-seq
MIRT2597244	hsa-miR-4765	CLIP-seq
MIRT2597245	hsa-miR-484	CLIP-seq
MIRT2597246	hsa-miR-485-5p	CLIP-seq
MIRT2597247	hsa-miR-510	CLIP-seq
MIRT2597248	hsa-miR-631	CLIP-seq
MIRT2597236	hsa-miR-3155	CLIP-seq
MIRT2597237	hsa-miR-3155b	CLIP-seq
MIRT2597238	hsa-miR-3164	CLIP-seq
MIRT2597239	hsa-miR-365	CLIP-seq
MIRT2597240	hsa-miR-3661	CLIP-seq
MIRT2597241	hsa-miR-3937	CLIP-seq
MIRT2597242	hsa-miR-4252	CLIP-seq
MIRT2597243	hsa-miR-4641	CLIP-seq
MIRT2597244	hsa-miR-4765	CLIP-seq
MIRT2597245	hsa-miR-484	CLIP-seq
MIRT2597246	hsa-miR-485-5p	CLIP-seq
MIRT2597247	hsa-miR-510	CLIP-seq
MIRT2597248	hsa-miR-631	CLIP-seq

Gene ontology (GO) Show/Hide all (20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000428	Component	DNA-directed RNA polymerase complex	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003697	Function	Single-stranded DNA binding	IDA	16632472
GO:0003899	Function	DNA-directed RNA polymerase activity	IBA
GO:0003899	Function	DNA-directed RNA polymerase activity	IEA
GO:0005634	Component	Nucleus	IDA	9852112
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005665	Component	RNA polymerase II, core complex	IBA
GO:0005665	Component	RNA polymerase II, core complex	IDA	9852112
GO:0005666	Component	RNA polymerase III complex	IBA
GO:0005666	Component	RNA polymerase III complex	IDA	33335104, 34675218
GO:0005730	Component	Nucleolus	IEA
GO:0005736	Component	RNA polymerase I complex	IBA
GO:0005736	Component	RNA polymerase I complex	IDA	34671025, 36271492
GO:0005829	Component	Cytosol	TAS
GO:0006351	Process	DNA-templated transcription	IEA
GO:0006366	Process	Transcription by RNA polymerase II	IDA	9852112
GO:0032993	Component	Protein-DNA complex	IDA	16632472

Other IDs

• MIM: 606023
• HGNC: 9195
• e!Ensembl: ENSG00000163882

Protein

• UniProt ID: P52434
• Protein name: DNA-directed RNA polymerases I, II, and III subunit RPABC3 (RNA polymerases I, II, and III subunit ABC3) (DNA-directed RNA polymerase II subunit H) (DNA-directed RNA polymerases I, II, and III 17.1 kDa polypeptide) (RPB17) (RPB8 homolog) (hRPB8)
• Protein function: DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I, II and III which synthesize ribosomal RNA precursors, mRNA precursors and
• PDB: 2F3I , 5IY6 , 5IY7 , 5IY8 , 5IY9 , 5IYA , 5IYB , 5IYC , 5IYD , 6DRD , 6O9L , 6XRE , 7A6H , 7AE1 , 7AE3 , 7AEA , 7AST , 7D58 , 7D59 , 7DN3 , 7DU2 , 7FJI , 7FJJ , 7LBM , 7OB9 , 7OBA , 7OBB , 7VBA , 7VBB , 7VBC , 8A43 , 8ITY , 8IUE , 8IUH , 9EHZ , 9EI1 , 9EI3 , 9EI4 , 9FSO , 9FSP , 9FSQ , 9FSR , 9FSS
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF03870	RNA_pol_Rpb8	7 → 147	RNA polymerase Rpb8	Family

• Sequence:

  MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVI
  ASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGG
  LLMRLQGDANNLHGFEVDSRVYLLMKKLAF

• Sequence length: 150

Pathways

KEGG Pathway	Reactome Pathway
RNA polymerase	Formation of RNA Pol II elongation complex
Nucleotide excision repair	Formation of the Early Elongation Complex
Cytosolic DNA-sensing pathway	Formation of HIV-1 elongation complex containing HIV-1 Tat
Huntington disease	Viral Messenger RNA Synthesis
	Cytosolic sensors of pathogen-associated DNA
	MicroRNA (miRNA) biogenesis
	B-WICH complex positively regulates rRNA expression
	Transcriptional regulation by small RNAs
	RNA Polymerase II Pre-transcription Events
	Formation of TC-NER Pre-Incision Complex
	Transcription-Coupled Nucleotide Excision Repair (TC-NER)
	Dual incision in TC-NER
	Gap-filling DNA repair synthesis and ligation in TC-NER
	TP53 Regulates Transcription of DNA Repair Genes
	FGFR2 alternative splicing
	RNA polymerase II transcribes snRNA genes
	mRNA Capping
	mRNA Splicing - Major Pathway
	mRNA Splicing - Minor Pathway
	Processing of Capped Intron-Containing Pre-mRNA
	RNA Polymerase I Transcription Initiation
	RNA Polymerase I Promoter Escape
	RNA Polymerase II Promoter Escape
	RNA Polymerase II Transcription Pre-Initiation And Promoter Opening
	RNA Polymerase I Transcription Termination
	RNA Polymerase II Transcription Initiation
	RNA Polymerase II Transcription Elongation
	RNA Polymerase II Transcription Initiation And Promoter Clearance
	RNA Polymerase III Transcription Initiation From Type 1 Promoter
	RNA Polymerase III Transcription Initiation From Type 2 Promoter
	RNA Polymerase III Transcription Initiation From Type 3 Promoter
	RNA Pol II CTD phosphorylation and interaction with CE
	Estrogen-dependent gene expression

Related Genes

Sort by: Blended Diseases Pathways Evidence source

POLR2E 36 shared pathwaysRNA polymerase, Nucleotide excision repair, Cytosolic DNA-sensing pathway, Formation of RNA Pol II elongation complex , RNA Polymerase II Pre-transcription Events, TP53 Regulates Transcription of DNA Repair Genes, RNA Polymerase II Transcription Elongation, Formation of TC-NER Pre-Incision Complex, Transcription-Coupled Nucleotide Excision Repair (TC-NER), Dual incision in TC-NER, Gap-filling DNA repair synthesis and ligation in TC-NER, mRNA Splicing - Major Pathway +24 more Related via 36 shared pathways including RNA polymerase, Nucleotide excision repair. POLR2F 36 shared pathwaysRNA polymerase, Nucleotide excision repair, Cytosolic DNA-sensing pathway, Formation of RNA Pol II elongation complex , RNA Polymerase II Pre-transcription Events, TP53 Regulates Transcription of DNA Repair Genes, RNA Polymerase II Transcription Elongation, Formation of TC-NER Pre-Incision Complex, Transcription-Coupled Nucleotide Excision Repair (TC-NER), Dual incision in TC-NER, Gap-filling DNA repair synthesis and ligation in TC-NER, mRNA Splicing - Major Pathway +24 more Related via 36 shared pathways including RNA polymerase, Nucleotide excision repair. POLR2K 36 shared pathwaysRNA polymerase, Nucleotide excision repair, Cytosolic DNA-sensing pathway, Formation of RNA Pol II elongation complex , RNA Polymerase II Pre-transcription Events, TP53 Regulates Transcription of DNA Repair Genes, RNA Polymerase II Transcription Elongation, Formation of TC-NER Pre-Incision Complex, Transcription-Coupled Nucleotide Excision Repair (TC-NER), Dual incision in TC-NER, Gap-filling DNA repair synthesis and ligation in TC-NER, mRNA Splicing - Major Pathway +24 more Related via 36 shared pathways including RNA polymerase, Nucleotide excision repair. POLR2L 36 shared pathwaysRNA polymerase, Nucleotide excision repair, Cytosolic DNA-sensing pathway, Formation of RNA Pol II elongation complex , RNA Polymerase II Pre-transcription Events, TP53 Regulates Transcription of DNA Repair Genes, RNA Polymerase II Transcription Elongation, Formation of TC-NER Pre-Incision Complex, Transcription-Coupled Nucleotide Excision Repair (TC-NER), Dual incision in TC-NER, Gap-filling DNA repair synthesis and ligation in TC-NER, mRNA Splicing - Major Pathway +24 more Related via 36 shared pathways including RNA polymerase, Nucleotide excision repair. POLR2A 27 shared pathwaysRNA polymerase, Nucleotide excision repair, Formation of RNA Pol II elongation complex , RNA Polymerase II Pre-transcription Events, TP53 Regulates Transcription of DNA Repair Genes, RNA Polymerase II Transcription Elongation, Formation of TC-NER Pre-Incision Complex, Transcription-Coupled Nucleotide Excision Repair (TC-NER), Dual incision in TC-NER, Gap-filling DNA repair synthesis and ligation in TC-NER, mRNA Splicing - Major Pathway, mRNA Splicing - Minor Pathway +15 more Related via 27 shared pathways including RNA polymerase, Nucleotide excision repair.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
POLR2E	0	[]	36	["RNA polymerase","Nucleotide excision repair","Cytosolic DNA-sensing pathway","Formation of RNA Pol II elongation complex ","RNA Polymerase II Pre-transcription Events","TP53 Regulates Transcription of DNA Repair Genes","RNA Polymerase II Transcription Elongation","Formation of TC-NER Pre-Incision Complex","Transcription-Coupled Nucleotide Excision Repair (TC-NER)","Dual incision in TC-NER","Gap-filling DNA repair synthesis and ligation in TC-NER","mRNA Splicing - Major Pathway"]	0	[]
POLR2F	0	[]	36	["RNA polymerase","Nucleotide excision repair","Cytosolic DNA-sensing pathway","Formation of RNA Pol II elongation complex ","RNA Polymerase II Pre-transcription Events","TP53 Regulates Transcription of DNA Repair Genes","RNA Polymerase II Transcription Elongation","Formation of TC-NER Pre-Incision Complex","Transcription-Coupled Nucleotide Excision Repair (TC-NER)","Dual incision in TC-NER","Gap-filling DNA repair synthesis and ligation in TC-NER","mRNA Splicing - Major Pathway"]	0	[]
POLR2K	0	[]	36	["RNA polymerase","Nucleotide excision repair","Cytosolic DNA-sensing pathway","Formation of RNA Pol II elongation complex ","RNA Polymerase II Pre-transcription Events","TP53 Regulates Transcription of DNA Repair Genes","RNA Polymerase II Transcription Elongation","Formation of TC-NER Pre-Incision Complex","Transcription-Coupled Nucleotide Excision Repair (TC-NER)","Dual incision in TC-NER","Gap-filling DNA repair synthesis and ligation in TC-NER","mRNA Splicing - Major Pathway"]	0	[]
POLR2L	0	[]	36	["RNA polymerase","Nucleotide excision repair","Cytosolic DNA-sensing pathway","Formation of RNA Pol II elongation complex ","RNA Polymerase II Pre-transcription Events","TP53 Regulates Transcription of DNA Repair Genes","RNA Polymerase II Transcription Elongation","Formation of TC-NER Pre-Incision Complex","Transcription-Coupled Nucleotide Excision Repair (TC-NER)","Dual incision in TC-NER","Gap-filling DNA repair synthesis and ligation in TC-NER","mRNA Splicing - Major Pathway"]	0	[]
POLR2A	0	[]	27	["RNA polymerase","Nucleotide excision repair","Formation of RNA Pol II elongation complex ","RNA Polymerase II Pre-transcription Events","TP53 Regulates Transcription of DNA Repair Genes","RNA Polymerase II Transcription Elongation","Formation of TC-NER Pre-Incision Complex","Transcription-Coupled Nucleotide Excision Repair (TC-NER)","Dual incision in TC-NER","Gap-filling DNA repair synthesis and ligation in TC-NER","mRNA Splicing - Major Pathway","mRNA Splicing - Minor Pathway"]	0	[]

Diseases Linked via Similar Genes

Alzheimer disease Linked via 1 of 5 related genesPOLR2E Autism Linked via 1 of 5 related genesPOLR2E Small vessel stroke Linked via 1 of 5 related genesPOLR2E Charcot-marie-tooth disease Linked via 1 of 5 related genesPOLR2F Hearing loss Linked via 1 of 5 related genesPOLR2F

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Alzheimer disease	1	["POLR2E"]
Autism	1	["POLR2E"]
Small vessel stroke	1	["POLR2E"]
Charcot-marie-tooth disease	1	["POLR2F"]
Hearing loss	1	["POLR2F"]