POLR2K (RNA polymerase II, I and III subunit K)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 5440
• Gene name: RNA polymerase II, I and III subunit K
• Gene symbol: POLR2K
• Synonyms (NCBI Gene): ABC10-alpha, RPABC4, RPB10alpha, RPB12, RPB7.0, hRPB7.0, hsRPB10a
• Chromosome: 8
• Chromosome location: 8q22.2
• Summary: This gene encodes one of the smallest subunits of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. This subunit is shared by the other two DNA-directed RNA polymerases. [provided by RefSeq, Jul 2008]

miRNA Show/Hide all (111)

miRTarBase ID	miRNA	Experiments	Reference
MIRT002738	hsa-miR-1-3p	Microarray	15685193
MIRT002738	hsa-miR-1-3p	Microarray;Other	15685193
MIRT439931	ebv-miR-BART7-3p	HITS-CLIP	22473208
MIRT439931	ebv-miR-BART7-3p	HITS-CLIP	22473208
MIRT1249041	hsa-miR-101	CLIP-seq
MIRT1249042	hsa-miR-1284	CLIP-seq
MIRT1249043	hsa-miR-142-5p	CLIP-seq
MIRT1249044	hsa-miR-144	CLIP-seq
MIRT1249045	hsa-miR-216a	CLIP-seq
MIRT1249046	hsa-miR-216b	CLIP-seq
MIRT1249047	hsa-miR-300	CLIP-seq
MIRT1249048	hsa-miR-302f	CLIP-seq
MIRT1249049	hsa-miR-3148	CLIP-seq
MIRT1249050	hsa-miR-323-3p	CLIP-seq
MIRT1249051	hsa-miR-331-5p	CLIP-seq
MIRT1249052	hsa-miR-340	CLIP-seq
MIRT1249053	hsa-miR-3613-3p	CLIP-seq
MIRT1249054	hsa-miR-3688-3p	CLIP-seq
MIRT1249055	hsa-miR-3691-3p	CLIP-seq
MIRT1249056	hsa-miR-381	CLIP-seq
MIRT1249057	hsa-miR-3924	CLIP-seq
MIRT1249058	hsa-miR-411	CLIP-seq
MIRT1249059	hsa-miR-4257	CLIP-seq
MIRT1249060	hsa-miR-4477a	CLIP-seq
MIRT1249061	hsa-miR-450b-5p	CLIP-seq
MIRT1249062	hsa-miR-4528	CLIP-seq
MIRT1249063	hsa-miR-4666-3p	CLIP-seq
MIRT1249064	hsa-miR-4678	CLIP-seq
MIRT1249065	hsa-miR-4720-3p	CLIP-seq
MIRT1249066	hsa-miR-4747-5p	CLIP-seq
MIRT1249067	hsa-miR-4775	CLIP-seq
MIRT1249068	hsa-miR-4777-5p	CLIP-seq
MIRT1249069	hsa-miR-4789-5p	CLIP-seq
MIRT1249070	hsa-miR-4795-3p	CLIP-seq
MIRT1249071	hsa-miR-4804-3p	CLIP-seq
MIRT1249072	hsa-miR-487a	CLIP-seq
MIRT1249073	hsa-miR-513a-3p	CLIP-seq
MIRT1249074	hsa-miR-518d-5p	CLIP-seq
MIRT1249075	hsa-miR-519b-5p	CLIP-seq
MIRT1249076	hsa-miR-519c-5p	CLIP-seq
MIRT1249077	hsa-miR-520c-5p	CLIP-seq
MIRT1249078	hsa-miR-526a	CLIP-seq
MIRT1249079	hsa-miR-548p	CLIP-seq
MIRT1249080	hsa-miR-568	CLIP-seq
MIRT1249081	hsa-miR-630	CLIP-seq
MIRT2073531	hsa-miR-1	CLIP-seq
MIRT2073532	hsa-miR-1183	CLIP-seq
MIRT2073533	hsa-miR-206	CLIP-seq
MIRT1249045	hsa-miR-216a	CLIP-seq
MIRT1249046	hsa-miR-216b	CLIP-seq
MIRT1249047	hsa-miR-300	CLIP-seq
MIRT1249048	hsa-miR-302f	CLIP-seq
MIRT1249053	hsa-miR-3613-3p	CLIP-seq
MIRT2073534	hsa-miR-3673	CLIP-seq
MIRT1249055	hsa-miR-3691-3p	CLIP-seq
MIRT1249056	hsa-miR-381	CLIP-seq
MIRT2073535	hsa-miR-3936	CLIP-seq
MIRT2073536	hsa-miR-4471	CLIP-seq
MIRT1249063	hsa-miR-4666-3p	CLIP-seq
MIRT2073537	hsa-miR-4671-5p	CLIP-seq
MIRT2073538	hsa-miR-4716-3p	CLIP-seq
MIRT1249065	hsa-miR-4720-3p	CLIP-seq
MIRT1249066	hsa-miR-4747-5p	CLIP-seq
MIRT1249067	hsa-miR-4775	CLIP-seq
MIRT1249069	hsa-miR-4789-5p	CLIP-seq
MIRT2073539	hsa-miR-4799-5p	CLIP-seq
MIRT1249071	hsa-miR-4804-3p	CLIP-seq
MIRT1249079	hsa-miR-548p	CLIP-seq
MIRT2073540	hsa-miR-606	CLIP-seq
MIRT2073541	hsa-miR-613	CLIP-seq
MIRT2073542	hsa-miR-625	CLIP-seq
MIRT2073531	hsa-miR-1	CLIP-seq
MIRT2073532	hsa-miR-1183	CLIP-seq
MIRT2300518	hsa-miR-1245b-3p	CLIP-seq
MIRT2300519	hsa-miR-1278	CLIP-seq
MIRT1249042	hsa-miR-1284	CLIP-seq
MIRT2300520	hsa-miR-1911	CLIP-seq
MIRT2300521	hsa-miR-2052	CLIP-seq
MIRT2073533	hsa-miR-206	CLIP-seq
MIRT1249047	hsa-miR-300	CLIP-seq
MIRT2073534	hsa-miR-3673	CLIP-seq
MIRT1249055	hsa-miR-3691-3p	CLIP-seq
MIRT1249056	hsa-miR-381	CLIP-seq
MIRT2073535	hsa-miR-3936	CLIP-seq
MIRT2300522	hsa-miR-4420	CLIP-seq
MIRT2300523	hsa-miR-4464	CLIP-seq
MIRT2073536	hsa-miR-4471	CLIP-seq
MIRT2300524	hsa-miR-4488	CLIP-seq
MIRT2300525	hsa-miR-451b	CLIP-seq
MIRT1249063	hsa-miR-4666-3p	CLIP-seq
MIRT2073537	hsa-miR-4671-5p	CLIP-seq
MIRT2300526	hsa-miR-4697-5p	CLIP-seq
MIRT2073538	hsa-miR-4716-3p	CLIP-seq
MIRT1249066	hsa-miR-4747-5p	CLIP-seq
MIRT2300527	hsa-miR-4748	CLIP-seq
MIRT2073539	hsa-miR-4799-5p	CLIP-seq
MIRT2073540	hsa-miR-606	CLIP-seq
MIRT2073541	hsa-miR-613	CLIP-seq
MIRT2073542	hsa-miR-625	CLIP-seq
MIRT2300528	hsa-miR-637	CLIP-seq
MIRT2073531	hsa-miR-1	CLIP-seq
MIRT2073533	hsa-miR-206	CLIP-seq
MIRT2073534	hsa-miR-3673	CLIP-seq
MIRT2300522	hsa-miR-4420	CLIP-seq
MIRT2392833	hsa-miR-4433	CLIP-seq
MIRT2392834	hsa-miR-4459	CLIP-seq
MIRT2300524	hsa-miR-4488	CLIP-seq
MIRT2300526	hsa-miR-4697-5p	CLIP-seq
MIRT2392835	hsa-miR-4768-3p	CLIP-seq
MIRT2073541	hsa-miR-613	CLIP-seq
MIRT2300528	hsa-miR-637	CLIP-seq

Gene ontology (GO) Show/Hide all (25)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000428	Component	DNA-directed RNA polymerase complex	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003899	Function	DNA-directed RNA polymerase activity	IBA
GO:0003899	Function	DNA-directed RNA polymerase activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IDA	9852112
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005665	Component	RNA polymerase II, core complex	IBA
GO:0005665	Component	RNA polymerase II, core complex	IDA	9852112
GO:0005666	Component	RNA polymerase III complex	IBA
GO:0005666	Component	RNA polymerase III complex	IDA	33335104, 34675218
GO:0005730	Component	Nucleolus	IEA
GO:0005736	Component	RNA polymerase I complex	IBA
GO:0005736	Component	RNA polymerase I complex	IDA	34671025, 36271492
GO:0005829	Component	Cytosol	TAS
GO:0006351	Process	DNA-templated transcription	IEA
GO:0006356	Process	Regulation of transcription by RNA polymerase I	TAS	7651387
GO:0006366	Process	Transcription by RNA polymerase II	IDA	9852112
GO:0006366	Process	Transcription by RNA polymerase II	TAS	7651387
GO:0006383	Process	Transcription by RNA polymerase III	TAS	7651387
GO:0008270	Function	Zinc ion binding	IEA
GO:0008270	Function	Zinc ion binding	TAS	7651387
GO:0046872	Function	Metal ion binding	IEA

Other IDs

• MIM: 606033
• HGNC: 9198
• e!Ensembl: ENSG00000147669

Protein

• UniProt ID: P53803
• Protein name: DNA-directed RNA polymerases I, II, and III subunit RPABC4 (RNA polymerases I, II, and III subunit ABC4) (ABC10-alpha) (DNA-directed RNA polymerase II subunit K) (RNA polymerase II 7.0 kDa subunit) (RPB7.0) (RPB10alpha)
• Protein function: DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I, II and III which synthesize ribosomal RNA precursors, mRNA precursors and
• PDB: 5IY6 , 5IY7 , 5IY8 , 5IY9 , 5IYA , 5IYB , 5IYC , 5IYD , 6DRD , 6O9L , 6XRE , 7A6H , 7AE1 , 7AE3 , 7AEA , 7AST , 7D58 , 7D59 , 7DN3 , 7DU2 , 7FJI , 7FJJ , 7LBM , 7OB9 , 7OBA , 7OBB , 7VBA , 7VBB , 7VBC , 8A43 , 8ITY , 8IUE , 8IUH , 9EHZ , 9EI1 , 9EI3 , 9EI4 , 9FSO , 9FSP , 9FSQ , 9FSR , 9FSS
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF03604	DNA_RNApol_7kD	17 → 48	DNA directed RNA polymerase, 7 kDa subunit	Domain

• Sequence:

  MDTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLVVFDAR

• Sequence length: 58

Pathways

KEGG Pathway	Reactome Pathway
RNA polymerase	Formation of RNA Pol II elongation complex
Nucleotide excision repair	Formation of the Early Elongation Complex
Cytosolic DNA-sensing pathway	Formation of HIV-1 elongation complex containing HIV-1 Tat
Huntington disease	Viral Messenger RNA Synthesis
	Cytosolic sensors of pathogen-associated DNA
	MicroRNA (miRNA) biogenesis
	B-WICH complex positively regulates rRNA expression
	Transcriptional regulation by small RNAs
	RNA Polymerase II Pre-transcription Events
	Formation of TC-NER Pre-Incision Complex
	Transcription-Coupled Nucleotide Excision Repair (TC-NER)
	Dual incision in TC-NER
	Gap-filling DNA repair synthesis and ligation in TC-NER
	TP53 Regulates Transcription of DNA Repair Genes
	FGFR2 alternative splicing
	RNA polymerase II transcribes snRNA genes
	mRNA Capping
	mRNA Splicing - Major Pathway
	mRNA Splicing - Minor Pathway
	Processing of Capped Intron-Containing Pre-mRNA
	RNA Polymerase I Transcription Initiation
	RNA Polymerase I Promoter Escape
	RNA Polymerase II Promoter Escape
	RNA Polymerase II Transcription Pre-Initiation And Promoter Opening
	RNA Polymerase I Transcription Termination
	RNA Polymerase II Transcription Initiation
	RNA Polymerase II Transcription Elongation
	RNA Polymerase II Transcription Initiation And Promoter Clearance
	RNA Polymerase III Transcription Initiation From Type 1 Promoter
	RNA Polymerase III Transcription Initiation From Type 2 Promoter
	RNA Polymerase III Transcription Initiation From Type 3 Promoter
	RNA Pol II CTD phosphorylation and interaction with CE
	Estrogen-dependent gene expression

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
INTERSTITIAL LUNG DISEASE	—	GWAS catalog	32737115	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Breast Neoplasms	Breast neoplasm	Pubtator	32444848	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	17786358		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	33622336	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

POLR2E 36 shared pathwaysRNA polymerase, Nucleotide excision repair, Cytosolic DNA-sensing pathway, Formation of RNA Pol II elongation complex , RNA Polymerase II Pre-transcription Events, TP53 Regulates Transcription of DNA Repair Genes, RNA Polymerase II Transcription Elongation, Formation of TC-NER Pre-Incision Complex, Transcription-Coupled Nucleotide Excision Repair (TC-NER), Dual incision in TC-NER, Gap-filling DNA repair synthesis and ligation in TC-NER, mRNA Splicing - Major Pathway +24 more Related via 36 shared pathways including RNA polymerase, Nucleotide excision repair. POLR2F 36 shared pathwaysRNA polymerase, Nucleotide excision repair, Cytosolic DNA-sensing pathway, Formation of RNA Pol II elongation complex , RNA Polymerase II Pre-transcription Events, TP53 Regulates Transcription of DNA Repair Genes, RNA Polymerase II Transcription Elongation, Formation of TC-NER Pre-Incision Complex, Transcription-Coupled Nucleotide Excision Repair (TC-NER), Dual incision in TC-NER, Gap-filling DNA repair synthesis and ligation in TC-NER, mRNA Splicing - Major Pathway +24 more Related via 36 shared pathways including RNA polymerase, Nucleotide excision repair. POLR2H 36 shared pathwaysRNA polymerase, Nucleotide excision repair, Cytosolic DNA-sensing pathway, Formation of RNA Pol II elongation complex , RNA Polymerase II Pre-transcription Events, TP53 Regulates Transcription of DNA Repair Genes, RNA Polymerase II Transcription Elongation, Formation of TC-NER Pre-Incision Complex, Transcription-Coupled Nucleotide Excision Repair (TC-NER), Dual incision in TC-NER, Gap-filling DNA repair synthesis and ligation in TC-NER, mRNA Splicing - Major Pathway +24 more Related via 36 shared pathways including RNA polymerase, Nucleotide excision repair. POLR2L 36 shared pathwaysRNA polymerase, Nucleotide excision repair, Cytosolic DNA-sensing pathway, Formation of RNA Pol II elongation complex , RNA Polymerase II Pre-transcription Events, TP53 Regulates Transcription of DNA Repair Genes, RNA Polymerase II Transcription Elongation, Formation of TC-NER Pre-Incision Complex, Transcription-Coupled Nucleotide Excision Repair (TC-NER), Dual incision in TC-NER, Gap-filling DNA repair synthesis and ligation in TC-NER, mRNA Splicing - Major Pathway +24 more Related via 36 shared pathways including RNA polymerase, Nucleotide excision repair. POLR2A 27 shared pathwaysRNA polymerase, Nucleotide excision repair, Formation of RNA Pol II elongation complex , RNA Polymerase II Pre-transcription Events, TP53 Regulates Transcription of DNA Repair Genes, RNA Polymerase II Transcription Elongation, Formation of TC-NER Pre-Incision Complex, Transcription-Coupled Nucleotide Excision Repair (TC-NER), Dual incision in TC-NER, Gap-filling DNA repair synthesis and ligation in TC-NER, mRNA Splicing - Major Pathway, mRNA Splicing - Minor Pathway +15 more Related via 27 shared pathways including RNA polymerase, Nucleotide excision repair.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
POLR2E	0	[]	36	["RNA polymerase","Nucleotide excision repair","Cytosolic DNA-sensing pathway","Formation of RNA Pol II elongation complex ","RNA Polymerase II Pre-transcription Events","TP53 Regulates Transcription of DNA Repair Genes","RNA Polymerase II Transcription Elongation","Formation of TC-NER Pre-Incision Complex","Transcription-Coupled Nucleotide Excision Repair (TC-NER)","Dual incision in TC-NER","Gap-filling DNA repair synthesis and ligation in TC-NER","mRNA Splicing - Major Pathway"]	0	[]
POLR2F	0	[]	36	["RNA polymerase","Nucleotide excision repair","Cytosolic DNA-sensing pathway","Formation of RNA Pol II elongation complex ","RNA Polymerase II Pre-transcription Events","TP53 Regulates Transcription of DNA Repair Genes","RNA Polymerase II Transcription Elongation","Formation of TC-NER Pre-Incision Complex","Transcription-Coupled Nucleotide Excision Repair (TC-NER)","Dual incision in TC-NER","Gap-filling DNA repair synthesis and ligation in TC-NER","mRNA Splicing - Major Pathway"]	0	[]
POLR2H	0	[]	36	["RNA polymerase","Nucleotide excision repair","Cytosolic DNA-sensing pathway","Formation of RNA Pol II elongation complex ","RNA Polymerase II Pre-transcription Events","TP53 Regulates Transcription of DNA Repair Genes","RNA Polymerase II Transcription Elongation","Formation of TC-NER Pre-Incision Complex","Transcription-Coupled Nucleotide Excision Repair (TC-NER)","Dual incision in TC-NER","Gap-filling DNA repair synthesis and ligation in TC-NER","mRNA Splicing - Major Pathway"]	0	[]
POLR2L	0	[]	36	["RNA polymerase","Nucleotide excision repair","Cytosolic DNA-sensing pathway","Formation of RNA Pol II elongation complex ","RNA Polymerase II Pre-transcription Events","TP53 Regulates Transcription of DNA Repair Genes","RNA Polymerase II Transcription Elongation","Formation of TC-NER Pre-Incision Complex","Transcription-Coupled Nucleotide Excision Repair (TC-NER)","Dual incision in TC-NER","Gap-filling DNA repair synthesis and ligation in TC-NER","mRNA Splicing - Major Pathway"]	0	[]
POLR2A	0	[]	27	["RNA polymerase","Nucleotide excision repair","Formation of RNA Pol II elongation complex ","RNA Polymerase II Pre-transcription Events","TP53 Regulates Transcription of DNA Repair Genes","RNA Polymerase II Transcription Elongation","Formation of TC-NER Pre-Incision Complex","Transcription-Coupled Nucleotide Excision Repair (TC-NER)","Dual incision in TC-NER","Gap-filling DNA repair synthesis and ligation in TC-NER","mRNA Splicing - Major Pathway","mRNA Splicing - Minor Pathway"]	0	[]

Diseases Linked via Similar Genes

Alzheimer disease Linked via 1 of 5 related genesPOLR2E Autism Linked via 1 of 5 related genesPOLR2E Small vessel stroke Linked via 1 of 5 related genesPOLR2E Charcot-marie-tooth disease Linked via 1 of 5 related genesPOLR2F Hearing loss Linked via 1 of 5 related genesPOLR2F

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Alzheimer disease	1	["POLR2E"]
Autism	1	["POLR2E"]
Small vessel stroke	1	["POLR2E"]
Charcot-marie-tooth disease	1	["POLR2F"]
Hearing loss	1	["POLR2F"]