OXGR1 (oxoglutarate receptor 1)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 27199
Gene name Oxoglutarate receptor 1
Gene symbol OXGR1
Synonyms (NCBI Gene)
CAON2GPR80GPR99P2RY15P2Y15aKGR
Chromosome 13
Chromosome location 13q32.1
Summary This gene encodes a G protein-coupled receptor (GPCR) that belongs to the oxoglutarate receptor family within the GPCR superfamily. The encoded protein is activated by the citric acid intermediate, oxoglutarate, as well as several cysteinyl leukotrienes,
miRNA miRNA information provided by mirtarbase database.
40 Show/Hide all (40)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT018985 hsa-miR-335-5p Microarray 18185580
MIRT497757 hsa-miR-548at-5p PAR-CLIP 22291592
MIRT497756 hsa-miR-100-3p PAR-CLIP 22291592
MIRT497755 hsa-miR-651-3p PAR-CLIP 22291592
MIRT497754 hsa-miR-216a-5p PAR-CLIP 22291592
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
20 Show/Hide all (20)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0002376 Process Immune system process IEA
GO:0004930 Function G protein-coupled receptor activity IDA 36919698
GO:0004930 Function G protein-coupled receptor activity IEA
GO:0004930 Function G protein-coupled receptor activity IMP 36571463
GO:0005886 Component Plasma membrane IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
606922 4531 ENSG00000165621
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q96P68
Protein name 2-oxoglutarate receptor 1 (Alpha-ketoglutarate receptor 1) (G-protein coupled receptor 80) (G-protein coupled receptor 99) (P2Y purinoceptor 15) (P2Y15) (P2Y-like GPCR) (P2Y-like nucleotide receptor)
Protein function G protein-coupled receptor for dicarboxylates and amino dicarboxylates (PubMed:15141213, PubMed:36571463, PubMed:36919698). Receptor for itaconate, a metabolite produced by myeloid lineages (PubMed:36919698). In the respiratory epithelium, coupl
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00001 7tm_1 50 → 302 7 transmembrane receptor (rhodopsin family) Family
Tissue specificity TISSUE SPECIFICITY: Detected in kidney and, to a lower extent, in placenta. Not detected in brain tissues including the frontal cortex, caudate putamen, thalamus, hypothalamus, hippocampus or pons.
Sequence 
MNEPLDYLANASDFPDYAAAFGNCTDENIPLKMHYLPVIYGIIFLVGFPGNAVVISTYIF
KMRPWKSSTIIMLNLACTDLLYLTSLPFLIHYYASGENWIFGDFMCKFIRFSFHFNLYSS
ILFLTCFSIFRYCVIIHPMSCFSIHKTRCAVVACAVVWIISLVAVIPMTFLITSTNRTNR
SACLDLTSSDELNTIKWYNLILTATTFCLPLVIVTLCYTTIIHTLTHGLQTDSCLKQKAR
RLTILLLLAFYVCFLPFHILRVIRIESRLLSISCSIENQIHEAYIVSRPLAALNTFGNLL
LYVVVSDNFQQAVCSTVRCKVSGNLEQAKKISYSNNP
Sequence length 337
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
Reactome Pathway
Class A/1 (Rhodopsin-like receptors)
G alpha (i) signalling events
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
2
Download as csvDownload as pdf
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Nephrolithiasis, calcium oxalate, 2, with or without nephrocalcinosis Likely pathogenic; Pathogenic rs780034038, rs2501845489, rs1305041953 RCV003228564
RCV003228565
RCV003228567
★★★★★
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Reference Evidence Score
NEPHROLITHIASIS, CALCIUM OXALATE, 1 — Disgenet —
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Congestive heart failure Congestive Heart Failure BEFREE 27693579
★★★★★
★☆☆☆☆
Found in Text Mining only
Heart failure Heart Failure BEFREE 27693579
★★★★★
★☆☆☆☆
Found in Text Mining only
Liver carcinoma Liver carcinoma BEFREE 19760608
★★★★★
★☆☆☆☆
Found in Text Mining only
Sort by:
CNR2 2 shared pathwaysG alpha (i) signalling events, Class A/1 (Rhodopsin-like receptors) Related via 2 shared pathways including G alpha (i) signalling events, Class A/1 (Rhodopsin-like receptors). GPR183 2 shared pathwaysG alpha (i) signalling events, Class A/1 (Rhodopsin-like receptors) Related via 2 shared pathways including G alpha (i) signalling events, Class A/1 (Rhodopsin-like receptors). GPR18 2 shared pathwaysG alpha (i) signalling events, Class A/1 (Rhodopsin-like receptors) Related via 2 shared pathways including G alpha (i) signalling events, Class A/1 (Rhodopsin-like receptors). GPR55 2 shared pathwaysG alpha (i) signalling events, Class A/1 (Rhodopsin-like receptors) Related via 2 shared pathways including G alpha (i) signalling events, Class A/1 (Rhodopsin-like receptors). MTNR1A 2 shared pathwaysG alpha (i) signalling events, Class A/1 (Rhodopsin-like receptors) Related via 2 shared pathways including G alpha (i) signalling events, Class A/1 (Rhodopsin-like receptors).
Inflammatory bowel disease Linked via 3 of 5 related genesCNR2, GPR183, GPR18 Major depressive disorder Linked via 2 of 5 related genesCNR2, GPR55 Hyperglycemia Linked via 2 of 5 related genesCNR2, GPR55 Schizophrenia Linked via 2 of 5 related genesCNR2, MTNR1A Crohn disease Linked via 2 of 5 related genesGPR183, GPR18