CNR2 (cannabinoid receptor 2)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 1269
• Gene name: Cannabinoid receptor 2
• Gene symbol: CNR2
• Synonyms (NCBI Gene): CB-2, CB2, CX5
• Chromosome: 1
• Chromosome location: 1p36.11
• Summary: The cannabinoid delta-9-tetrahydrocannabinol is the principal psychoactive ingredient of marijuana. The proteins encoded by this gene and the cannabinoid receptor 1 (brain) (CNR1) gene have the characteristics of a guanine nucleotide-binding protein (G-pr

miRNA Show/Hide all (46)

miRTarBase ID	miRNA	Experiments	Reference
MIRT438440	hsa-miR-665	Luciferase reporter assay, Western blot	25111814
MIRT438440	hsa-miR-665	Luciferase reporter assay, Western blot	25111814
MIRT438440	hsa-miR-665	Luciferase reporter assay, Western blot	25111814
MIRT438440	hsa-miR-665	Luciferase reporter assay, Western blot	25111814
MIRT438440	hsa-miR-665	Luciferase reporter assay, Western blot	25111814
MIRT438440	hsa-miR-665	Luciferase reporter assay, Western blot	25111814
MIRT438440	hsa-miR-665	Luciferase reporter assay, Western blot	25111814
MIRT438440	hsa-miR-665	Luciferase reporter assay, Western blot	25111814
MIRT438440	hsa-miR-665	Luciferase reporter assay, Western blot	25111814
MIRT438440	hsa-miR-665	Luciferase reporter assay, Western blot	25111814
MIRT438440	hsa-miR-665	Luciferase reporter assay, Western blot	25111814
MIRT438440	hsa-miR-665	Luciferase reporter assay, Western blot	25111814
MIRT438440	hsa-miR-665	Luciferase reporter assay, Western blot	25111814
MIRT438440	hsa-miR-665	Luciferase reporter assay, Western blot	25111814
MIRT438440	hsa-miR-665	Luciferase reporter assay, Western blot	25111814
MIRT438440	hsa-miR-665	Luciferase reporter assay, Western blot	25111814
MIRT438440	hsa-miR-665	Luciferase reporter assay, Western blot	25111814
MIRT438440	hsa-miR-665	Luciferase reporter assay, Western blot	25111814
MIRT438440	hsa-miR-665	Luciferase reporter assay, Western blot	25111814
MIRT438440	hsa-miR-665	Luciferase reporter assay, Western blot	25111814
MIRT438440	hsa-miR-665	Luciferase reporter assay, Western blot	25111814
MIRT438440	hsa-miR-665	Luciferase reporter assay, Western blot	25111814
MIRT438440	hsa-miR-665	Luciferase reporter assay, Western blot	25111814
MIRT438440	hsa-miR-665	Luciferase reporter assay, Western blot	25111814
MIRT438440	hsa-miR-665	Luciferase reporter assay, Western blot	25111814
MIRT438440	hsa-miR-665	Luciferase reporter assay, Western blot	25111814
MIRT438440	hsa-miR-665	Luciferase reporter assay, Western blot	25111814
MIRT438440	hsa-miR-665	Luciferase reporter assay, Western blot	25111814
MIRT901403	hsa-miR-1253	CLIP-seq
MIRT901404	hsa-miR-2964a-5p	CLIP-seq
MIRT901405	hsa-miR-3661	CLIP-seq
MIRT901406	hsa-miR-4764-5p	CLIP-seq
MIRT901407	hsa-miR-619	CLIP-seq
MIRT901408	hsa-miR-631	CLIP-seq
MIRT2447350	hsa-miR-1245b-5p	CLIP-seq
MIRT2447351	hsa-miR-3142	CLIP-seq
MIRT2447352	hsa-miR-3173-3p	CLIP-seq
MIRT2447353	hsa-miR-4695-5p	CLIP-seq
MIRT2447354	hsa-miR-520a-5p	CLIP-seq
MIRT2447355	hsa-miR-525-5p	CLIP-seq
MIRT2447350	hsa-miR-1245b-5p	CLIP-seq
MIRT2447351	hsa-miR-3142	CLIP-seq
MIRT2447352	hsa-miR-3173-3p	CLIP-seq
MIRT2447353	hsa-miR-4695-5p	CLIP-seq
MIRT2447354	hsa-miR-520a-5p	CLIP-seq
MIRT2447355	hsa-miR-525-5p	CLIP-seq

Gene ontology (GO) Show/Hide all (32)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001975	Process	Response to amphetamine	IEA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004949	Function	Cannabinoid receptor activity	IBA
GO:0004949	Function	Cannabinoid receptor activity	IEA
GO:0004949	Function	Cannabinoid receptor activity	TAS	8679694
GO:0005515	Function	Protein binding	IPI	31616248, 32296183
GO:0005737	Component	Cytoplasm	IBA
GO:0005783	Component	Endoplasmic reticulum	IDA	28364261
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	8679694
GO:0006954	Process	Inflammatory response	IEA
GO:0006955	Process	Immune response	TAS	7556170
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007187	Process	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	IEA
GO:0007187	Process	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	TAS	8679694
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IBA
GO:0016020	Component	Membrane	IEA
GO:0030425	Component	Dendrite	IEA
GO:0030595	Process	Leukocyte chemotaxis	IEA
GO:0031234	Component	Extrinsic component of cytoplasmic side of plasma membrane	IEA
GO:0032229	Process	Negative regulation of synaptic transmission, GABAergic	IEA
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0033004	Process	Negative regulation of mast cell activation	IEA
GO:0038171	Process	Cannabinoid signaling pathway	IEA
GO:0042995	Component	Cell projection	IEA
GO:0043025	Component	Neuronal cell body	IEA
GO:0043204	Component	Perikaryon	IEA
GO:0045211	Component	Postsynaptic membrane	IEA
GO:0045759	Process	Negative regulation of action potential	IEA
GO:0099553	Process	Trans-synaptic signaling by endocannabinoid, modulating synaptic transmission	IEA

Other IDs

• MIM: 605051
• HGNC: 2160
• e!Ensembl: ENSG00000188822

Protein

• UniProt ID: P34972
• Protein name: Cannabinoid receptor 2 (CB-2) (CB2) (hCB2) (CX5)
• Protein function: Heterotrimeric G protein-coupled receptor for endocannabinoid 2-arachidonoylglycerol mediating inhibition of adenylate cyclase. May function in inflammatory response, nociceptive transmission and bone homeostasis. {ECO:0000269|PubMed:10051546, E
• PDB: 2KI9 , 5ZTY , 6KPC , 6KPF , 6PT0 , 8GUQ , 8GUR , 8GUS , 8GUT , 8X3L
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	50 → 299	7 transmembrane receptor (rhodopsin family)	Family

• Tissue specificity: TISSUE SPECIFICITY: Preferentially expressed in cells of the immune system with higher expression in B-cells and NK cells (at protein level). Expressed in skin in suprabasal layers and hair follicles (at protein level). Highly expressed in tonsil and to a
• Sequence:

  MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILS
  SHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTAS
  VGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCS
  ELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLD
  VRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYA
  LRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC
  

• Sequence length: 360

Pathways

KEGG Pathway	Reactome Pathway
Neuroactive ligand-receptor interaction	Class A/1 (Rhodopsin-like receptors)
	G alpha (i) signalling events

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (26)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
ANTERIOR CRUCIATE LIGAMENT INJURIES	—	CTD	34537380	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATHEROSCLEROSIS	—	CTD, Disgenet CTD, Disgenet	15815632	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	16818634	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANNABIS USE	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CATALEPSY	—	CTD, Disgenet CTD, Disgenet	31877572	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHOLESTASIS	—	CTD, Disgenet CTD, Disgenet	26884397	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	CTD, Disgenet CTD, Disgenet	18286196	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DISORDERS INVOLVING THE IMMUNE MECHANISM	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL NEOPLASMS	—	CTD	29805589	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERALGESIA	—	CTD	17572696, 18664590	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPEREMIA	—	CTD, Disgenet CTD, Disgenet	27611972	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERGLYCEMIA	—	CTD, Disgenet CTD, Disgenet	32365865	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IMMUNE SYSTEM DISEASES	—	CTD	16924491	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASES	—	CTD, Disgenet CTD, Disgenet	30102254	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA, MYELOID, ACUTE	—	CTD	15039279	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS	—	CTD, Disgenet CTD, Disgenet	15765409	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATIC NEOPLASMS	—	CTD	16818650	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATITIS	—	CTD, Disgenet CTD, Disgenet	17484889	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE, SECONDARY	—	CTD	27317300	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POST-TRAUMATIC STRESS DISORDER	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCLERODERMA, SYSTEMIC	—	CTD	27228633	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SECONDARY PARKINSON DISEASE	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC SCLERODERMA	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Related Genes

Sort by: Blended Diseases Pathways Evidence source

CNR1 11 shared diseasesCannabis abuse, Catalepsy, Cholelithiasis, Pancreatitis, Liver cirrhosis, Endometrial neoplasms, Hyperalgesia, Pancreatic neoplasms, Post-traumatic stress disorder, Scleroderma, Systemic sclerosis 2 shared pathwaysG alpha (i) signalling events, Class A/1 (Rhodopsin-like receptors) 15 shared evidence sourcesDisgenet (Cannabis abuse), CTD (Catalepsy), Disgenet (Catalepsy), CTD (Cholelithiasis), Disgenet (Cholelithiasis), CTD (Endometrial neoplasms), CTD (Hyperalgesia), CTD (Liver cirrhosis), Disgenet (Liver cirrhosis), CTD (Pancreatic neoplasms), Disgenet (Pancreatitis), CTD (Pancreatitis) +3 more Related via 11 shared diseases including Cannabis abuse, Catalepsy — evidence mostly CTD. GPR55 1 shared diseaseHyperglycemia 2 shared pathwaysG alpha (i) signalling events, Class A/1 (Rhodopsin-like receptors) 2 shared evidence sourcesCTD (Hyperglycemia), Disgenet (Hyperglycemia) Related via 2 shared pathways including G alpha (i) signalling events, Class A/1 (Rhodopsin-like receptors) — evidence mostly CTD. GPR183 2 shared pathwaysG alpha (i) signalling events, Class A/1 (Rhodopsin-like receptors) Related via 2 shared pathways including G alpha (i) signalling events, Class A/1 (Rhodopsin-like receptors). OXGR1 2 shared pathwaysG alpha (i) signalling events, Class A/1 (Rhodopsin-like receptors) Related via 2 shared pathways including G alpha (i) signalling events, Class A/1 (Rhodopsin-like receptors). GPR18 2 shared pathwaysG alpha (i) signalling events, Class A/1 (Rhodopsin-like receptors) Related via 2 shared pathways including G alpha (i) signalling events, Class A/1 (Rhodopsin-like receptors).

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
CNR1	11	["Cannabis abuse","Catalepsy","Cholelithiasis","Pancreatitis","Liver cirrhosis","Endometrial neoplasms","Hyperalgesia","Pancreatic neoplasms","Post-traumatic stress disorder","Scleroderma","Systemic sclerosis"]	2	["G alpha (i) signalling events","Class A\/1 (Rhodopsin-like receptors)"]	15	["Disgenet (Cannabis abuse)","CTD (Catalepsy)","Disgenet (Catalepsy)","CTD (Cholelithiasis)","Disgenet (Cholelithiasis)","CTD (Endometrial neoplasms)","CTD (Hyperalgesia)","CTD (Liver cirrhosis)","Disgenet (Liver cirrhosis)","CTD (Pancreatic neoplasms)","Disgenet (Pancreatitis)","CTD (Pancreatitis)"]
GPR55	1	["Hyperglycemia"]	2	["G alpha (i) signalling events","Class A\/1 (Rhodopsin-like receptors)"]	2	["CTD (Hyperglycemia)","Disgenet (Hyperglycemia)"]
GPR183	0	[]	2	["G alpha (i) signalling events","Class A\/1 (Rhodopsin-like receptors)"]	0	[]
OXGR1	0	[]	2	["G alpha (i) signalling events","Class A\/1 (Rhodopsin-like receptors)"]	0	[]
GPR18	0	[]	2	["G alpha (i) signalling events","Class A\/1 (Rhodopsin-like receptors)"]	0	[]

Diseases Linked via Similar Genes

Crohn disease Linked via 2 of 5 related genesGPR183, GPR18 Ulcerative colitis Linked via 2 of 5 related genesGPR183, GPR18 Anxiety disorder Linked via 1 of 5 related genesCNR1 Attention deficit hyperactivity disorder Linked via 1 of 5 related genesCNR1 Binge eating disorder Linked via 1 of 5 related genesCNR1

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Crohn disease	2	["GPR183","GPR18"]
Ulcerative colitis	2	["GPR183","GPR18"]
Anxiety disorder	1	["CNR1"]
Attention deficit hyperactivity disorder	1	["CNR1"]
Binge eating disorder	1	["CNR1"]