CNR1 (cannabinoid receptor 1)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 1268
• Gene name: Cannabinoid receptor 1
• Gene symbol: CNR1
• Synonyms (NCBI Gene): CANN6, CB-R, CB1, CB1A, CB1K5, CB1R, CNR
• Chromosome: 6
• Chromosome location: 6q15
• Summary: This gene encodes one of two cannabinoid receptors. The cannabinoids, principally delta-9-tetrahydrocannabinol and synthetic analogs, are psychoactive ingredients of marijuana. The cannabinoid receptors are members of the guanine-nucleotide-binding protei

miRNA Show/Hide all (135)

miRTarBase ID	miRNA	Experiments	Reference
MIRT438441	hsa-miR-494-3p	Luciferase reporter assay, Western blot	25111814
MIRT438441	hsa-miR-494-3p	Luciferase reporter assay, Western blot	25111814
MIRT438441	hsa-miR-494-3p	Luciferase reporter assay, Western blot	25111814
MIRT438441	hsa-miR-494-3p	Luciferase reporter assay, Western blot	25111814
MIRT438441	hsa-miR-494-3p	Luciferase reporter assay, Western blot	25111814
MIRT438441	hsa-miR-494-3p	Luciferase reporter assay, Western blot	25111814
MIRT755408	hsa-miR-212-5p	Luciferase reporter assay, Western blotting, qRT-PCR	35978628
MIRT901338	hsa-miR-1183	CLIP-seq
MIRT901339	hsa-miR-1225-5p	CLIP-seq
MIRT901340	hsa-miR-132	CLIP-seq
MIRT901341	hsa-miR-194	CLIP-seq
MIRT901342	hsa-miR-212	CLIP-seq
MIRT901343	hsa-miR-214	CLIP-seq
MIRT901344	hsa-miR-29a	CLIP-seq
MIRT901345	hsa-miR-29b	CLIP-seq
MIRT901346	hsa-miR-29c	CLIP-seq
MIRT901347	hsa-miR-3155	CLIP-seq
MIRT901348	hsa-miR-3155b	CLIP-seq
MIRT901349	hsa-miR-323-3p	CLIP-seq
MIRT901350	hsa-miR-3591-5p	CLIP-seq
MIRT901351	hsa-miR-3619-5p	CLIP-seq
MIRT901352	hsa-miR-425	CLIP-seq
MIRT901353	hsa-miR-4473	CLIP-seq
MIRT901354	hsa-miR-4475	CLIP-seq
MIRT901355	hsa-miR-4514	CLIP-seq
MIRT901356	hsa-miR-4522	CLIP-seq
MIRT901357	hsa-miR-4530	CLIP-seq
MIRT901358	hsa-miR-4643	CLIP-seq
MIRT901359	hsa-miR-4671-3p	CLIP-seq
MIRT901360	hsa-miR-4690-5p	CLIP-seq
MIRT901361	hsa-miR-4692	CLIP-seq
MIRT901362	hsa-miR-4693-5p	CLIP-seq
MIRT901363	hsa-miR-4712-5p	CLIP-seq
MIRT901364	hsa-miR-4714-5p	CLIP-seq
MIRT901365	hsa-miR-484	CLIP-seq
MIRT901366	hsa-miR-512-3p	CLIP-seq
MIRT901367	hsa-miR-516a-5p	CLIP-seq
MIRT901368	hsa-miR-520f	CLIP-seq
MIRT901369	hsa-miR-626	CLIP-seq
MIRT901370	hsa-miR-761	CLIP-seq
MIRT901371	hsa-miR-770-5p	CLIP-seq
MIRT901372	hsa-miR-1178	CLIP-seq
MIRT901373	hsa-miR-1279	CLIP-seq
MIRT901374	hsa-miR-134	CLIP-seq
MIRT901375	hsa-miR-1343	CLIP-seq
MIRT901376	hsa-miR-137	CLIP-seq
MIRT901377	hsa-miR-141	CLIP-seq
MIRT901378	hsa-miR-200a	CLIP-seq
MIRT901379	hsa-miR-216a	CLIP-seq
MIRT901380	hsa-miR-216b	CLIP-seq
MIRT901381	hsa-miR-3074-5p	CLIP-seq
MIRT901382	hsa-miR-3118	CLIP-seq
MIRT901383	hsa-miR-3124-3p	CLIP-seq
MIRT901384	hsa-miR-3128	CLIP-seq
MIRT901385	hsa-miR-3136-5p	CLIP-seq
MIRT901350	hsa-miR-3591-5p	CLIP-seq
MIRT901386	hsa-miR-3606	CLIP-seq
MIRT901387	hsa-miR-374c	CLIP-seq
MIRT901388	hsa-miR-4265	CLIP-seq
MIRT901389	hsa-miR-4296	CLIP-seq
MIRT901390	hsa-miR-4318	CLIP-seq
MIRT901391	hsa-miR-4322	CLIP-seq
MIRT901392	hsa-miR-4417	CLIP-seq
MIRT901393	hsa-miR-4439	CLIP-seq
MIRT901394	hsa-miR-4513	CLIP-seq
MIRT901395	hsa-miR-4659a-3p	CLIP-seq
MIRT901396	hsa-miR-4659b-3p	CLIP-seq
MIRT901362	hsa-miR-4693-5p	CLIP-seq
MIRT901397	hsa-miR-4778-3p	CLIP-seq
MIRT901398	hsa-miR-578	CLIP-seq
MIRT901399	hsa-miR-643	CLIP-seq
MIRT901400	hsa-miR-655	CLIP-seq
MIRT901401	hsa-miR-892a	CLIP-seq
MIRT901402	hsa-miR-921	CLIP-seq
MIRT901381	hsa-miR-3074-5p	CLIP-seq
MIRT1967395	hsa-miR-377	CLIP-seq
MIRT2203017	hsa-miR-4700-3p	CLIP-seq
MIRT2203018	hsa-let-7a	CLIP-seq
MIRT2203019	hsa-let-7b	CLIP-seq
MIRT2203020	hsa-let-7c	CLIP-seq
MIRT2203021	hsa-let-7d	CLIP-seq
MIRT2203022	hsa-let-7e	CLIP-seq
MIRT2203023	hsa-let-7f	CLIP-seq
MIRT2203024	hsa-let-7g	CLIP-seq
MIRT2203025	hsa-let-7i	CLIP-seq
MIRT2203026	hsa-miR-1229	CLIP-seq
MIRT2203027	hsa-miR-128	CLIP-seq
MIRT2203028	hsa-miR-151-3p	CLIP-seq
MIRT901341	hsa-miR-194	CLIP-seq
MIRT2203029	hsa-miR-202	CLIP-seq
MIRT2203030	hsa-miR-2116	CLIP-seq
MIRT2203031	hsa-miR-27a	CLIP-seq
MIRT2203032	hsa-miR-27b	CLIP-seq
MIRT2203033	hsa-miR-3187-3p	CLIP-seq
MIRT901349	hsa-miR-323-3p	CLIP-seq
MIRT2203034	hsa-miR-4257	CLIP-seq
MIRT2203035	hsa-miR-4328	CLIP-seq
MIRT2203036	hsa-miR-4435	CLIP-seq
MIRT2203037	hsa-miR-4458	CLIP-seq
MIRT2203038	hsa-miR-4500	CLIP-seq
MIRT901358	hsa-miR-4643	CLIP-seq
MIRT2203039	hsa-miR-4645-5p	CLIP-seq
MIRT901395	hsa-miR-4659a-3p	CLIP-seq
MIRT901396	hsa-miR-4659b-3p	CLIP-seq
MIRT2203040	hsa-miR-4673	CLIP-seq
MIRT2203017	hsa-miR-4700-3p	CLIP-seq
MIRT2203041	hsa-miR-4701-5p	CLIP-seq
MIRT901397	hsa-miR-4778-3p	CLIP-seq
MIRT2203042	hsa-miR-548s	CLIP-seq
MIRT901398	hsa-miR-578	CLIP-seq
MIRT2203043	hsa-miR-588	CLIP-seq
MIRT2203044	hsa-miR-617	CLIP-seq
MIRT2203045	hsa-miR-653	CLIP-seq
MIRT2203046	hsa-miR-890	CLIP-seq
MIRT2203047	hsa-miR-98	CLIP-seq
MIRT2386297	hsa-miR-1289	CLIP-seq
MIRT2386298	hsa-miR-3198	CLIP-seq
MIRT2386299	hsa-miR-4294	CLIP-seq
MIRT2386300	hsa-miR-4309	CLIP-seq
MIRT2386301	hsa-miR-4790-3p	CLIP-seq
MIRT2505992	hsa-miR-3115	CLIP-seq
MIRT2505993	hsa-miR-4735-5p	CLIP-seq
MIRT2505994	hsa-miR-4777-5p	CLIP-seq
MIRT2505995	hsa-miR-518d-5p	CLIP-seq
MIRT2505996	hsa-miR-519b-5p	CLIP-seq
MIRT2505997	hsa-miR-519c-5p	CLIP-seq
MIRT2505998	hsa-miR-520c-5p	CLIP-seq
MIRT2505999	hsa-miR-526a	CLIP-seq
MIRT2506000	hsa-miR-944	CLIP-seq
MIRT2505994	hsa-miR-4777-5p	CLIP-seq
MIRT2505995	hsa-miR-518d-5p	CLIP-seq
MIRT2505996	hsa-miR-519b-5p	CLIP-seq
MIRT2505997	hsa-miR-519c-5p	CLIP-seq
MIRT2505998	hsa-miR-520c-5p	CLIP-seq
MIRT2505999	hsa-miR-526a	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
STAT6	Activation	18156315

Gene ontology (GO) Show/Hide all (37)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004930	Function	G protein-coupled receptor activity	IBA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004949	Function	Cannabinoid receptor activity	IDA	18761332
GO:0004949	Function	Cannabinoid receptor activity	IEA
GO:0004949	Function	Cannabinoid receptor activity	TAS	1718258
GO:0005515	Function	Protein binding	IPI	17356572, 17895407, 23296780, 28102227
GO:0005737	Component	Cytoplasm	IBA
GO:0005739	Component	Mitochondrion	IEA
GO:0005739	Component	Mitochondrion	IEA
GO:0005741	Component	Mitochondrial outer membrane	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	17895407
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	1718258
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007187	Process	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	IEA
GO:0007187	Process	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	TAS	1718258
GO:0007188	Process	Adenylate cyclase-modulating G protein-coupled receptor signaling pathway	IDA	18761332
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IBA
GO:0007413	Process	Axonal fasciculation	IEA
GO:0015629	Component	Actin cytoskeleton	IDA
GO:0016020	Component	Membrane	IEA
GO:0030424	Component	Axon	IEA
GO:0030426	Component	Growth cone	IEA
GO:0038171	Process	Cannabinoid signaling pathway	IDA	17895407
GO:0042593	Process	Glucose homeostasis	IEA
GO:0042734	Component	Presynaptic membrane	IEA
GO:0042802	Function	Identical protein binding	IPI	20590567, 28734930
GO:0042995	Component	Cell projection	IEA
GO:0045121	Component	Membrane raft	IEA
GO:0045202	Component	Synapse	IEA
GO:0098793	Component	Presynapse	IEA
GO:0098921	Process	Retrograde trans-synaptic signaling by endocannabinoid	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0098982	Component	GABA-ergic synapse	IEA
GO:0099509	Process	Regulation of presynaptic cytosolic calcium ion concentration	IEA

Other IDs

• MIM: 114610
• HGNC: 2159
• e!Ensembl: ENSG00000118432

Protein

• UniProt ID: P21554
• Protein name: Cannabinoid receptor 1 (CB-R) (CB1) (CANN6)
• Protein function: G-protein coupled receptor for endogenous cannabinoids (eCBs), including N-arachidonoylethanolamide (also called anandamide or AEA) and 2-arachidonoylglycerol (2-AG), as well as phytocannabinoids, such as delta(9)-tetrahydrocannabinol (THC) (Pub
• PDB: 1LVQ , 1LVR , 2B0Y , 2KOE , 2MZ2 , 2MZ3 , 2MZA , 5TGZ , 5U09 , 5XR8 , 5XRA , 6KPG , 6KQI , 6N4B , 7FEE , 7V3Z , 7WV9 , 8GAG , 8GHV , 8IKG , 8IKH , 8K8J , 8WRZ , 8WU1 , 9B54 , 9B65 , 9B9Y , 9B9Z , 9BA0 , 9ERX
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	133 → 397	7 transmembrane receptor (rhodopsin family)	Family

• Tissue specificity: TISSUE SPECIFICITY: Widely expressed, with highest levels in fetal and adult brain. Expression levels of isoform 2 and isoform 3 are much lower than those of isoform 1. {ECO:0000269|PubMed:15620723}.
• Sequence:

  MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQE
  KMTAGDNPQLVPADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMVLNPSQQLAIA
  VLSLTLGTFTVLENLLVLCVILHSRSLRCRPSYHFIGSLAVADLLGSVIFVYSFIDFHVF
  HRKDSRNVFLFKLGGVTASFTASVGSLFLTAIDRYISIHRPLAYKRIVTRPKAVVAFCLM
  WTIAIVIAVLPLLGWNCEKLQSVCSDIFPHIDETYLMFWIGVTSVLLLFIVYAYMYILWK
  AHSHAVRMIQRGTQKSIIIHTSEDGKVQVTRPDQARMDIRLAKTLVLILVVLIICWGPLL
  AIMVYDVFGKMNKLIKTVFAFCSMLCLLNSTVNPIIYALRSKDLRHAFRSMFPSCEGTAQ
  PLDNSMGDSDCLHKHANNAASVHRAAESCIKSTVKIAKVTMSVSTDTSAEAL

• Sequence length: 472

Pathways

KEGG Pathway	Reactome Pathway
Rap1 signaling pathway	Class A/1 (Rhodopsin-like receptors)
Neuroactive ligand-receptor interaction	G alpha (i) signalling events
Thermogenesis
Retrograde endocannabinoid signaling

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (45)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
ANXIETY DISORDERS	—	CTD, Disgenet CTD, Disgenet	15081793, 18690112	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT DISORDER	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT DISORDER WITH HYPERACTIVITY	—	CTD	22034972	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BINGE-EATING DISORDER	—	CTD	23072421	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANNABIS ABUSE	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CATALEPSY	—	CTD, Disgenet CTD, Disgenet	10318961, 27149200, 27535976, 31877572	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHOLESTASIS	—	CTD, Disgenet CTD, Disgenet	26884397	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CNR1-related disorder	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COGNITION DISORDERS	—	CTD	29294249	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONDUCT DISORDER	—	GWAS catalog	18846501	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DELIRIUM, DEMENTIA, AMNESTIC, COGNITIVE DISORDERS	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEVELOPMENTAL COORDINATION DISORDER	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL NEOPLASMS	—	CTD	29805589, 32751388	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	CTD, Disgenet CTD, Disgenet	20864642	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EPILEPSY, TEMPORAL LOBE	—	CTD, Disgenet CTD, Disgenet	20498848	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HUNTINGTON DISEASE	—	CTD, Disgenet CTD, Disgenet	20929960	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERALGESIA	—	CTD	17572696	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTENSION	—	CTD	9888857	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS	—	CTD, Disgenet CTD, Disgenet	11433348, 21863215	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	40341939	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CANCER	—	GWAS catalog	40341939	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	40341939	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MELANOMA, CUTANEOUS MALIGNANT	—	CTD	28131817	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MEMORY DISORDERS	—	CTD, Disgenet CTD, Disgenet	29294249	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOTOR SKILLS DISORDERS	—	CTD	26460022	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOVEMENT DISORDERS	—	CTD, Disgenet CTD, Disgenet	10802025	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	CTD, Disgenet CTD, Disgenet	12876144	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	CTD, Disgenet CTD, Disgenet	18722357	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATIC NEOPLASMS	—	CTD	16818650	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATITIS	—	CTD, Disgenet CTD, Disgenet	17484889	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POST-TRAUMATIC STRESS DISORDER	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHABDOMYOSARCOMA	—	CTD	19509271	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	CTD, Disgenet CTD, Disgenet	21513772	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCLERODERMA, SYSTEMIC	—	CTD	27228633	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEIZURES	—	CTD	12954810, 26460022	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL CARCINOMA	—	GWAS catalog	40341939	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STATUS EPILEPTICUS	—	CTD, Disgenet CTD, Disgenet	19368833	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE WITHDRAWAL SYNDROME	—	CTD	18705688	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC SCLERODERMA	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UNIPOLAR DEPRESSION	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Related Genes

Sort by: Blended Diseases Pathways Evidence source

CNR2 11 shared diseasesCannabis abuse, Catalepsy, Cholelithiasis, Pancreatitis, Liver cirrhosis, Endometrial neoplasms, Hyperalgesia, Pancreatic neoplasms, Post-traumatic stress disorder, Scleroderma, Systemic sclerosis 2 shared pathwaysG alpha (i) signalling events, Class A/1 (Rhodopsin-like receptors) 15 shared evidence sourcesDisgenet (Cannabis abuse), CTD (Catalepsy), Disgenet (Catalepsy), CTD (Cholelithiasis), Disgenet (Cholelithiasis), CTD (Endometrial neoplasms), CTD (Hyperalgesia), CTD (Liver cirrhosis), Disgenet (Liver cirrhosis), CTD (Pancreatic neoplasms), Disgenet (Pancreatitis), CTD (Pancreatitis) +3 more Related via 11 shared diseases including Cannabis abuse, Catalepsy — evidence mostly CTD. DRD2 10 shared diseasesAnxiety disorder, Cannabis abuse, Catalepsy, Depression, Cognition disorder, Movement disorder, Delirium, dementia, and cognitive disorders, Seizures, Hypotension, Memory disorders 1 shared pathwayRap1 signaling pathway 20 shared evidence sourcesDisgenet (Anxiety disorder), CTD (Anxiety disorder), CTD (Attention deficit hyperactivity disorder), Disgenet (Attention deficit hyperactivity disorder), Disgenet (Cannabis abuse), CTD (Catalepsy), Disgenet (Catalepsy), Disgenet (Depression), Disgenet (Obesity), CTD (Cognition disorder), Disgenet (Delirium, dementia, and cognitive disorders), Disgenet (Diabetes mellitus type 2) +8 more Related via 10 shared diseases including Anxiety disorder, Cannabis abuse — evidence mostly Disgenet. CRH 8 shared diseasesAnxiety disorder, Depression, Cognition disorder, Movement disorder, Delirium, dementia, and cognitive disorders, Seizures, Hypotension, Status epilepticus 13 shared evidence sourcesDisgenet (Anxiety disorder), CTD (Anxiety disorder), Disgenet (Depression), Disgenet (Obesity), CTD (Cognition disorder), Disgenet (Delirium, dementia, and cognitive disorders), CTD (Hypotension), CTD (Movement disorder), Disgenet (Movement disorder), CTD (Seizures), Disgenet (Status epilepticus), CTD (Status epilepticus) +1 more Related via 8 shared diseases including Anxiety disorder, Depression — evidence mostly Disgenet. SLC6A4 7 shared diseasesAnxiety disorder, Cannabis abuse, Depression, Liver cirrhosis, Cognition disorder, Delirium, dementia, and cognitive disorders, Memory disorders 12 shared evidence sourcesDisgenet (Anxiety disorder), CTD (Anxiety disorder), Disgenet (Attention deficit hyperactivity disorder), Disgenet (Cannabis abuse), Disgenet (Depression), CTD (Cognition disorder), Disgenet (Delirium, dementia, and cognitive disorders), Disgenet (Liver cirrhosis), CTD (Memory disorders), Disgenet (Memory disorders), CTD (Schizophrenia), CTD (Substance abuse) Related via 7 shared diseases including Anxiety disorder, Cannabis abuse — evidence mostly Disgenet. PDYN 7 shared diseasesCholelithiasis, Depression, Movement disorder, Temporal lobe epilepsy, Seizures, Hyperalgesia, Hypotension 1 shared pathwayG alpha (i) signalling events 9 shared evidence sourcesCTD (Cholelithiasis), Disgenet (Cholelithiasis), Disgenet (Depression), Disgenet (Temporal lobe epilepsy), CTD (Hyperalgesia), CTD (Hypotension), CTD (Movement disorder), Disgenet (Movement disorder), CTD (Seizures) Related via 7 shared diseases including Cholelithiasis, Depression — evidence mostly CTD.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
CNR2	11	["Cannabis abuse","Catalepsy","Cholelithiasis","Pancreatitis","Liver cirrhosis","Endometrial neoplasms","Hyperalgesia","Pancreatic neoplasms","Post-traumatic stress disorder","Scleroderma","Systemic sclerosis"]	2	["G alpha (i) signalling events","Class A\/1 (Rhodopsin-like receptors)"]	15	["Disgenet (Cannabis abuse)","CTD (Catalepsy)","Disgenet (Catalepsy)","CTD (Cholelithiasis)","Disgenet (Cholelithiasis)","CTD (Endometrial neoplasms)","CTD (Hyperalgesia)","CTD (Liver cirrhosis)","Disgenet (Liver cirrhosis)","CTD (Pancreatic neoplasms)","Disgenet (Pancreatitis)","CTD (Pancreatitis)"]
DRD2	10	["Anxiety disorder","Cannabis abuse","Catalepsy","Depression","Cognition disorder","Movement disorder","Delirium, dementia, and cognitive disorders","Seizures","Hypotension","Memory disorders"]	1	["Rap1 signaling pathway"]	20	["Disgenet (Anxiety disorder)","CTD (Anxiety disorder)","CTD (Attention deficit hyperactivity disorder)","Disgenet (Attention deficit hyperactivity disorder)","Disgenet (Cannabis abuse)","CTD (Catalepsy)","Disgenet (Catalepsy)","Disgenet (Depression)","Disgenet (Obesity)","CTD (Cognition disorder)","Disgenet (Delirium, dementia, and cognitive disorders)","Disgenet (Diabetes mellitus type 2)"]
CRH	8	["Anxiety disorder","Depression","Cognition disorder","Movement disorder","Delirium, dementia, and cognitive disorders","Seizures","Hypotension","Status epilepticus"]	0	[]	13	["Disgenet (Anxiety disorder)","CTD (Anxiety disorder)","Disgenet (Depression)","Disgenet (Obesity)","CTD (Cognition disorder)","Disgenet (Delirium, dementia, and cognitive disorders)","CTD (Hypotension)","CTD (Movement disorder)","Disgenet (Movement disorder)","CTD (Seizures)","Disgenet (Status epilepticus)","CTD (Status epilepticus)"]
SLC6A4	7	["Anxiety disorder","Cannabis abuse","Depression","Liver cirrhosis","Cognition disorder","Delirium, dementia, and cognitive disorders","Memory disorders"]	0	[]	12	["Disgenet (Anxiety disorder)","CTD (Anxiety disorder)","Disgenet (Attention deficit hyperactivity disorder)","Disgenet (Cannabis abuse)","Disgenet (Depression)","CTD (Cognition disorder)","Disgenet (Delirium, dementia, and cognitive disorders)","Disgenet (Liver cirrhosis)","CTD (Memory disorders)","Disgenet (Memory disorders)","CTD (Schizophrenia)","CTD (Substance abuse)"]
PDYN	7	["Cholelithiasis","Depression","Movement disorder","Temporal lobe epilepsy","Seizures","Hyperalgesia","Hypotension"]	1	["G alpha (i) signalling events"]	9	["CTD (Cholelithiasis)","Disgenet (Cholelithiasis)","Disgenet (Depression)","Disgenet (Temporal lobe epilepsy)","CTD (Hyperalgesia)","CTD (Hypotension)","CTD (Movement disorder)","Disgenet (Movement disorder)","CTD (Seizures)"]

Diseases Linked via Similar Genes

Mood disorder Linked via 4 of 5 related genesDRD2, CRH, SLC6A4, PDYN Amphetamine or sympathomimetic abuse Linked via 3 of 5 related genesDRD2, SLC6A4, PDYN Anhedonia Linked via 3 of 5 related genesDRD2, CRH, SLC6A4 Bradycardia Linked via 3 of 5 related genesDRD2, CRH, PDYN Autism Linked via 2 of 5 related genesDRD2, SLC6A4

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Mood disorder	4	["DRD2","CRH","SLC6A4","PDYN"]
Amphetamine or sympathomimetic abuse	3	["DRD2","SLC6A4","PDYN"]
Anhedonia	3	["DRD2","CRH","SLC6A4"]
Bradycardia	3	["DRD2","CRH","PDYN"]
Autism	2	["DRD2","SLC6A4"]