NPY4R2 (neuropeptide Y receptor Y4-2)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 100996758
• Gene name: Neuropeptide Y receptor Y4-2
• Gene symbol: NPY4R2
• Synonyms (NCBI Gene): CH17-360D5.1, NPY4-R, NPY4R, PP1, PPYR1
• Chromosome: 10
• Chromosome location: 10q11.22

Gene ontology (GO) Show/Hide all (14)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001602	Function	Pancreatic polypeptide receptor activity	IBA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004983	Function	Neuropeptide Y receptor activity	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0007154	Process	Cell communication	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IBA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007218	Process	Neuropeptide signaling pathway	IEA
GO:0016020	Component	Membrane	IEA
GO:0023052	Process	Signaling	IEA
GO:0042923	Function	Neuropeptide binding	IBA
GO:0043005	Component	Neuron projection	IBA

Other IDs

• MIM: HGNC
• HGNC: N/A
• e!Ensembl: HGNC

Protein

• UniProt ID: P0DQD5
• Protein name: Neuropeptide Y receptor type 4-2
• Protein function: G protein-coupled receptor for PPY/pancreatic polypeptide/PP, NPY/neuropeptide Y and PYY/peptide YY that is negatively coupled to cAMP. The rank order of affinity for these polypeptides and their derivatives is PP, PP (2-36) and [Ile-31, Gln-34]
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	58 → 322	7 transmembrane receptor (rhodopsin family)	Family

• Sequence:

  MNTSHLLALLLPKSPQGENRSKPLGTPYNFSEHCQDSVDVMVFIVTSYSIETVVGVLGNL
  CLMCVTVRQKEKANVTNLLIANLAFSDFLMCLLCQPLTAVYTIMDYWIFGETLCKMSAFI
  QCMSVTVSILSLVLVALERHQLIINPTGWKPSISQAYLGIVLIWVIACVLSLPFLANSIL
  ENVFHKNHSKALEFLADKVVCTESWPLAHHRTIYTTFLLLFQYCLPLGFILVCYARIYRR
  LQRQGRVFHKGTYSLRAGHMKQVNVVLVVMVVAFAVLWLPLHVFNSLEDWHHEAIPICHG
  NLIFLVCHLLAMASTCVNPFIYGFLNTNFKKEIKALVLTCQQSAPLEESEHLPLSTVHTE
  VSKGSLRLSGRSNPI

• Sequence length: 375

Pathways

KEGG Pathway	Reactome Pathway
Neuroactive ligand-receptor interaction	Peptide ligand-binding receptors
	G alpha (i) signalling events

Related Genes

Sort by: Blended Diseases Pathways Evidence source

CORT 2 shared pathwaysG alpha (i) signalling events, Peptide ligand-binding receptors Related via 2 shared pathways including G alpha (i) signalling events, Peptide ligand-binding receptors. NPB 2 shared pathwaysG alpha (i) signalling events, Peptide ligand-binding receptors Related via 2 shared pathways including G alpha (i) signalling events, Peptide ligand-binding receptors. GALR1 2 shared pathwaysG alpha (i) signalling events, Peptide ligand-binding receptors Related via 2 shared pathways including G alpha (i) signalling events, Peptide ligand-binding receptors. NPBWR1 2 shared pathwaysG alpha (i) signalling events, Peptide ligand-binding receptors Related via 2 shared pathways including G alpha (i) signalling events, Peptide ligand-binding receptors. NPBWR2 2 shared pathwaysG alpha (i) signalling events, Peptide ligand-binding receptors Related via 2 shared pathways including G alpha (i) signalling events, Peptide ligand-binding receptors.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
CORT	0	[]	2	["G alpha (i) signalling events","Peptide ligand-binding receptors"]	0	[]
NPB	0	[]	2	["G alpha (i) signalling events","Peptide ligand-binding receptors"]	0	[]
GALR1	0	[]	2	["G alpha (i) signalling events","Peptide ligand-binding receptors"]	0	[]
NPBWR1	0	[]	2	["G alpha (i) signalling events","Peptide ligand-binding receptors"]	0	[]
NPBWR2	0	[]	2	["G alpha (i) signalling events","Peptide ligand-binding receptors"]	0	[]

Diseases Linked via Similar Genes

Alzheimer disease Linked via 2 of 5 related genesGALR1, NPBWR1 Obesity Linked via 2 of 5 related genesGALR1, NPBWR1 Polycystic ovary syndrome Linked via 1 of 5 related genesNPB Atrophic macular degeneration Linked via 1 of 5 related genesGALR1 Behcet disease Linked via 1 of 5 related genesGALR1

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Alzheimer disease	2	["GALR1","NPBWR1"]
Obesity	2	["GALR1","NPBWR1"]
Polycystic ovary syndrome	1	["NPB"]
Atrophic macular degeneration	1	["GALR1"]
Behcet disease	1	["GALR1"]