CORT (cortistatin)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 1325
Gene name Cortistatin
Gene symbol CORT
Synonyms (NCBI Gene)
CST-14CST-17CST-29SST2
Chromosome 1
Chromosome location 1p36.22
Summary This gene encodes a neuropeptide that is structurally similar to somatostatin. It binds to all known somatostatin receptors, and shares many pharmacological and functional properties with somatostatin, including the depression of neuronal activity. Howeve
miRNA miRNA information provided by mirtarbase database.
10 Show/Hide all (10)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT904777 hsa-miR-374c CLIP-seq
MIRT904778 hsa-miR-4426 CLIP-seq
MIRT904779 hsa-miR-4539 CLIP-seq
MIRT904780 hsa-miR-4647 CLIP-seq
MIRT904781 hsa-miR-4662b CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
16 Show/Hide all (16)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0001664 Function G protein-coupled receptor binding IBA
GO:0001664 Function G protein-coupled receptor binding IPI 12915402
GO:0005179 Function Hormone activity IEA
GO:0005184 Function Neuropeptide hormone activity IBA
GO:0005184 Function Neuropeptide hormone activity IDA 9125122
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
602784 2257 ENSG00000241563
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O00230
Protein name Cortistatin [Cleaved into: Cortistatin-29; Cortistatin-17]
Protein function Binds to all human somatostatin receptor (SSTR) subtypes. It also inhibits cAMP production induced by forskolin through SSTRs.
PDB 7S8L , 7S8M , 7VDL , 7VV4 , 8X8L
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF03002 Somatostatin 87 → 104 Somatostatin/Cortistatin family Family
Tissue specificity TISSUE SPECIFICITY: Expressed in a subset of GABAergic cells in the cortex and hippocampus.
Sequence 
MPLSPGLLLLLLSGATATAALPLEGGPTGRDSEHMQEAAGIRKSSLLTFLAWWFEWTSQA
SAGPLIGEEAREVARRQEGAPPQQSARRDRMPCRNFFWKTFSSCK
Sequence length 105
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
KEGG Pathway Reactome Pathway
Neuroactive ligand-receptor interaction Peptide ligand-binding receptors
  G alpha (i) signalling events
Sort by:
NPY4R2 2 shared pathwaysG alpha (i) signalling events, Peptide ligand-binding receptors Related via 2 shared pathways including G alpha (i) signalling events, Peptide ligand-binding receptors. NPB 2 shared pathwaysG alpha (i) signalling events, Peptide ligand-binding receptors Related via 2 shared pathways including G alpha (i) signalling events, Peptide ligand-binding receptors. GALR1 2 shared pathwaysG alpha (i) signalling events, Peptide ligand-binding receptors Related via 2 shared pathways including G alpha (i) signalling events, Peptide ligand-binding receptors. NPBWR1 2 shared pathwaysG alpha (i) signalling events, Peptide ligand-binding receptors Related via 2 shared pathways including G alpha (i) signalling events, Peptide ligand-binding receptors. NPBWR2 2 shared pathwaysG alpha (i) signalling events, Peptide ligand-binding receptors Related via 2 shared pathways including G alpha (i) signalling events, Peptide ligand-binding receptors.
Alzheimer disease Linked via 2 of 5 related genesGALR1, NPBWR1 Obesity Linked via 2 of 5 related genesGALR1, NPBWR1 Polycystic ovary syndrome Linked via 1 of 5 related genesNPB Atrophic macular degeneration Linked via 1 of 5 related genesGALR1 Behcet disease Linked via 1 of 5 related genesGALR1