Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID	51701
Gene name	Nemo like kinase
Gene symbol	NLK
Synonyms (NCBI Gene)	-
Chromosome	17
Chromosome location	17q11.2

384

Show/Hide all (384)

miRTarBase ID	miRNA	Experiments	Reference
MIRT000243	hsa-miR-181a-5p	Luciferase reporter assay	19585654
MIRT000238	hsa-miR-181b-5p	Luciferase reporter assay	19585654
MIRT000233	hsa-miR-181c-5p	Luciferase reporter assay	19585654
MIRT024563	hsa-miR-215-5p	Microarray	19074876
MIRT026531	hsa-miR-192-5p	Microarray	19074876
MIRT035518	hsa-miR-92b-3p	Luciferase reporter assay	23416699
MIRT050387	hsa-miR-23a-3p	CLASH	23622248
MIRT054629	hsa-miR-199b-5p	ChIP-seqFlowqRT-PCRWestern blot	24608802
MIRT438193	hsa-miR-101-3p	Luciferase reporter assay	24189458
MIRT438193	hsa-miR-101-3p	Luciferase reporter assay	24189458
MIRT438193	hsa-miR-101-3p	Luciferase reporter assay	24189458
MIRT438193	hsa-miR-101-3p	Luciferase reporter assay	24189458
MIRT701405	hsa-miR-944	HITS-CLIP	23313552
MIRT701404	hsa-miR-5088-5p	HITS-CLIP	23313552
MIRT701403	hsa-miR-4446-3p	HITS-CLIP	23313552
MIRT701402	hsa-miR-3158-3p	HITS-CLIP	23313552
MIRT701401	hsa-miR-6815-5p	HITS-CLIP	23313552
MIRT701400	hsa-miR-6865-5p	HITS-CLIP	23313552
MIRT701399	hsa-miR-135a-3p	HITS-CLIP	23313552
MIRT701398	hsa-miR-6741-3p	HITS-CLIP	23313552
MIRT701397	hsa-miR-1253	HITS-CLIP	23313552
MIRT701396	hsa-miR-6770-5p	HITS-CLIP	23313552
MIRT701395	hsa-miR-3622b-5p	HITS-CLIP	23313552
MIRT701394	hsa-miR-6822-3p	HITS-CLIP	23313552
MIRT701393	hsa-miR-6800-5p	HITS-CLIP	23313552
MIRT701392	hsa-miR-6802-5p	HITS-CLIP	23313552
MIRT627963	hsa-miR-216a-5p	HITS-CLIP	23824327
MIRT627962	hsa-miR-1285-5p	HITS-CLIP	23824327
MIRT627961	hsa-miR-1250-3p	HITS-CLIP	23824327
MIRT627960	hsa-miR-153-5p	HITS-CLIP	23824327
MIRT627959	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT627958	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT627957	hsa-miR-5696	HITS-CLIP	23824327
MIRT627956	hsa-miR-579-3p	HITS-CLIP	23824327
MIRT627955	hsa-miR-664b-3p	HITS-CLIP	23824327
MIRT627954	hsa-miR-6818-5p	HITS-CLIP	23824327
MIRT627953	hsa-miR-574-5p	HITS-CLIP	23824327
MIRT522258	hsa-miR-548c-3p	PAR-CLIP	23446348
MIRT522257	hsa-miR-3121-3p	PAR-CLIP	23446348
MIRT522256	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT522255	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT522254	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT472141	hsa-miR-27b-3p	PAR-CLIP	23592263
MIRT472140	hsa-miR-27a-3p	PAR-CLIP	23592263
MIRT472139	hsa-miR-5692a	PAR-CLIP	23592263
MIRT472138	hsa-miR-3120-3p	PAR-CLIP	23592263
MIRT472137	hsa-miR-545-3p	PAR-CLIP	23592263
MIRT472135	hsa-miR-3682-5p	PAR-CLIP	23592263
MIRT472136	hsa-miR-513a-5p	PAR-CLIP	23592263
MIRT035518	hsa-miR-92b-3p	Luciferase reporter assayWestern blot	26503628
MIRT035518	hsa-miR-92b-3p	Luciferase reporter assayWestern blot	26503628
MIRT701405	hsa-miR-944	HITS-CLIP	23313552
MIRT701404	hsa-miR-5088-5p	HITS-CLIP	23313552
MIRT701403	hsa-miR-4446-3p	HITS-CLIP	23313552
MIRT701402	hsa-miR-3158-3p	HITS-CLIP	23313552
MIRT701401	hsa-miR-6815-5p	HITS-CLIP	23313552
MIRT701400	hsa-miR-6865-5p	HITS-CLIP	23313552
MIRT701399	hsa-miR-135a-3p	HITS-CLIP	23313552
MIRT701398	hsa-miR-6741-3p	HITS-CLIP	23313552
MIRT701397	hsa-miR-1253	HITS-CLIP	23313552
MIRT701396	hsa-miR-6770-5p	HITS-CLIP	23313552
MIRT701395	hsa-miR-3622b-5p	HITS-CLIP	23313552
MIRT701394	hsa-miR-6822-3p	HITS-CLIP	23313552
MIRT701393	hsa-miR-6800-5p	HITS-CLIP	23313552
MIRT701392	hsa-miR-6802-5p	HITS-CLIP	23313552
MIRT627963	hsa-miR-216a-5p	HITS-CLIP	23824327
MIRT627962	hsa-miR-1285-5p	HITS-CLIP	23824327
MIRT627961	hsa-miR-1250-3p	HITS-CLIP	23824327
MIRT627960	hsa-miR-153-5p	HITS-CLIP	23824327
MIRT627959	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT627958	hsa-miR-6867-5p	HITS-CLIP	23824327
MIRT627957	hsa-miR-5696	HITS-CLIP	23824327
MIRT627956	hsa-miR-579-3p	HITS-CLIP	23824327
MIRT627955	hsa-miR-664b-3p	HITS-CLIP	23824327
MIRT627954	hsa-miR-6818-5p	HITS-CLIP	23824327
MIRT627953	hsa-miR-574-5p	HITS-CLIP	23824327
MIRT522258	hsa-miR-548c-3p	PAR-CLIP	23446348
MIRT522257	hsa-miR-3121-3p	PAR-CLIP	23446348
MIRT522256	hsa-miR-1277-5p	PAR-CLIP	23446348
MIRT522255	hsa-miR-5011-5p	PAR-CLIP	23446348
MIRT522254	hsa-miR-190a-3p	PAR-CLIP	23446348
MIRT472141	hsa-miR-27b-3p	PAR-CLIP	23592263
MIRT472140	hsa-miR-27a-3p	PAR-CLIP	23592263
MIRT472139	hsa-miR-5692a	PAR-CLIP	23592263
MIRT472138	hsa-miR-3120-3p	PAR-CLIP	23592263
MIRT472137	hsa-miR-545-3p	PAR-CLIP	23592263
MIRT472135	hsa-miR-3682-5p	PAR-CLIP	23592263
MIRT472136	hsa-miR-513a-5p	PAR-CLIP	23592263
MIRT1186849	hsa-let-7a	CLIP-seq
MIRT1186850	hsa-let-7b	CLIP-seq
MIRT1186851	hsa-let-7c	CLIP-seq
MIRT1186852	hsa-let-7d	CLIP-seq
MIRT1186853	hsa-let-7e	CLIP-seq
MIRT1186854	hsa-let-7f	CLIP-seq
MIRT1186855	hsa-let-7g	CLIP-seq
MIRT1186856	hsa-let-7i	CLIP-seq
MIRT1186857	hsa-miR-105	CLIP-seq
MIRT1186858	hsa-miR-1197	CLIP-seq
MIRT1186859	hsa-miR-1245b-5p	CLIP-seq
MIRT1186860	hsa-miR-1286	CLIP-seq
MIRT1186861	hsa-miR-148a	CLIP-seq
MIRT1186862	hsa-miR-148b	CLIP-seq
MIRT1186863	hsa-miR-152	CLIP-seq
MIRT1186864	hsa-miR-1825	CLIP-seq
MIRT1186865	hsa-miR-188-3p	CLIP-seq
MIRT1186866	hsa-miR-197	CLIP-seq
MIRT1186867	hsa-miR-198	CLIP-seq
MIRT1186868	hsa-miR-199a-5p	CLIP-seq
MIRT1186869	hsa-miR-203	CLIP-seq
MIRT1186870	hsa-miR-23a	CLIP-seq
MIRT1186871	hsa-miR-23b	CLIP-seq
MIRT1186872	hsa-miR-23c	CLIP-seq
MIRT1186873	hsa-miR-30a	CLIP-seq
MIRT1186874	hsa-miR-30b	CLIP-seq
MIRT1186875	hsa-miR-30c	CLIP-seq
MIRT1186876	hsa-miR-30d	CLIP-seq
MIRT1186877	hsa-miR-30e	CLIP-seq
MIRT1186878	hsa-miR-3142	CLIP-seq
MIRT1186879	hsa-miR-3149	CLIP-seq
MIRT1186880	hsa-miR-3152-5p	CLIP-seq
MIRT1186881	hsa-miR-3616-5p	CLIP-seq
MIRT1186882	hsa-miR-3647-3p	CLIP-seq
MIRT1186883	hsa-miR-3647-5p	CLIP-seq
MIRT1186884	hsa-miR-3655	CLIP-seq
MIRT1186885	hsa-miR-3662	CLIP-seq
MIRT1186886	hsa-miR-3671	CLIP-seq
MIRT1186887	hsa-miR-3689d	CLIP-seq
MIRT1186888	hsa-miR-382	CLIP-seq
MIRT1186889	hsa-miR-3927	CLIP-seq
MIRT1186890	hsa-miR-3938	CLIP-seq
MIRT1186891	hsa-miR-4255	CLIP-seq
MIRT1186892	hsa-miR-4276	CLIP-seq
MIRT1186893	hsa-miR-4302	CLIP-seq
MIRT1186894	hsa-miR-4307	CLIP-seq
MIRT1186895	hsa-miR-4310	CLIP-seq
MIRT1186896	hsa-miR-4320	CLIP-seq
MIRT1186897	hsa-miR-4330	CLIP-seq
MIRT1186898	hsa-miR-4432	CLIP-seq
MIRT1186899	hsa-miR-4451	CLIP-seq
MIRT1186900	hsa-miR-4458	CLIP-seq
MIRT1186901	hsa-miR-4459	CLIP-seq
MIRT1186902	hsa-miR-4477a	CLIP-seq
MIRT1186903	hsa-miR-4480	CLIP-seq
MIRT1186904	hsa-miR-4491	CLIP-seq
MIRT1186905	hsa-miR-4500	CLIP-seq
MIRT1186906	hsa-miR-450b-3p	CLIP-seq
MIRT1186907	hsa-miR-4521	CLIP-seq
MIRT1186908	hsa-miR-455-5p	CLIP-seq
MIRT1186909	hsa-miR-4657	CLIP-seq
MIRT1186910	hsa-miR-4670-3p	CLIP-seq
MIRT1186911	hsa-miR-4693-5p	CLIP-seq
MIRT1186912	hsa-miR-4722-5p	CLIP-seq
MIRT1186913	hsa-miR-4762-5p	CLIP-seq
MIRT1186914	hsa-miR-4764-3p	CLIP-seq
MIRT1186915	hsa-miR-4774-3p	CLIP-seq
MIRT1186916	hsa-miR-4803	CLIP-seq
MIRT1186917	hsa-miR-489	CLIP-seq
MIRT1186918	hsa-miR-498	CLIP-seq
MIRT1186919	hsa-miR-501-3p	CLIP-seq
MIRT1186920	hsa-miR-502-3p	CLIP-seq
MIRT1186921	hsa-miR-508-5p	CLIP-seq
MIRT1186922	hsa-miR-5096	CLIP-seq
MIRT1186923	hsa-miR-511	CLIP-seq
MIRT1186924	hsa-miR-513a-3p	CLIP-seq
MIRT1186925	hsa-miR-514	CLIP-seq
MIRT1186926	hsa-miR-514b-3p	CLIP-seq
MIRT1186927	hsa-miR-532-3p	CLIP-seq
MIRT1186928	hsa-miR-548a-3p	CLIP-seq
MIRT1186929	hsa-miR-548e	CLIP-seq
MIRT1186930	hsa-miR-548f	CLIP-seq
MIRT1186931	hsa-miR-550a	CLIP-seq
MIRT1186932	hsa-miR-555	CLIP-seq
MIRT1186933	hsa-miR-561	CLIP-seq
MIRT1186934	hsa-miR-568	CLIP-seq
MIRT1186935	hsa-miR-570	CLIP-seq
MIRT1186936	hsa-miR-573	CLIP-seq
MIRT1186937	hsa-miR-578	CLIP-seq
MIRT1186938	hsa-miR-607	CLIP-seq
MIRT1186939	hsa-miR-630	CLIP-seq
MIRT1186940	hsa-miR-633	CLIP-seq
MIRT1186941	hsa-miR-664	CLIP-seq
MIRT1186942	hsa-miR-665	CLIP-seq
MIRT1186943	hsa-miR-769-3p	CLIP-seq
MIRT1186944	hsa-miR-98	CLIP-seq
MIRT1186849	hsa-let-7a	CLIP-seq
MIRT1186850	hsa-let-7b	CLIP-seq
MIRT1186851	hsa-let-7c	CLIP-seq
MIRT1186852	hsa-let-7d	CLIP-seq
MIRT1186853	hsa-let-7e	CLIP-seq
MIRT1186854	hsa-let-7f	CLIP-seq
MIRT1186855	hsa-let-7g	CLIP-seq
MIRT1186856	hsa-let-7i	CLIP-seq
MIRT1186859	hsa-miR-1245b-5p	CLIP-seq
MIRT1186873	hsa-miR-30a	CLIP-seq
MIRT1186874	hsa-miR-30b	CLIP-seq
MIRT1186875	hsa-miR-30c	CLIP-seq
MIRT1186876	hsa-miR-30d	CLIP-seq
MIRT1186877	hsa-miR-30e	CLIP-seq
MIRT1186878	hsa-miR-3142	CLIP-seq
MIRT1186887	hsa-miR-3689d	CLIP-seq
MIRT1186889	hsa-miR-3927	CLIP-seq
MIRT1186895	hsa-miR-4310	CLIP-seq
MIRT1186899	hsa-miR-4451	CLIP-seq
MIRT1186900	hsa-miR-4458	CLIP-seq
MIRT1186901	hsa-miR-4459	CLIP-seq
MIRT1186904	hsa-miR-4491	CLIP-seq
MIRT1186905	hsa-miR-4500	CLIP-seq
MIRT1186909	hsa-miR-4657	CLIP-seq
MIRT1186914	hsa-miR-4764-3p	CLIP-seq
MIRT1186921	hsa-miR-508-5p	CLIP-seq
MIRT1186942	hsa-miR-665	CLIP-seq
MIRT1186944	hsa-miR-98	CLIP-seq
MIRT1186879	hsa-miR-3149	CLIP-seq
MIRT1186919	hsa-miR-501-3p	CLIP-seq
MIRT1186920	hsa-miR-502-3p	CLIP-seq
MIRT1186939	hsa-miR-630	CLIP-seq
MIRT1186941	hsa-miR-664	CLIP-seq
MIRT1186849	hsa-let-7a	CLIP-seq
MIRT1186850	hsa-let-7b	CLIP-seq
MIRT1186851	hsa-let-7c	CLIP-seq
MIRT1186852	hsa-let-7d	CLIP-seq
MIRT1186853	hsa-let-7e	CLIP-seq
MIRT1186854	hsa-let-7f	CLIP-seq
MIRT1186855	hsa-let-7g	CLIP-seq
MIRT1186856	hsa-let-7i	CLIP-seq
MIRT2054134	hsa-miR-101	CLIP-seq
MIRT1186859	hsa-miR-1245b-5p	CLIP-seq
MIRT2054135	hsa-miR-1297	CLIP-seq
MIRT2054136	hsa-miR-144	CLIP-seq
MIRT1186866	hsa-miR-197	CLIP-seq
MIRT1186868	hsa-miR-199a-5p	CLIP-seq
MIRT1186870	hsa-miR-23a	CLIP-seq
MIRT1186871	hsa-miR-23b	CLIP-seq
MIRT1186872	hsa-miR-23c	CLIP-seq
MIRT2054137	hsa-miR-26a	CLIP-seq
MIRT2054138	hsa-miR-26b	CLIP-seq
MIRT2054139	hsa-miR-2964a-3p	CLIP-seq
MIRT1186873	hsa-miR-30a	CLIP-seq
MIRT1186874	hsa-miR-30b	CLIP-seq
MIRT1186875	hsa-miR-30c	CLIP-seq
MIRT1186876	hsa-miR-30d	CLIP-seq
MIRT1186877	hsa-miR-30e	CLIP-seq
MIRT1186878	hsa-miR-3142	CLIP-seq
MIRT1186879	hsa-miR-3149	CLIP-seq
MIRT2054140	hsa-miR-3150a-5p	CLIP-seq
MIRT2054141	hsa-miR-3150b-5p	CLIP-seq
MIRT2054142	hsa-miR-329	CLIP-seq
MIRT2054143	hsa-miR-362-3p	CLIP-seq
MIRT1186886	hsa-miR-3671	CLIP-seq
MIRT2054144	hsa-miR-3685	CLIP-seq
MIRT1186887	hsa-miR-3689d	CLIP-seq
MIRT1186888	hsa-miR-382	CLIP-seq
MIRT2054145	hsa-miR-384	CLIP-seq
MIRT1186889	hsa-miR-3927	CLIP-seq
MIRT2054146	hsa-miR-4282	CLIP-seq
MIRT1186894	hsa-miR-4307	CLIP-seq
MIRT1186895	hsa-miR-4310	CLIP-seq
MIRT1186899	hsa-miR-4451	CLIP-seq
MIRT1186900	hsa-miR-4458	CLIP-seq
MIRT1186901	hsa-miR-4459	CLIP-seq
MIRT2054147	hsa-miR-4465	CLIP-seq
MIRT1186903	hsa-miR-4480	CLIP-seq
MIRT1186904	hsa-miR-4491	CLIP-seq
MIRT1186905	hsa-miR-4500	CLIP-seq
MIRT1186909	hsa-miR-4657	CLIP-seq
MIRT1186913	hsa-miR-4762-5p	CLIP-seq
MIRT1186914	hsa-miR-4764-3p	CLIP-seq
MIRT2054148	hsa-miR-4795-3p	CLIP-seq
MIRT1186921	hsa-miR-508-5p	CLIP-seq
MIRT1186922	hsa-miR-5096	CLIP-seq
MIRT1186923	hsa-miR-511	CLIP-seq
MIRT2054149	hsa-miR-518a-5p	CLIP-seq
MIRT2054150	hsa-miR-527	CLIP-seq
MIRT1186934	hsa-miR-568	CLIP-seq
MIRT2054151	hsa-miR-582-5p	CLIP-seq
MIRT2054152	hsa-miR-605	CLIP-seq
MIRT1186938	hsa-miR-607	CLIP-seq
MIRT1186939	hsa-miR-630	CLIP-seq
MIRT1186941	hsa-miR-664	CLIP-seq
MIRT1186942	hsa-miR-665	CLIP-seq
MIRT1186944	hsa-miR-98	CLIP-seq
MIRT1186849	hsa-let-7a	CLIP-seq
MIRT1186850	hsa-let-7b	CLIP-seq
MIRT1186851	hsa-let-7c	CLIP-seq
MIRT1186852	hsa-let-7d	CLIP-seq
MIRT1186853	hsa-let-7e	CLIP-seq
MIRT1186854	hsa-let-7f	CLIP-seq
MIRT1186855	hsa-let-7g	CLIP-seq
MIRT1186856	hsa-let-7i	CLIP-seq
MIRT1186858	hsa-miR-1197	CLIP-seq
MIRT1186859	hsa-miR-1245b-5p	CLIP-seq
MIRT2283285	hsa-miR-1284	CLIP-seq
MIRT1186864	hsa-miR-1825	CLIP-seq
MIRT1186865	hsa-miR-188-3p	CLIP-seq
MIRT2283286	hsa-miR-199a-3p	CLIP-seq
MIRT1186868	hsa-miR-199a-5p	CLIP-seq
MIRT2283287	hsa-miR-199b-3p	CLIP-seq
MIRT2283288	hsa-miR-2117	CLIP-seq
MIRT2283289	hsa-miR-221	CLIP-seq
MIRT2283290	hsa-miR-222	CLIP-seq
MIRT1186873	hsa-miR-30a	CLIP-seq
MIRT1186874	hsa-miR-30b	CLIP-seq
MIRT1186875	hsa-miR-30c	CLIP-seq
MIRT1186876	hsa-miR-30d	CLIP-seq
MIRT1186877	hsa-miR-30e	CLIP-seq
MIRT2283291	hsa-miR-3129-5p	CLIP-seq
MIRT1186878	hsa-miR-3142	CLIP-seq
MIRT1186879	hsa-miR-3149	CLIP-seq
MIRT1186880	hsa-miR-3152-5p	CLIP-seq
MIRT2283292	hsa-miR-3168	CLIP-seq
MIRT2283293	hsa-miR-323-3p	CLIP-seq
MIRT1186886	hsa-miR-3671	CLIP-seq
MIRT1186887	hsa-miR-3689d	CLIP-seq
MIRT1186888	hsa-miR-382	CLIP-seq
MIRT2054145	hsa-miR-384	CLIP-seq
MIRT2283294	hsa-miR-3925-3p	CLIP-seq
MIRT1186889	hsa-miR-3927	CLIP-seq
MIRT2283295	hsa-miR-3942-5p	CLIP-seq
MIRT2283296	hsa-miR-3978	CLIP-seq
MIRT2054146	hsa-miR-4282	CLIP-seq
MIRT1186895	hsa-miR-4310	CLIP-seq
MIRT2283297	hsa-miR-4318	CLIP-seq
MIRT1186898	hsa-miR-4432	CLIP-seq
MIRT1186899	hsa-miR-4451	CLIP-seq
MIRT1186900	hsa-miR-4458	CLIP-seq
MIRT1186901	hsa-miR-4459	CLIP-seq
MIRT1186902	hsa-miR-4477a	CLIP-seq
MIRT1186903	hsa-miR-4480	CLIP-seq
MIRT1186904	hsa-miR-4491	CLIP-seq
MIRT1186905	hsa-miR-4500	CLIP-seq
MIRT2283298	hsa-miR-4504	CLIP-seq
MIRT1186907	hsa-miR-4521	CLIP-seq
MIRT1186909	hsa-miR-4657	CLIP-seq
MIRT1186911	hsa-miR-4693-5p	CLIP-seq
MIRT2283299	hsa-miR-4703-5p	CLIP-seq
MIRT2283300	hsa-miR-4719	CLIP-seq
MIRT2283301	hsa-miR-4753-3p	CLIP-seq
MIRT1186914	hsa-miR-4764-3p	CLIP-seq
MIRT1186915	hsa-miR-4774-3p	CLIP-seq
MIRT2054148	hsa-miR-4795-3p	CLIP-seq
MIRT1186918	hsa-miR-498	CLIP-seq
MIRT1186919	hsa-miR-501-3p	CLIP-seq
MIRT1186920	hsa-miR-502-3p	CLIP-seq
MIRT1186921	hsa-miR-508-5p	CLIP-seq
MIRT1186927	hsa-miR-532-3p	CLIP-seq
MIRT2283302	hsa-miR-542-3p	CLIP-seq
MIRT2283303	hsa-miR-548n	CLIP-seq
MIRT1186934	hsa-miR-568	CLIP-seq
MIRT1186938	hsa-miR-607	CLIP-seq
MIRT1186939	hsa-miR-630	CLIP-seq
MIRT1186940	hsa-miR-633	CLIP-seq
MIRT1186941	hsa-miR-664	CLIP-seq
MIRT1186942	hsa-miR-665	CLIP-seq
MIRT2283304	hsa-miR-892a	CLIP-seq
MIRT2283305	hsa-miR-936	CLIP-seq
MIRT1186944	hsa-miR-98	CLIP-seq
MIRT1186849	hsa-let-7a	CLIP-seq
MIRT1186850	hsa-let-7b	CLIP-seq
MIRT1186851	hsa-let-7c	CLIP-seq
MIRT1186852	hsa-let-7d	CLIP-seq
MIRT1186853	hsa-let-7e	CLIP-seq
MIRT1186854	hsa-let-7f	CLIP-seq
MIRT1186855	hsa-let-7g	CLIP-seq
MIRT1186856	hsa-let-7i	CLIP-seq
MIRT1186859	hsa-miR-1245b-5p	CLIP-seq
MIRT1186878	hsa-miR-3142	CLIP-seq
MIRT1186879	hsa-miR-3149	CLIP-seq
MIRT1186888	hsa-miR-382	CLIP-seq
MIRT1186889	hsa-miR-3927	CLIP-seq
MIRT1186899	hsa-miR-4451	CLIP-seq
MIRT1186900	hsa-miR-4458	CLIP-seq
MIRT1186901	hsa-miR-4459	CLIP-seq
MIRT1186903	hsa-miR-4480	CLIP-seq
MIRT1186905	hsa-miR-4500	CLIP-seq
MIRT1186914	hsa-miR-4764-3p	CLIP-seq
MIRT1186921	hsa-miR-508-5p	CLIP-seq
MIRT1186934	hsa-miR-568	CLIP-seq
MIRT1186939	hsa-miR-630	CLIP-seq
MIRT1186941	hsa-miR-664	CLIP-seq
MIRT1186942	hsa-miR-665	CLIP-seq
MIRT1186944	hsa-miR-98	CLIP-seq
MIRT1186886	hsa-miR-3671	CLIP-seq
MIRT1186938	hsa-miR-607	CLIP-seq
MIRT1186895	hsa-miR-4310	CLIP-seq

Show/Hide all (2)

Transcription factor	Regulation	Reference
FOXO1	Unknown	23144700
STAT3	Unknown	15764709

Show/Hide all (55)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000165	Process	MAPK cascade	IEA
GO:0000166	Function	Nucleotide binding	IEA
GO:0000287	Function	Magnesium ion binding	IEA
GO:0000287	Function	Magnesium ion binding	ISS
GO:0004672	Function	Protein kinase activity	IEA
GO:0004672	Function	Protein kinase activity	TAS	10863097
GO:0004674	Function	Protein serine/threonine kinase activity	IBA
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	26588989
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	TAS
GO:0004707	Function	MAP kinase activity	IEA
GO:0004707	Function	MAP kinase activity	ISS
GO:0005515	Function	Protein binding	IPI	16713569, 21454679, 21516116, 21988832, 22773187, 23602568, 25416956, 25910212, 31515488, 32296183, 32814053
GO:0005524	Function	ATP binding	IEA
GO:0005524	Function	ATP binding	ISS
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005634	Component	Nucleus	TAS	9448268
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	ISS
GO:0006468	Process	Protein phosphorylation	ISS
GO:0007165	Process	Signal transduction	IEA
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IMP	15004007
GO:0007223	Process	Wnt signaling pathway, calcium modulating pathway	TAS
GO:0009966	Process	Regulation of signal transduction	IEA
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0018107	Process	Peptidyl-threonine phosphorylation	ISS
GO:0030178	Process	Negative regulation of Wnt signaling pathway	IEA
GO:0030178	Process	Negative regulation of Wnt signaling pathway	ISS
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	16714285
GO:0031669	Process	Cellular response to nutrient levels	IDA	29236692, 29750193, 31601708
GO:0033554	Process	Cellular response to stress	IEA
GO:0035556	Process	Intracellular signal transduction	IBA
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0035556	Process	Intracellular signal transduction	ISS
GO:0038202	Process	TORC1 signaling	IDA	29750193
GO:0042169	Function	SH2 domain binding	IEA
GO:0042169	Function	SH2 domain binding	ISS
GO:0046872	Function	Metal ion binding	IEA
GO:0050821	Process	Protein stabilization	IDA	25512613
GO:0061462	Process	Protein localization to lysosome	IDA	31601708
GO:0071470	Process	Cellular response to osmotic stress	IDA	26588989
GO:0106310	Function	Protein serine kinase activity	IEA
GO:0140297	Function	DNA-binding transcription factor binding	IPI	16714285, 25512613
GO:1904262	Process	Negative regulation of TORC1 signaling	IDA	26588989
GO:1904263	Process	Positive regulation of TORC1 signaling	IDA	29236692, 31601708
GO:1904894	Process	Positive regulation of receptor signaling pathway via STAT	IEA
GO:1904894	Process	Positive regulation of receptor signaling pathway via STAT	ISS

MIM	HGNC	e!Ensembl
609476	29858	ENSG00000087095

Q9UBE8

Protein name

Serine/threonine-protein kinase NLK (EC 2.7.11.24) (Nemo-like kinase) (Protein LAK1)

Protein function

Serine/threonine-protein kinase that regulates a number of transcription factors with key roles in cell fate determination (PubMed:12482967, PubMed:14960582, PubMed:15004007, PubMed:15764709, PubMed:20061393, PubMed:20874444, PubMed:21454679). P

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	138 → 427	Protein kinase domain	Domain

Sequence

MSLCGARANAKMMAAYNGGTSAAAAGHHHHHHHHLPHLPPPHLHHHHHPQHHLHPGSAAA
VHPVQQHTSSAAAAAAAAAAAAAMLNPGQQQPYFPSPAPGQAPGPAAAAPAQVQAAAAAT
VKAHHHQHSHHPQQQLDIEPDRPIGYGAFGVVWSVTDPRDGKRVALKKMPNVFQNLVSCK
RVFRELKMLCFFKHDNVLSALDILQPPHIDYFEEIYVVTELMQSDLHKIIVSPQPLSSDH
VKVFLYQILRGLKYLHSAGILHRDIKPGNLLVNSNCVLKICDFGLARVEELDESRHMTQE
VVTQYYRAPEILMGSRHYSNAIDIWSVGCIFAELLGRRILFQAQSPIQQLDLITDLLGTP
SLEAMRTACEGAKAHILRGPHKQPSLPVLYTLSSQATHEAVHLLCRMLVFDPSKRISAKD
ALAHPYLDEGRLRYHTCMCKCCFSTSTGRVYTSDFEPVTNPKFDDTFEKNLSSVRQVKEI
IHQFILEQQKGNRVPLCINPQSAAFKSFISSTVAQPSEMPPSPLVWE

Sequence length

527

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (67)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenoma	Adenoma	BEFREE	26269673		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	28543390		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	40471493	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anodontia	Anodontia	Pubtator	31828582	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	23935942		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	23935942	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	24816797	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	29132323		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	26252054, 29132323	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	26022162	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	24460265, 26252054, 31364124		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	27895463, 30451112		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	22253297	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	22253297		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	27776139	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	20512928		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	12901858		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	24972723, 25371216, 26269673		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	14720327, 26269673, 31828582	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	29803790		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	27764156		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	22253297		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	22733362		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	23857283	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	26023737		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	26023737		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	23416699, 27583705		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	36674671	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	27764156		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	26997628	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	24460265, 26252054, 31364124	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngitis	Laryngitis	Pubtator	24460265	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	20512928, 24189458, 26022162		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	26503334		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	26823848	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	26823848	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	26269673	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	31322229	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	GWASCAT_DG	27622933		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant neoplasm of breast	Breast Cancer	BEFREE	23935942		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	22733362		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of larynx	Larynx cancer	BEFREE	24460265, 26252054, 31364124		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	20512928		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	27895463, 30451112		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	22253297		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	19514049, 27036119		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	20512928, 23983589, 26252054, 26427665, 26503334, 29445289		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	20512928		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	30778016		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	GWASCAT_DG	27622933		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	28543390		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12901858, 20512928, 24972723, 25371216, 26022162, 26023737, 26427665, 26503334, 26503628, 26647877, 27895463, 29803790		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	28003306		★★★★★ ★☆☆☆☆ Found in Text Mining only
Niemann-Pick Disease, Type C	Niemann-Pick Disease	BEFREE	28543390		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	23904219, 26503334, 31322229		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	22253297		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	22027747	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	22253297, 25833695	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pediatric Obesity	Childhood obesity	BEFREE	31622249		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	19514049, 27036119		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	27036119	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	27895463		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinocerebellar Ataxia Type 1	Spinocerebellar Ataxia	BEFREE	23719801		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	26503628		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	23983589	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	GWASCAT_DG	27622933		★★★★★ ★☆☆☆☆ Found in Text Mining only

NLK (nemo like kinase)