SIRT1 (sirtuin 1)

Gene

• Entrez ID: 23411
• Gene name: Sirtuin 1
• Gene symbol: SIRT1
• Synonyms (NCBI Gene): SIR2, SIR2L1, SIR2alpha
• Chromosome: 10
• Chromosome location: 10q21.3
• Summary: This gene encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been det

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT002098	hsa-miR-34a-5p	Western blot	18834855
MIRT002098	hsa-miR-34a-5p	Western blot, Luciferase reporter assay, Northern blot	18755897
MIRT002098	hsa-miR-34a-5p	Western blot, Luciferase reporter assay, Northern blot	18755897
MIRT002098	hsa-miR-34a-5p	qRT-PCR, Luciferase reporter assay, Western blot	18834855
MIRT002098	hsa-miR-34a-5p	Review, Luciferase reporter assay	19461653
MIRT002098	hsa-miR-34a-5p	Luciferase reporter assay	18834855
MIRT002098	hsa-miR-34a-5p	Review	19815577
MIRT002098	hsa-miR-34a-5p	Luciferase reporter assay, qRT-PCR, Western blot	20185821
MIRT000144	hsa-miR-217	Luciferase reporter assay, Western blot	19786632
MIRT005018	hsa-miR-216a-5p	Luciferase reporter assay, Western blot	19786632
MIRT002098	hsa-miR-34a-5p	Luciferase reporter assay, qRT-PCR, Western blot	20627091
MIRT002098	hsa-miR-34a-5p	Luciferase reporter assay, qRT-PCR, Western blot	20627091
MIRT002098	hsa-miR-34a-5p	Luciferase reporter assay, Western blot	19221490
MIRT000333	hsa-miR-132-3p	Luciferase reporter assay, Western blot	19819989
MIRT002098	hsa-miR-34a-5p	Flow, Luciferase reporter assay, qRT-PCR, Western blot	20470934
MIRT002098	hsa-miR-34a-5p	qRT-PCR, Western blot	21297663
MIRT002098	hsa-miR-34a-5p	Luciferase reporter assay, qRT-PCR, Western blot	21909380
MIRT002098	hsa-miR-34a-5p	Luciferase reporter assay, qRT-PCR, Western blot	21909380
MIRT006156	hsa-miR-520c-3p	Luciferase reporter assay, qRT-PCR, Western blot	21898400
MIRT006156	hsa-miR-520c-3p	Luciferase reporter assay, qRT-PCR, Western blot	21898400
MIRT006158	hsa-miR-373-3p	Luciferase reporter assay, qRT-PCR, Western blot	21898400
MIRT006158	hsa-miR-373-3p	Luciferase reporter assay, qRT-PCR, Western blot	21898400
MIRT006213	hsa-miR-181a-5p	Immunoblot, Luciferase reporter assay, qRT-PCR	22476949
MIRT006213	hsa-miR-181a-5p	Immunoblot, Luciferase reporter assay, qRT-PCR	22476949
MIRT006271	hsa-miR-138-5p	Luciferase reporter assay	22228303
MIRT006213	hsa-miR-181a-5p	Luciferase reporter assay	22228303
MIRT006213	hsa-miR-181a-5p	Luciferase reporter assay	22228303
MIRT006272	hsa-miR-181b-5p	Luciferase reporter assay	22228303
MIRT006272	hsa-miR-181b-5p	Luciferase reporter assay	22228303
MIRT006348	hsa-miR-449a	Luciferase reporter assay, Western blot	21418558
MIRT006349	hsa-miR-449b-5p	Luciferase reporter assay, Western blot	21418558
MIRT002098	hsa-miR-34a-5p	qRT-PCR, Western blot	21297663
MIRT002098	hsa-miR-34a-5p	Luciferase reporter assay, qRT-PCR, Western blot	21909380
MIRT002098	hsa-miR-34a-5p	Luciferase reporter assay, qRT-PCR, Western blot	21909380
MIRT006156	hsa-miR-520c-3p	Luciferase reporter assay, qRT-PCR, Western blot	21898400
MIRT006156	hsa-miR-520c-3p	Luciferase reporter assay, qRT-PCR, Western blot	21898400
MIRT006158	hsa-miR-373-3p	Luciferase reporter assay, qRT-PCR, Western blot	21898400
MIRT006158	hsa-miR-373-3p	Luciferase reporter assay, qRT-PCR, Western blot	21898400
MIRT006213	hsa-miR-181a-5p	Immunoblot, Luciferase reporter assay, qRT-PCR	22476949
MIRT006213	hsa-miR-181a-5p	Immunoblot, Luciferase reporter assay, qRT-PCR	22476949
MIRT006271	hsa-miR-138-5p	Luciferase reporter assay	22228303
MIRT006213	hsa-miR-181a-5p	Luciferase reporter assay	22228303
MIRT006213	hsa-miR-181a-5p	Luciferase reporter assay	22228303
MIRT006272	hsa-miR-181b-5p	Luciferase reporter assay	22228303
MIRT006272	hsa-miR-181b-5p	Luciferase reporter assay	22228303
MIRT006348	hsa-miR-449a	Luciferase reporter assay, Western blot	21418558
MIRT006349	hsa-miR-449b-5p	Luciferase reporter assay, Western blot	21418558
MIRT002098	hsa-miR-34a-5p	qRT-PCR, Western blot	21297663
MIRT002098	hsa-miR-34a-5p	Luciferase reporter assay, qRT-PCR, Western blot	21909380
MIRT002098	hsa-miR-34a-5p	Luciferase reporter assay, qRT-PCR, Western blot	21909380
MIRT006156	hsa-miR-520c-3p	Luciferase reporter assay, qRT-PCR, Western blot	21898400
MIRT006156	hsa-miR-520c-3p	Luciferase reporter assay, qRT-PCR, Western blot	21898400
MIRT006158	hsa-miR-373-3p	Luciferase reporter assay, qRT-PCR, Western blot	21898400
MIRT006158	hsa-miR-373-3p	Luciferase reporter assay, qRT-PCR, Western blot	21898400
MIRT006213	hsa-miR-181a-5p	Immunoblot, Luciferase reporter assay, qRT-PCR	22476949
MIRT006213	hsa-miR-181a-5p	Immunoblot, Luciferase reporter assay, qRT-PCR	22476949
MIRT006271	hsa-miR-138-5p	Luciferase reporter assay	22228303
MIRT006213	hsa-miR-181a-5p	Luciferase reporter assay	22228303
MIRT006213	hsa-miR-181a-5p	Luciferase reporter assay	22228303
MIRT006272	hsa-miR-181b-5p	Luciferase reporter assay	22228303
MIRT006272	hsa-miR-181b-5p	Luciferase reporter assay	22228303
MIRT006348	hsa-miR-449a	Luciferase reporter assay, Western blot	21418558
MIRT006349	hsa-miR-449b-5p	Luciferase reporter assay, Western blot	21418558
MIRT006878	hsa-miR-181c-5p	In situ hybridization, Luciferase reporter assay	21720722
MIRT006892	hsa-miR-9-5p	In situ hybridization, Luciferase reporter assay	21720722
MIRT007324	hsa-miR-128-3p	Luciferase reporter assay	23492773
MIRT006892	hsa-miR-9-5p	Western blot;qRT-PCR	20362537
MIRT023069	hsa-miR-124-3p	qRT-PCR	20362537
MIRT024509	hsa-miR-215-5p	Microarray	19074876
MIRT002098	hsa-miR-34a-5p	Reporter assay;Western blot;qRT-PCR	20185821
MIRT002098	hsa-miR-34a-5p	Reporter assay;Western blot;qRT-PCR	20627091
MIRT026849	hsa-miR-192-5p	Microarray	19074876
MIRT052646	hsa-miR-199a-5p	qRT-PCR, Western blot	23760629
MIRT051790	hsa-let-7c-5p	CLASH	23622248
MIRT043458	hsa-miR-331-3p	CLASH	23622248
MIRT053127	hsa-miR-204-5p	Luciferase reporter assay, qRT-PCR, Western blot	23768087
MIRT053343	hsa-miR-29c-3p	Luciferase reporter assay, qRT-PCR, Western blot	23728341
MIRT053343	hsa-miR-29c-3p	Luciferase reporter assay, qRT-PCR, Western blot	23728341
MIRT053127	hsa-miR-204-5p	Luciferase reporter assay, qRT-PCR, Western blot	23768087
MIRT052646	hsa-miR-199a-5p	Luciferase reporter assay, qRT-PCR, Western blot	24839982
MIRT002098	hsa-miR-34a-5p	qRT-PCR	23292172
MIRT002098	hsa-miR-34a-5p	Luciferase reporter assay, qRT-PCR, Western blot	23954321
MIRT438672	hsa-miR-142-5p	Immunofluorescence, In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	23752207
MIRT438672	hsa-miR-142-5p	Immunofluorescence, In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	23752207
MIRT438651	hsa-miR-126-3p	Luciferase reporter assay, qRT-PCR, Western blot	23877372
MIRT438651	hsa-miR-126-3p	Luciferase reporter assay, qRT-PCR, Western blot	23877372
MIRT000144	hsa-miR-217	Luciferase reporter assay, Western blot, qRT-PCR	25172416
MIRT000144	hsa-miR-217	Luciferase reporter assay, Western blot, qRT-PCR	25172416
MIRT002098	hsa-miR-34a-5p	qRT-PCR	24504520
MIRT002098	hsa-miR-34a-5p	qRT-PCR	23292172
MIRT002098	hsa-miR-34a-5p	Luciferase reporter assay, qRT-PCR, Western blot	23954321
MIRT438672	hsa-miR-142-5p	Immunofluorescence, In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	23752207
MIRT438672	hsa-miR-142-5p	Immunofluorescence, In situ hybridization, Luciferase reporter assay, qRT-PCR, Western blot	23752207
MIRT438651	hsa-miR-126-3p	Luciferase reporter assay, qRT-PCR, Western blot	23877372
MIRT438651	hsa-miR-126-3p	Luciferase reporter assay, qRT-PCR, Western blot	23877372
MIRT000144	hsa-miR-217	Luciferase reporter assay, Western blot, qRT-PCR	25172416
MIRT000144	hsa-miR-217	Luciferase reporter assay, Western blot, qRT-PCR	25172416
MIRT002098	hsa-miR-34a-5p	qRT-PCR	24504520
MIRT177771	hsa-miR-548at-5p	PAR-CLIP	22100165
MIRT450611	hsa-miR-4474-5p	PAR-CLIP	22100165
MIRT439628	hsa-miR-155-5p	HITS-CLIP	22473208
MIRT439628	hsa-miR-155-5p	HITS-CLIP	22473208
MIRT002098	hsa-miR-34a-5p	Western blot	25348795
MIRT002098	hsa-miR-34a-5p	Luciferase reporter assay	25526086
MIRT002098	hsa-miR-34a-5p	Luciferase reporter assay	25526086
MIRT002098	hsa-miR-34a-5p	Western blot	25585539
MIRT052646	hsa-miR-199a-5p	Luciferase reporter assay	26344589
MIRT002098	hsa-miR-34a-5p	5.0	26802970
MIRT002098	hsa-miR-34a-5p	5.0	26802970
MIRT006271	hsa-miR-138-5p	In situ hybridization, Luciferase reporter assay, Western blot	28052003
MIRT006271	hsa-miR-138-5p	In situ hybridization, Luciferase reporter assay, Western blot	28052003
MIRT006213	hsa-miR-181a-5p	GFP reporter assay	26922183
MIRT263019	hsa-miR-22-3p	Luciferase reporter assay	26912776
MIRT263019	hsa-miR-22-3p	Luciferase reporter assay	26912776
MIRT263019	hsa-miR-22-3p	Luciferase reporter assay	26912776
MIRT263019	hsa-miR-22-3p	Luciferase reporter assay	26912776
MIRT263019	hsa-miR-22-3p	Luciferase reporter assay	26912776
MIRT731643	hsa-miR-133b	Luciferase reporter assay	27166997
MIRT731643	hsa-miR-133b	Luciferase reporter assay	27166997
MIRT053127	hsa-miR-204-5p	Luciferase reporter assay	27156885
MIRT731643	hsa-miR-133b	Luciferase reporter assay	27090017
MIRT731643	hsa-miR-133b	Luciferase reporter assay	27090017
MIRT263012	hsa-miR-543	Luciferase reporter assay, qRT-PCR, Western blot	26612257
MIRT263012	hsa-miR-543	Luciferase reporter assay, qRT-PCR, Western blot	26612257
MIRT052646	hsa-miR-199a-5p	Immunoprecipitaion, qRT-PCR, Western blot	26945677
MIRT006348	hsa-miR-449a	Immunoblot, Luciferase reporter assay, qRT-PCR	26988912
MIRT006348	hsa-miR-449a	Immunoblot, Luciferase reporter assay, qRT-PCR	26988912
MIRT006348	hsa-miR-449a	Luciferase reporter assay, qRT-PCR, Western blot	27421775
MIRT006348	hsa-miR-449a	Luciferase reporter assay, qRT-PCR, Western blot	27421775
MIRT733820	hsa-miR-34a-3p	Western blot	25395581
MIRT733852	hsa-miR-92a-3p	Luciferase reporter assay	25550450
MIRT733852	hsa-miR-92a-3p	Luciferase reporter assay	25550450
MIRT733852	hsa-miR-92a-3p	Luciferase reporter assay	25550450
MIRT733852	hsa-miR-92a-3p	Luciferase reporter assay	25550450
MIRT002098	hsa-miR-34a-5p	Immunoblot, qRT-PCR	28250026
MIRT000333	hsa-miR-132-3p	ChIP-seq, Immunoprecipitaion, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	28383763
MIRT000333	hsa-miR-132-3p	ChIP-seq, Immunoprecipitaion, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	28383763
MIRT002098	hsa-miR-34a-5p	Luciferase reporter assay, Western blot	28236278
MIRT006271	hsa-miR-138-5p	Luciferase reporter assay, Western blot	28236278
MIRT002098	hsa-miR-34a-5p	Western blot	25826085
MIRT006892	hsa-miR-9-5p	Luciferase reporter assay	27914878
MIRT006892	hsa-miR-9-5p	Luciferase reporter assay	27914878
MIRT006892	hsa-miR-9-5p	Luciferase reporter assay	27914878
MIRT002098	hsa-miR-34a-5p	Luciferase reporter assay	27767101
MIRT002098	hsa-miR-34a-5p	Luciferase reporter assay	27767101
MIRT002098	hsa-miR-34a-5p	Luciferase reporter assay, qRT-PCR, Western blot	27767101
MIRT002098	hsa-miR-34a-5p	Luciferase reporter assay, qRT-PCR, Western blot	27767101
MIRT002098	hsa-miR-34a-5p	Luciferase reporter assay, qRT-PCR, Western blot	27767101
MIRT053127	hsa-miR-204-5p	Luciferase reporter assay, qRT-PCR, Western blot	25998694
MIRT023069	hsa-miR-124-3p	Luciferase reporter assay, qRT-PCR, Western blot	27646435
MIRT439628	hsa-miR-155-3p	Luciferase reporter assay, qRT-PCR, Western blot	27646435
MIRT439628	hsa-miR-155-3p	Luciferase reporter assay, qRT-PCR, Western blot	27646435
MIRT439628	hsa-miR-155-3p	Luciferase reporter assay, qRT-PCR, Western blot	27646435
MIRT053127	hsa-miR-204-5p	Luciferase reporter assay, qRT-PCR, Western blot	27748572
MIRT053127	hsa-miR-204-5p	Luciferase reporter assay, qRT-PCR, Western blot	27748572
MIRT006892	hsa-miR-9-5p	Luciferase reporter assay, qRT-PCR, Western blot	27756894
MIRT006892	hsa-miR-9-5p	Luciferase reporter assay, qRT-PCR, Western blot	27756894
MIRT006271	hsa-miR-138-5p	Luciferase reporter assay	28236278
MIRT006271	hsa-miR-138-5p	Luciferase reporter assay, qRT-PCR, Western blot	27207584
MIRT006271	hsa-miR-138-5p	Luciferase reporter assay, qRT-PCR, Western blot	27207584
MIRT006271	hsa-miR-138-5p	Luciferase reporter assay, qRT-PCR, Western blot	27207584
MIRT002098	hsa-miR-34a-5p	Luciferase reporter assay, qRT-PCR, Western blot	27247228
MIRT263019	hsa-miR-22-3p	Luciferase reporter assay, qRT-PCR, Western blot	26662303
MIRT000144	hsa-miR-217	Luciferase reporter assay, Western blotting, qRT-PCR	32267139
MIRT000144	hsa-miR-217	Luciferase reporter assay, Western blotting, qRT-PCR, ELISA	31432137
MIRT733631	hsa-miR-1301-3p	Immunohistochemistry (IHC), Luciferase reporter assay, qRT-PCR, Western blotting	33987098
MIRT733820	hsa-miR-34a-3p	qRT-PCR	33718673
MIRT733852	hsa-miR-92a-3p	qRT-PCR, Western blotting	33742265
MIRT052646	hsa-miR-199a-5p	ELISA, Immunofluorescence, Luciferase reporter assay, qRT-PCR, RNA-seq, Western blotting	34132029
MIRT263019	hsa-miR-22-3p	Western blotting, Microarray, qRT-PCR	31612074
MIRT734467	hsa-miR-155-3p	Immunofluorescence, Luciferase reporter assay, Western blotting	33748285
MIRT002098	hsa-miR-34a-5p	Western blotting, Immunohistochemistry (IHC), Immunofluorescence, qRT-PCR, Flow cytometry	32161722
MIRT002098	hsa-miR-34a-5p	qRT-PCR	31885789
MIRT735066	hsa-miR-27a-5p	Luciferase reporter assay, Western blotting, Microarray, Immunofluorescence, qRT-PCR, Flow cytometry	32790210
MIRT002098	hsa-miR-34a-5p	Luciferase reporter assay, Western blotting, qRT-PCR, Flow cytometry	33488795
MIRT000333	hsa-miR-132-3p	Luciferase reporter assay, Western blotting, qRT-PCR	32950974
MIRT735186	hsa-miR-212-3p	Luciferase reporter assay, Western blotting, qRT-PCR	32950974
MIRT000333	hsa-miR-132-3p	Western blotting, qRT-PCR, ELISA	32219698
MIRT735713	hsa-miR-1185-1-3p	Western blotting, Immunoprecipitaion (IP), Immunohistochemistry (IHC), in vitro cullelar assays, qRT-PCR, Flow cytometry	33046442
MIRT007324	hsa-miR-128-3p	Western blotting, qRT-PCR	32528236
MIRT263019	hsa-miR-22-3p	Luciferase reporter assay, Western blotting, qRT-PCR	31503007
MIRT731643	hsa-miR-133b	qRT-PCR	32655835
MIRT737526	hsa-miR-29a-3p	Microarray, qRT-PCR	32741895
MIRT737527	hsa-miR-23a-3p	Microarray, qRT-PCR	32741895
MIRT177771	hsa-miR-548at-5p	PAR-CLIP	22100165
MIRT450611	hsa-miR-4474-5p	PAR-CLIP	22100165
MIRT002098	hsa-miR-34a-5p	Luciferase reporter assay, Western blotting, qRT-PCR	38828289
MIRT756377	hsa-miR-139-5p	Western blotting	37794118
MIRT756394	hsa-miR-141-3p	Luciferase reporter assay, Western blotting, qRT-PCR	34868528
MIRT1350042	hsa-miR-3125	CLIP-seq
MIRT1350043	hsa-miR-3916	CLIP-seq
MIRT1350044	hsa-miR-4266	CLIP-seq
MIRT1350045	hsa-miR-4477a	CLIP-seq
MIRT1350046	hsa-miR-4765	CLIP-seq
MIRT1350047	hsa-miR-4775	CLIP-seq
MIRT1350048	hsa-miR-502-5p	CLIP-seq
MIRT1350049	hsa-miR-651	CLIP-seq
MIRT1350050	hsa-miR-1208	CLIP-seq
MIRT1350051	hsa-miR-1271	CLIP-seq
MIRT1350052	hsa-miR-1279	CLIP-seq
MIRT1350053	hsa-miR-1283	CLIP-seq
MIRT1350054	hsa-miR-1301	CLIP-seq
MIRT1350055	hsa-miR-132	CLIP-seq
MIRT1350056	hsa-miR-182	CLIP-seq
MIRT1350057	hsa-miR-186	CLIP-seq
MIRT1350058	hsa-miR-200b	CLIP-seq
MIRT1350059	hsa-miR-200c	CLIP-seq
MIRT1350060	hsa-miR-212	CLIP-seq
MIRT1350061	hsa-miR-22	CLIP-seq
MIRT1350062	hsa-miR-2355-5p	CLIP-seq
MIRT1350063	hsa-miR-23a	CLIP-seq
MIRT1350064	hsa-miR-23b	CLIP-seq
MIRT1350065	hsa-miR-23c	CLIP-seq
MIRT1350066	hsa-miR-29a	CLIP-seq
MIRT1350067	hsa-miR-29b	CLIP-seq
MIRT1350068	hsa-miR-29c	CLIP-seq
MIRT1350069	hsa-miR-3064-3p	CLIP-seq
MIRT1350070	hsa-miR-3133	CLIP-seq
MIRT1350071	hsa-miR-3140-3p	CLIP-seq
MIRT1350072	hsa-miR-3148	CLIP-seq
MIRT1350073	hsa-miR-3163	CLIP-seq
MIRT1350074	hsa-miR-3177-5p	CLIP-seq
MIRT1350075	hsa-miR-3190	CLIP-seq
MIRT1350076	hsa-miR-338-5p	CLIP-seq
MIRT1350077	hsa-miR-34a	CLIP-seq
MIRT1350078	hsa-miR-34c-5p	CLIP-seq
MIRT1350079	hsa-miR-3591-5p	CLIP-seq
MIRT1350080	hsa-miR-3607-3p	CLIP-seq
MIRT1350081	hsa-miR-3618	CLIP-seq
MIRT1350082	hsa-miR-374c	CLIP-seq
MIRT1350083	hsa-miR-3978	CLIP-seq
MIRT1350084	hsa-miR-412	CLIP-seq
MIRT1350085	hsa-miR-4251	CLIP-seq
MIRT1350086	hsa-miR-4280	CLIP-seq
MIRT1350087	hsa-miR-4286	CLIP-seq
MIRT1350088	hsa-miR-429	CLIP-seq
MIRT1350089	hsa-miR-4328	CLIP-seq
MIRT1350090	hsa-miR-4418	CLIP-seq
MIRT1350091	hsa-miR-4420	CLIP-seq
MIRT1350092	hsa-miR-4455	CLIP-seq
MIRT1350093	hsa-miR-448	CLIP-seq
MIRT1350094	hsa-miR-449b	CLIP-seq
MIRT1350095	hsa-miR-450b-5p	CLIP-seq
MIRT1350096	hsa-miR-4635	CLIP-seq
MIRT1350097	hsa-miR-4660	CLIP-seq
MIRT1350098	hsa-miR-4662a-5p	CLIP-seq
MIRT1350099	hsa-miR-4695-3p	CLIP-seq
MIRT1350100	hsa-miR-4752	CLIP-seq
MIRT1350101	hsa-miR-4773	CLIP-seq
MIRT1350102	hsa-miR-4795-3p	CLIP-seq
MIRT1350103	hsa-miR-488	CLIP-seq
MIRT1350104	hsa-miR-491-3p	CLIP-seq
MIRT1350105	hsa-miR-5047	CLIP-seq
MIRT1350106	hsa-miR-507	CLIP-seq
MIRT1350107	hsa-miR-509-3-5p	CLIP-seq
MIRT1350108	hsa-miR-509-5p	CLIP-seq
MIRT1350109	hsa-miR-526b	CLIP-seq
MIRT1350110	hsa-miR-539	CLIP-seq
MIRT1350111	hsa-miR-548a-5p	CLIP-seq
MIRT1350112	hsa-miR-548ab	CLIP-seq
MIRT1350113	hsa-miR-548ak	CLIP-seq
MIRT1350114	hsa-miR-548b-5p	CLIP-seq
MIRT1350115	hsa-miR-548c-3p	CLIP-seq
MIRT1350116	hsa-miR-548c-5p	CLIP-seq
MIRT1350117	hsa-miR-548d-5p	CLIP-seq
MIRT1350118	hsa-miR-548h	CLIP-seq
MIRT1350119	hsa-miR-548i	CLIP-seq
MIRT1350120	hsa-miR-548j	CLIP-seq
MIRT1350121	hsa-miR-548k	CLIP-seq
MIRT1350122	hsa-miR-548l	CLIP-seq
MIRT1350123	hsa-miR-548n	CLIP-seq
MIRT1350124	hsa-miR-548t	CLIP-seq
MIRT1350125	hsa-miR-548u	CLIP-seq
MIRT1350126	hsa-miR-548w	CLIP-seq
MIRT1350127	hsa-miR-548y	CLIP-seq
MIRT1350128	hsa-miR-557	CLIP-seq
MIRT1350129	hsa-miR-559	CLIP-seq
MIRT1350130	hsa-miR-570	CLIP-seq
MIRT1350131	hsa-miR-586	CLIP-seq
MIRT1350132	hsa-miR-590-3p	CLIP-seq
MIRT1350133	hsa-miR-607	CLIP-seq
MIRT1350134	hsa-miR-609	CLIP-seq
MIRT1350135	hsa-miR-633	CLIP-seq
MIRT1350136	hsa-miR-655	CLIP-seq
MIRT1350137	hsa-miR-936	CLIP-seq
MIRT1350138	hsa-miR-96	CLIP-seq
MIRT1350053	hsa-miR-1283	CLIP-seq
MIRT1350055	hsa-miR-132	CLIP-seq
MIRT2103736	hsa-miR-141	CLIP-seq
MIRT2103737	hsa-miR-200a	CLIP-seq
MIRT1350060	hsa-miR-212	CLIP-seq
MIRT2103738	hsa-miR-3143	CLIP-seq
MIRT2103739	hsa-miR-3149	CLIP-seq
MIRT1350076	hsa-miR-338-5p	CLIP-seq
MIRT1350081	hsa-miR-3618	CLIP-seq
MIRT1350047	hsa-miR-4775	CLIP-seq
MIRT1350133	hsa-miR-607	CLIP-seq
MIRT2327874	hsa-miR-4699-5p	CLIP-seq
MIRT2327875	hsa-miR-4709-3p	CLIP-seq
MIRT2394561	hsa-miR-579	CLIP-seq
MIRT1350057	hsa-miR-186	CLIP-seq
MIRT1350061	hsa-miR-22	CLIP-seq
MIRT2622859	hsa-miR-221	CLIP-seq
MIRT2622860	hsa-miR-222	CLIP-seq
MIRT1350069	hsa-miR-3064-3p	CLIP-seq
MIRT2622861	hsa-miR-3128	CLIP-seq
MIRT1350070	hsa-miR-3133	CLIP-seq
MIRT1350072	hsa-miR-3148	CLIP-seq
MIRT2622862	hsa-miR-3152-3p	CLIP-seq
MIRT2622863	hsa-miR-3187-3p	CLIP-seq
MIRT2622864	hsa-miR-326	CLIP-seq
MIRT2622865	hsa-miR-330-3p	CLIP-seq
MIRT2622866	hsa-miR-330-5p	CLIP-seq
MIRT1350077	hsa-miR-34a	CLIP-seq
MIRT1350078	hsa-miR-34c-5p	CLIP-seq
MIRT1350083	hsa-miR-3978	CLIP-seq
MIRT1350089	hsa-miR-4328	CLIP-seq
MIRT2622867	hsa-miR-4422	CLIP-seq
MIRT1350092	hsa-miR-4455	CLIP-seq
MIRT1350094	hsa-miR-449b	CLIP-seq
MIRT2622868	hsa-miR-4529-5p	CLIP-seq
MIRT2622869	hsa-miR-4666-5p	CLIP-seq
MIRT2622870	hsa-miR-4720-5p	CLIP-seq
MIRT2622871	hsa-miR-4729	CLIP-seq
MIRT2622872	hsa-miR-4768-5p	CLIP-seq
MIRT1350101	hsa-miR-4773	CLIP-seq
MIRT2622873	hsa-miR-4799-3p	CLIP-seq
MIRT1350104	hsa-miR-491-3p	CLIP-seq
MIRT2622874	hsa-miR-494	CLIP-seq
MIRT1350115	hsa-miR-548c-3p	CLIP-seq
MIRT2622875	hsa-miR-548v	CLIP-seq
MIRT2622876	hsa-miR-556-5p	CLIP-seq
MIRT2622877	hsa-miR-562	CLIP-seq
MIRT2394561	hsa-miR-579	CLIP-seq
MIRT1350131	hsa-miR-586	CLIP-seq
MIRT1350134	hsa-miR-609	CLIP-seq
MIRT2622878	hsa-miR-616	CLIP-seq
MIRT1350057	hsa-miR-186	CLIP-seq
MIRT1350061	hsa-miR-22	CLIP-seq
MIRT1350069	hsa-miR-3064-3p	CLIP-seq
MIRT2622861	hsa-miR-3128	CLIP-seq
MIRT1350070	hsa-miR-3133	CLIP-seq
MIRT1350072	hsa-miR-3148	CLIP-seq
MIRT2622862	hsa-miR-3152-3p	CLIP-seq
MIRT2622863	hsa-miR-3187-3p	CLIP-seq
MIRT2622864	hsa-miR-326	CLIP-seq
MIRT2622866	hsa-miR-330-5p	CLIP-seq
MIRT1350077	hsa-miR-34a	CLIP-seq
MIRT1350078	hsa-miR-34c-5p	CLIP-seq
MIRT1350083	hsa-miR-3978	CLIP-seq
MIRT1350089	hsa-miR-4328	CLIP-seq
MIRT1350092	hsa-miR-4455	CLIP-seq
MIRT1350094	hsa-miR-449b	CLIP-seq
MIRT2622868	hsa-miR-4529-5p	CLIP-seq
MIRT2622870	hsa-miR-4720-5p	CLIP-seq
MIRT2622872	hsa-miR-4768-5p	CLIP-seq
MIRT2622873	hsa-miR-4799-3p	CLIP-seq
MIRT1350104	hsa-miR-491-3p	CLIP-seq
MIRT1350115	hsa-miR-548c-3p	CLIP-seq
MIRT2622877	hsa-miR-562	CLIP-seq
MIRT2394561	hsa-miR-579	CLIP-seq
MIRT1350131	hsa-miR-586	CLIP-seq
MIRT1350134	hsa-miR-609	CLIP-seq
MIRT2622878	hsa-miR-616	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
ATF4	Activation	22363646
ATF4	Repression	21801305
BRCA1	Activation	18851829;20160719;21407215;9000507
CIITA	Repression	22064865
DDIT3	Repression	21801305
FOXL2	Activation	19010791
FOXO3	Activation	23525956
GTF2I	Activation	21407215
HIC1	Repression	19525223;19649206
HIC1	Unknown	22064865
RELA	Activation	20617556
SP1	Unknown	23843607

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000012	Process	Single strand break repair	IMP	20097625
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	11672523, 12535671, 15692560, 20955178
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IMP	17505061, 20203304, 21947282
GO:0000183	Process	RDNA heterochromatin formation	IDA	18485871
GO:0000183	Process	RDNA heterochromatin formation	IMP	18485871
GO:0000183	Process	RDNA heterochromatin formation	TAS
GO:0000720	Process	Pyrimidine dimer repair by nucleotide-excision repair	IEA
GO:0000720	Process	Pyrimidine dimer repair by nucleotide-excision repair	IMP	21149730
GO:0000731	Process	DNA synthesis involved in DNA repair	IEA
GO:0000731	Process	DNA synthesis involved in DNA repair	ISS
GO:0000781	Component	Chromosome, telomeric region	IEA
GO:0000785	Component	Chromatin	IDA	17505061, 22956909
GO:0000785	Component	Chromatin	IEA
GO:0000791	Component	Euchromatin	IDA	15469825
GO:0000792	Component	Heterochromatin	IDA	15469825
GO:0000792	Component	Heterochromatin	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0001525	Process	Angiogenesis	IDA	20620956
GO:0001525	Process	Angiogenesis	IEA
GO:0001542	Process	Ovulation from ovarian follicle	IEA
GO:0001650	Component	Fibrillar center	IDA
GO:0001678	Process	Intracellular glucose homeostasis	IEA
GO:0001678	Process	Intracellular glucose homeostasis	ISS
GO:0001934	Process	Positive regulation of protein phosphorylation	ISS
GO:0001938	Process	Positive regulation of endothelial cell proliferation	IMP	20203304
GO:0002039	Function	P53 binding	IEA
GO:0002039	Function	P53 binding	IPI	11672523
GO:0002821	Process	Positive regulation of adaptive immune response	IDA	21890893
GO:0003713	Function	Transcription coactivator activity	IEA
GO:0003714	Function	Transcription corepressor activity	IBA
GO:0003714	Function	Transcription corepressor activity	IDA	12535671, 20955178
GO:0003714	Function	Transcription corepressor activity	IEA
GO:0003714	Function	Transcription corepressor activity	IMP	17505061
GO:0003714	Function	Transcription corepressor activity	ISS
GO:0003950	Function	NAD+ poly-ADP-ribosyltransferase activity	TAS	17456799
GO:0004407	Function	Histone deacetylase activity	EXP	18485871
GO:0004857	Function	Enzyme inhibitor activity	IEA
GO:0005515	Function	Protein binding	IPI	11672523, 12006491, 12535671, 14976264, 15126506, 15152190, 15175761, 15205477, 15220471, 15632193, 15692560, 16892051, 16998810, 17172643, 17334224, 17612497, 17680780, 17901049, 17936707, 17964266, 18004385, 18203716, 18235501, 18235502, 18296641, 18485871, 19047049, 19188449, 192
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	11672523, 19934257, 20027304, 20167603, 20955178
GO:0005634	Component	Nucleus	IEA
GO:0005635	Component	Nuclear envelope	IDA	15469825
GO:0005637	Component	Nuclear inner membrane	IBA
GO:0005637	Component	Nuclear inner membrane	IDA	15469825
GO:0005654	Component	Nucleoplasm	IBA
GO:0005654	Component	Nucleoplasm	IDA	16079181
GO:0005654	Component	Nucleoplasm	TAS
GO:0005677	Component	Chromatin silencing complex	IDA	18485871
GO:0005730	Component	Nucleolus	IDA	16079181
GO:0005730	Component	Nucleolus	IDA	15469825, 18485871
GO:0005737	Component	Cytoplasm	IDA	15469825
GO:0005737	Component	Cytoplasm	IDA	20027304
GO:0005739	Component	Mitochondrion	IDA
GO:0005829	Component	Cytosol	IDA	20027304
GO:0005829	Component	Cytosol	IDA
GO:0006094	Process	Gluconeogenesis	IDA	16753578, 30193097
GO:0006325	Process	Chromatin organization	IMP	22956909
GO:0006346	Process	DNA methylation-dependent constitutive heterochromatin formation	TAS	21947282
GO:0006476	Process	Protein deacetylation	IDA	18203716, 18662546, 20027304, 31722219
GO:0006476	Process	Protein deacetylation	IMP	24824780
GO:0006642	Process	Triglyceride mobilization	IEA
GO:0006642	Process	Triglyceride mobilization	ISS
GO:0006915	Process	Apoptotic process	IEA
GO:0006974	Process	DNA damage response	IBA
GO:0006974	Process	DNA damage response	IDA	18203716
GO:0006979	Process	Response to oxidative stress	IDA	14976264
GO:0007179	Process	Transforming growth factor beta receptor signaling pathway	IDA	23960241
GO:0007283	Process	Spermatogenesis	IEA
GO:0007346	Process	Regulation of mitotic cell cycle	IDA	15692560
GO:0007517	Process	Muscle organ development	IEA
GO:0007623	Process	Circadian rhythm	IEA
GO:0008047	Function	Enzyme activator activity	IDA	18203716
GO:0008284	Process	Positive regulation of cell population proliferation	IMP	21807113
GO:0008630	Process	Intrinsic apoptotic signaling pathway in response to DNA damage	IEA
GO:0009267	Process	Cellular response to starvation	IEA
GO:0009267	Process	Cellular response to starvation	ISS
GO:0010629	Process	Negative regulation of gene expression	IMP	17916362
GO:0010824	Process	Regulation of centrosome duplication	IDA	31722219
GO:0010868	Process	Negative regulation of triglyceride biosynthetic process	IDA	29765047
GO:0010875	Process	Positive regulation of cholesterol efflux	IEA
GO:0010875	Process	Positive regulation of cholesterol efflux	ISS
GO:0010883	Process	Regulation of lipid storage	IEA
GO:0010883	Process	Regulation of lipid storage	ISS
GO:0010906	Process	Regulation of glucose metabolic process	IEA
GO:0010906	Process	Regulation of glucose metabolic process	ISS
GO:0016239	Process	Positive regulation of macroautophagy	IDA	18296641
GO:0016239	Process	Positive regulation of macroautophagy	IEA
GO:0016567	Process	Protein ubiquitination	IDA	21841822
GO:0016605	Component	PML body	IDA	12006491
GO:0016605	Component	PML body	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016922	Function	Nuclear receptor binding	IPI	24043310
GO:0017136	Function	Histone deacetylase activity, NAD-dependent	IDA	12006491, 15469825, 16079181, 16959573, 28497810
GO:0017136	Function	Histone deacetylase activity, NAD-dependent	IEA
GO:0018394	Process	Peptidyl-lysine acetylation	IMP	18004385
GO:0019213	Function	Deacetylase activity	IDA	18203716
GO:0019213	Function	Deacetylase activity	IEA
GO:0019432	Process	Triglyceride biosynthetic process	IDA	29765047
GO:0019899	Function	Enzyme binding	IEA
GO:0019899	Function	Enzyme binding	IPI	23382074
GO:0019904	Function	Protein domain specific binding	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0030225	Process	Macrophage differentiation	IEA
GO:0030225	Process	Macrophage differentiation	ISS
GO:0030512	Process	Negative regulation of transforming growth factor beta receptor signaling pathway	IEA
GO:0030512	Process	Negative regulation of transforming growth factor beta receptor signaling pathway	ISS
GO:0030968	Process	Endoplasmic reticulum unfolded protein response	IDA	20955178
GO:0030968	Process	Endoplasmic reticulum unfolded protein response	IEA
GO:0031393	Process	Negative regulation of prostaglandin biosynthetic process	IEA
GO:0031393	Process	Negative regulation of prostaglandin biosynthetic process	ISS
GO:0031507	Process	Heterochromatin formation	IDA	15469825
GO:0031507	Process	Heterochromatin formation	IEA
GO:0031509	Process	Subtelomeric heterochromatin formation	IBA
GO:0031648	Process	Protein destabilization	IEA
GO:0031648	Process	Protein destabilization	ISS
GO:0032007	Process	Negative regulation of TOR signaling	IEA
GO:0032007	Process	Negative regulation of TOR signaling	IMP	20169165
GO:0032041	Function	Histone H3K14 deacetylase activity, NAD-dependent	IBA
GO:0032041	Function	Histone H3K14 deacetylase activity, NAD-dependent	IDA	15469825
GO:0032071	Process	Regulation of endodeoxyribonuclease activity	IMP	19934257
GO:0032088	Process	Negative regulation of NF-kappaB transcription factor activity	IDA	15152190
GO:0032436	Process	Positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IEA
GO:0032436	Process	Positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IMP	20203304
GO:0032868	Process	Response to insulin	IEA
GO:0032868	Process	Response to insulin	ISS
GO:0032922	Process	Circadian regulation of gene expression	IEA
GO:0032922	Process	Circadian regulation of gene expression	IMP	18662546
GO:0032922	Process	Circadian regulation of gene expression	ISS
GO:0032991	Component	Protein-containing complex	IEA
GO:0033210	Process	Leptin-mediated signaling pathway	IEA
GO:0033210	Process	Leptin-mediated signaling pathway	ISS
GO:0033553	Component	RDNA heterochromatin	IBA
GO:0033553	Component	RDNA heterochromatin	IDA	18485871
GO:0033558	Function	Protein lysine deacetylase activity	IDA	19934257, 20027304, 21807113, 23056314
GO:0033558	Function	Protein lysine deacetylase activity	IEA
GO:0033558	Function	Protein lysine deacetylase activity	IMP	20203304, 20424141, 20670893
GO:0033558	Function	Protein lysine deacetylase activity	TAS
GO:0034391	Process	Regulation of smooth muscle cell apoptotic process	IEA
GO:0034391	Process	Regulation of smooth muscle cell apoptotic process	ISS
GO:0034979	Function	NAD-dependent protein lysine deacetylase activity	IDA	15692560, 20100829, 20955178, 21775285, 22918831, 23142079, 29681526, 29765047, 30193097, 30409912, 32034146, 32538779
GO:0034979	Function	NAD-dependent protein lysine deacetylase activity	IEA
GO:0034979	Function	NAD-dependent protein lysine deacetylase activity	IMP	11672523
GO:0034979	Function	NAD-dependent protein lysine deacetylase activity	TAS
GO:0035098	Component	ESC/E(Z) complex	IDA	15684044
GO:0035329	Process	Hippo signaling	IDA	18579750, 19324877, 35429439
GO:0035329	Process	Hippo signaling	TAS	18158288
GO:0035331	Process	Negative regulation of hippo signaling	IDA	38512451
GO:0035356	Process	Intracellular triglyceride homeostasis	IEA
GO:0035356	Process	Intracellular triglyceride homeostasis	ISS
GO:0035358	Process	Regulation of peroxisome proliferator activated receptor signaling pathway	IEA
GO:0035358	Process	Regulation of peroxisome proliferator activated receptor signaling pathway	ISS
GO:0042127	Process	Regulation of cell population proliferation	IMP	12006491
GO:0042149	Process	Cellular response to glucose starvation	IMP	18485871
GO:0042326	Process	Negative regulation of phosphorylation	IMP	17612497
GO:0042393	Function	Histone binding	IPI	15469825, 22956909
GO:0042542	Process	Response to hydrogen peroxide	IDA	19934257
GO:0042595	Process	Behavioral response to starvation	IEA
GO:0042632	Process	Cholesterol homeostasis	IEA
GO:0042632	Process	Cholesterol homeostasis	ISS
GO:0042771	Process	Intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator	IMP	20100829
GO:0042802	Function	Identical protein binding	IPI	15469825
GO:0042981	Process	Regulation of apoptotic process	IMP	19934257
GO:0043065	Process	Positive regulation of apoptotic process	IDA	15152190
GO:0043065	Process	Positive regulation of apoptotic process	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IMP	19047049
GO:0043066	Process	Negative regulation of apoptotic process	IMP	16892051, 21775285
GO:0043124	Process	Negative regulation of canonical NF-kappaB signal transduction	IDA	17680780
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IEA
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IMP	21841822
GO:0043398	Function	HLH domain binding	IPI	12535671
GO:0043425	Function	BHLH transcription factor binding	IPI	12535671, 21807113
GO:0043518	Process	Negative regulation of DNA damage response, signal transduction by p53 class mediator	IDA	11672523
GO:0043524	Process	Negative regulation of neuron apoptotic process	IEA
GO:0043536	Process	Positive regulation of blood vessel endothelial cell migration	IDA	23960241
GO:0044321	Process	Response to leptin	IEA
GO:0044321	Process	Response to leptin	ISS
GO:0045348	Process	Positive regulation of MHC class II biosynthetic process	IDA	21890893
GO:0045599	Process	Negative regulation of fat cell differentiation	IEA
GO:0045599	Process	Negative regulation of fat cell differentiation	ISS
GO:0045722	Process	Positive regulation of gluconeogenesis	IDA	17024043
GO:0045722	Process	Positive regulation of gluconeogenesis	IDA	15692560, 23142079, 30193097
GO:0045722	Process	Positive regulation of gluconeogenesis	IEA
GO:0045739	Process	Positive regulation of DNA repair	IMP	19934257
GO:0045766	Process	Positive regulation of angiogenesis	IDA	23960241, 25217442
GO:0045766	Process	Positive regulation of angiogenesis	IMP	20424141, 24048733
GO:0045786	Process	Negative regulation of cell cycle	IMP	18485871
GO:0045892	Process	Negative regulation of DNA-templated transcription	IBA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	20074560
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	IMP	18485871
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	12837246, 21807113
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0046015	Process	Regulation of transcription by glucose	IMP	18485871
GO:0046628	Process	Positive regulation of insulin receptor signaling pathway	IDA	21241768
GO:0046872	Function	Metal ion binding	IEA
GO:0046890	Process	Regulation of lipid biosynthetic process	IEA
GO:0046969	Function	Histone H3K9 deacetylase activity, NAD-dependent	IBA
GO:0046969	Function	Histone H3K9 deacetylase activity, NAD-dependent	IDA	15469825
GO:0046969	Function	Histone H3K9 deacetylase activity, NAD-dependent	IEA
GO:0046969	Function	Histone H3K9 deacetylase activity, NAD-dependent	ISS
GO:0046970	Function	Histone H4K16 deacetylase activity, NAD-dependent	IBA
GO:0046970	Function	Histone H4K16 deacetylase activity, NAD-dependent	IDA	15469825
GO:0046970	Function	Histone H4K16 deacetylase activity, NAD-dependent	IEA
GO:0048511	Process	Rhythmic process	IEA
GO:0050793	Process	Regulation of developmental process	IEA
GO:0050872	Process	White fat cell differentiation	IEA
GO:0050872	Process	White fat cell differentiation	ISS
GO:0051019	Function	Mitogen-activated protein kinase binding	IPI	20027304
GO:0051152	Process	Positive regulation of smooth muscle cell differentiation	IEA
GO:0051239	Process	Regulation of multicellular organismal process	IEA
GO:0051315	Process	Attachment of mitotic spindle microtubules to kinetochore	IDA	30409912
GO:0051658	Process	Maintenance of nucleus location	IDA	15692560
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	ISS
GO:0051898	Process	Negative regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:0051898	Process	Negative regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IMP	21149730
GO:0055089	Process	Fatty acid homeostasis	IEA
GO:0055089	Process	Fatty acid homeostasis	ISS
GO:0060766	Process	Negative regulation of androgen receptor signaling pathway	IMP	17505061
GO:0060907	Process	Positive regulation of macrophage cytokine production	IEA
GO:0060907	Process	Positive regulation of macrophage cytokine production	ISS
GO:0061773	Component	ENoSc complex	IPI	18485871
GO:0062013	Process	Positive regulation of small molecule metabolic process	IEA
GO:0070301	Process	Cellular response to hydrogen peroxide	IDA	20027304
GO:0070403	Function	NAD+ binding	IEA
GO:0070857	Process	Regulation of bile acid biosynthetic process	IEA
GO:0070857	Process	Regulation of bile acid biosynthetic process	ISS
GO:0070914	Process	UV-damage excision repair	IMP	20670893
GO:0071356	Process	Cellular response to tumor necrosis factor	IDA	15152190
GO:0071456	Process	Cellular response to hypoxia	IEA
GO:0071456	Process	Cellular response to hypoxia	IMP	20620956
GO:0071479	Process	Cellular response to ionizing radiation	IEA
GO:0071479	Process	Cellular response to ionizing radiation	ISS
GO:0072331	Process	Signal transduction by p53 class mediator	IDA	29681526
GO:0072350	Process	Tricarboxylic acid metabolic process	IDA	30193097
GO:0090335	Process	Regulation of brown fat cell differentiation	IEA
GO:0090335	Process	Regulation of brown fat cell differentiation	ISS
GO:0090400	Process	Stress-induced premature senescence	IMP	17916362
GO:0097009	Process	Energy homeostasis	IMP	18485871
GO:0106230	Process	Protein depropionylation	ISS
GO:0106231	Function	NAD-dependent protein-lysine depropionylase activity	IEA
GO:0106231	Function	NAD-dependent protein-lysine depropionylase activity	ISS
GO:0140297	Function	DNA-binding transcription factor binding	IPI	20955178, 23382074
GO:0140416	Function	Transcription regulator inhibitor activity	IDA	11672523
GO:0140861	Process	DNA repair-dependent chromatin remodeling	IDA	25301942
GO:0140861	Process	DNA repair-dependent chromatin remodeling	IDA	20100829
GO:0140937	Function	Histone H4K12 deacetylase activity, hydrolytic mechanism	IDA	15469825
GO:0141050	Function	Histone H3K deacetylase activity	IDA	20027304
GO:0141208	Function	NAD-dependent protein lysine delactylase activity	IDA	38512451
GO:0141208	Function	NAD-dependent protein lysine delactylase activity	IEA
GO:0160011	Function	NAD-dependent protein decrotonylase activity	IEA
GO:0160012	Function	Histone decrotonylase activity, NAD-dependent	IDA	28497810
GO:1900034	Process	Regulation of cellular response to heat	TAS
GO:1901797	Process	Negative regulation of signal transduction by p53 class mediator	IDA	29681526
GO:1901984	Process	Negative regulation of protein acetylation	IMP	17916362
GO:1902166	Process	Negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator	IEA
GO:1902166	Process	Negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator	ISS	11672522
GO:1902176	Process	Negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway	IMP	17317627
GO:1902237	Process	Positive regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway	IEA
GO:1902424	Process	Negative regulation of attachment of mitotic spindle microtubules to kinetochore	IDA	30409912
GO:1904179	Process	Positive regulation of adipose tissue development	IEA
GO:1904179	Process	Positive regulation of adipose tissue development	ISS
GO:1990254	Function	Keratin filament binding	IPI	23382074
GO:1990404	Function	NAD+-protein mono-ADP-ribosyltransferase activity	TAS	17456799
GO:1990830	Process	Cellular response to leukemia inhibitory factor	IEA
GO:1990841	Function	Promoter-specific chromatin binding	IEA
GO:2000111	Process	Positive regulation of macrophage apoptotic process	IEA
GO:2000111	Process	Positive regulation of macrophage apoptotic process	ISS
GO:2000481	Process	Positive regulation of cAMP-dependent protein kinase activity	IMP	18687677
GO:2000655	Process	Negative regulation of cellular response to testosterone stimulus	IMP	17505061
GO:2000757	Process	Negative regulation of peptidyl-lysine acetylation	IDA	20100829
GO:2000773	Process	Negative regulation of cellular senescence	IDA	20203304
GO:2000773	Process	Negative regulation of cellular senescence	IMP	20424141
GO:2000774	Process	Positive regulation of cellular senescence	IDA	18687677
GO:2000781	Process	Positive regulation of double-strand break repair	IDA	23911928, 31995034, 32538779
GO:2000781	Process	Positive regulation of double-strand break repair	IDA	32538779

Other IDs

• MIM: 604479
• HGNC: 14929
• e!Ensembl: ENSG00000096717

Protein

• UniProt ID: Q96EB6
• Protein name: NAD-dependent protein deacetylase sirtuin-1 (hSIRT1) (EC 2.3.1.286) (NAD-dependent protein deacylase sirtuin-1) (EC 2.3.1.-) (Regulatory protein SIR2 homolog 1) (SIR2-like protein 1) (hSIR2) [Cleaved into: SirtT1 75 kDa fragment (75SirT1)]
• Protein function: NAD-dependent protein deacetylase that links transcriptional regulation directly to intracellular energetics and participates in the coordination of several separated cellular functions such as cell cycle, response to DNA damage, metabolism, apo
• PDB: 4I5I, 4IF6, 4IG9, 4KXQ, 4ZZH, 4ZZI, 4ZZJ, 5BTR, 8ANB
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02146	SIR2	261 → 447	Sir2 family	Family

• Tissue specificity: TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:10381378}.
• Sequence:

  MADEAALALQPGGSPSAAGADREAASSPAGEPLRKRPRRDGPGLERSPGEPGGAAPEREV
  PAAARGCPGAAAAALWREAEAEAAAAGGEQEAQATAAAGEGDNGPGLQGPSREPPLADNL
  YDEDDDDEGEEEEEAAAAAIGYRDNLLFGDEIITNGFHSCESDEEDRASHASSSDWTPRP
  RIGPYTFVQQHLMIGTDPRTILKDLLPETIPPPELDDMTLWQIVINILSEPPKRKKRKDI
  NTIEDAVKLLQECKKIIVLTGAGVSVSCGIPDFRSRDGIYARLAVDFPDLPDPQAMFDIE
  YFRKDPRPFFKFAKEIYPGQFQPSLCHKFIALSDKEGKLLRNYTQNIDTLEQVAGIQRII
  QCHGSFATASCLICKYKVDCEAVRGDIFNQVVPRCPRCPADEPLAIMKPEIVFFGENLPE
  QFHRAMKYDKDEVDLLIVIGSSLKVRPVALIPSSIPHEVPQILINREPLPHLHFDVELLG
  DCDVIINELCHRLGGEYAKLCCNPVKLSEITEKPPRTQKELAYLSELPPTPLHVSEDSSS
  PERTSPPDSSVIVTLLDQAAKSNDDLDVSESKGCMEEKPQEVQTSRNVESIAEQMENPDL
  KNVGSSTGEKNERTSVAGTVRKCWPNRVAKEQISRRLDGNQYLFLPPNRYIFHGAEVYSD
  SEDDVLSSSSCGSNSDSGTCQSPSLEEPMEDESEIEEFYNGLEDEPDVPERAGGAGFGTD
  GDDQEAINEAISVKQEVTDMNYPSNKS

• Sequence length: 747

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ANKYLOSING SPONDYLITIS AND OTHER INFLAMMATORY SPONDYLOPATHIES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATHEROSCLEROSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE DISEASES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN INFARCTION	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEROID LIPOFUSCINOSIS, NEURONAL 1, INFANTILE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CEROID LIPOFUSCINOSIS, NEURONAL, 1	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLITIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGESTIVE HEART FAILURE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEGENERATIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMYELINATING DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, TYPE 2	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC RETINOPATHY	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOCRINE SYSTEM DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FATTY LIVER	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FATTY LIVER, ALCOHOLIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HUNTINGTON DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTROPHY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSULIN RESISTANCE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
JUVENILE NEURONAL CEROID LIPOFUSCINOSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE, ACUTE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LATE-INFANTILE NEURONAL CEROID LIPOFUSCINOSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME X	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEGENERATIVE DISEASES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEGENERATIVE DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURONAL CEROID-LIPOFUSCINOSES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC FATTY LIVER DISEASE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NONALCOHOLIC STEATOHEPATITIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOSARCOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARALYSIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCLERODERMA, SYSTEMIC	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SIRT1-related disorder	Uncertain significance; Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC SCLERODERMA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THROMBOSIS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TOOTH DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Variant of unknown significance	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENTRICULAR DYSFUNCTION, LEFT	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
WALLERIAN DEGENERATION	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Actinic keratosis	Actinic keratosis	BEFREE	17180656		★☆☆☆☆ Found in Text Mining only
Acute Cerebrovascular Accidents	Stroke	BEFREE	30544370		★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	25342474		★☆☆☆☆ Found in Text Mining only
Acute Kidney Insufficiency	Acute Kidney Insufficiency	CTD_human_DG	21416250		★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	24504520		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	25884180, 26416354, 31809874		★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	28592850, 31055719		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	17638871, 19433578, 19649206, 24816737, 25915617, 27540973, 28390310, 29599352, 30252536, 31487876		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	31058315		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	BEFREE	22554968, 24816737		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	19649206, 30021836, 30841451, 31765940		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	19433578, 24816737, 27540973, 30460421		★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	30460421		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyps	Adenomatous Polyposis	BEFREE	22554968		★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	BEFREE	25822341, 27871879, 29457836		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	25884180		★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	30377410		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	19907922, 22537175, 25250818		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	22322739, 26398583		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	26656366, 30399423, 30717113, 31249522		★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	29701897		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	19558452, 26010513, 26827652, 27687218, 29855513, 31175839, 31370365, 32348224, 36035216	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	27522594, 28578695, 33834065	Inhibit	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	36073820	Stimulate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	26827652		★☆☆☆☆ Found in Text Mining only
Amnesia	Amnesia	BEFREE	30484407, 30794116		★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	19104446, 24254769, 24903973, 27600946, 27614878		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	17581637, 21896316, 22796962, 24252177, 25167838, 29571747, 30295421, 30479062, 31812544		★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	28108221		★☆☆☆☆ Found in Text Mining only
Androgen-Insensitivity Syndrome	Androgen-Insensitivity Syndrome	BEFREE	30361109, 30544370		★☆☆☆☆ Found in Text Mining only
Angina Unstable	Angina pectoris	Pubtator	25342474	Inhibit	★☆☆☆☆ Found in Text Mining only
Angina, Unstable	Intermediate coronary syndrome	BEFREE	25342474		★☆☆☆☆ Found in Text Mining only
Angioimmunoblastic Lymphadenopathy	Angioimmunoblastic T-cell lymphoma	BEFREE	27124741		★☆☆☆☆ Found in Text Mining only
Anhedonia	Anhedonia	BEFREE	30705425		★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	30558548		★☆☆☆☆ Found in Text Mining only
Anodontia	Anodontia	Pubtator	29363918, 33318474	Associate	★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	23370328, 24088390, 27170223, 27494892		★☆☆☆☆ Found in Text Mining only
Anorexia	Anorexia	BEFREE	22110092		★☆☆☆☆ Found in Text Mining only
Antisocial Personality Disorder	Antisocial Personality Disorder	BEFREE	28439078		★☆☆☆☆ Found in Text Mining only
Antisocial Personality Disorder	Antisocial personality disorder	Pubtator	28439078	Associate	★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	22169038, 27581932, 29680708, 30636176		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	22169038, 26509718, 27581932, 29680708, 30636176, 31421827		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety disorder	Pubtator	26509718	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	32138469	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	27650558, 29232676, 29396144, 29524861, 31710686		★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic Valve Sclerosis	BEFREE	22493735, 31677538		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	18689793, 19581416, 20068143, 20606253, 21293192, 21810449, 22753194, 23224247, 23382833, 23652462, 23754392, 24378473, 25706717, 27123454, 28029409, 28765952, 28881659, 28888894, 29115493, 29299128, 29787963, 30273616, 30637828, 30805760, 31023999, 31105126, 31432137, 31752013		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	23239110, 26298564, 26987484, 28329314, 28966618, 29355701		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	23257246, 28329314	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	21931678, 27496874	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	21742641, 32692720, 33215529, 38225924	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	25799392, 29784872	Inhibit	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	34431434	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis, Gouty	Gouty arthritis	BEFREE	31367941		★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	28899784, 30558548, 31737170		★☆☆☆☆ Found in Text Mining only
ARTHROGRYPOSIS, DISTAL, TYPE 2B	Sheldon-Hall syndrome	BEFREE	20033348		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	29055943, 30654657, 31210330, 31542484		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	30654657	Inhibit	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	37274900	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	28236278		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	18689793, 19581416, 20068143, 20606253, 21293192, 21810449, 22753194, 23224247, 23382833, 23652462, 23754392, 24378473, 25706717, 27123454, 28029409, 28765952, 28881659, 28888894, 29115493, 29299128, 29787963, 30273616, 30637828, 30805760, 31023999, 31105126, 31432137, 31752013		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	LHGDN	18689793		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	CTD_human_DG	20068143		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	Pubtator	20068143, 24378473, 24859347, 24973384, 25273948, 25706717, 27123454, 31023999, 31901246	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	Pubtator	23382833, 28765952	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial Fibrillation	Atrial Fibrillation	BEFREE	28043667, 31680473		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial Fibrillation	Atrial Fibrillation	CTD_human_DG	29892015		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial Fibrillation	Atrial Fibrillation	GWASCAT_DG	30061737		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	28694700		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	18687325, 19729833, 22105513, 23473037, 24386389, 24570024, 27245255, 28336124, 29306019, 31127867		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Diseases	Autoimmune disease	Pubtator	23473037, 27245255, 32485674	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Diseases	Autoimmune Diseases	CTD_human_DG	23993977		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
B-Cell Lymphomas	B-Cell Lymphoma	LHGDN	18724249		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	28324774, 29658582, 29805682, 29873178, 30029514, 30546451, 30655755, 30700637, 31258632		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	23395551		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	33142293	Inhibit	★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	BEFREE	30842143		★☆☆☆☆ Found in Text Mining only
Benign neoplasm of brain, unspecified	Brain Neoplasms	CTD_human_DG	22523472		★☆☆☆☆ Found in Text Mining only
Bicuspid aortic valve	Bicuspid aortic valve	BEFREE	22370592		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	20977650, 21349544, 27424200		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	20977650, 21349544		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar disorder	Pubtator	38012695	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bladder Neoplasm	Bladder Neoplasm	BEFREE	29147649, 30655755, 30868406		★☆☆☆☆ Found in Text Mining only
Bloch Sulzberger syndrome	Incontinentia pigmenti syndrome	BEFREE	28017962		★☆☆☆☆ Found in Text Mining only
Bloom Syndrome	Bloom Syndrome	BEFREE	28532580		★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone Disease	BEFREE	28677728, 30862606		★☆☆☆☆ Found in Text Mining only
Borderline Personality Disorder	Borderline personality disorder	BEFREE	21349544		★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	37098490	Associate	★☆☆☆☆ Found in Text Mining only
Brain Infarction	Brain Infarction	CTD_human_DG	22878646		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Injuries	Brain injuries	Pubtator	36506933	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	CTD_human_DG	22523472		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Neoplasms	Brain Neoplasms	BEFREE	29991742		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Tumor, Primary	Brain Neoplasms	CTD_human_DG	22523472		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	19839049		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	20412117, 21596753, 21920899, 22470132, 22623155, 23340254, 23352644, 23583181, 24183459, 24897117, 25411356, 25826085, 26004371, 26225773, 26416354, 26902145, 26999517, 27080717, 27358235, 28327197, 28781618, 28845527, 28882183, 29340027, 29695913, 29752439, 29752474, 29807012, 29896286, 30038266, 30093977, 30319540, 30319549, 30380732, 30520099, 30620711, 30697969, 30826489, 30982660, 31063745, 31101119, 31220581, 31261609, 31357743, 31746308, 31781916		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	19047049, 20412117, 23169992, 23340254, 24126058, 24897117, 25139823, 25420528, 26459286, 26999517, 28882183, 29752439, 30409902, 30697969, 30982660, 31101119, 32681437, 34663249, 35250881, 36322753, 37433152, 40604083	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	21596753, 26999517	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	22190494	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bronchitis Chronic	Bronchitis	Pubtator	39682757	Associate	★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	21349544, 29115559		★☆☆☆☆ Found in Text Mining only
Calcinosis	Calcinosis	Pubtator	32402066	Inhibit	★☆☆☆☆ Found in Text Mining only
Cap Myopathy	Cap myopathy	Pubtator	26988912	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	19649206, 20412117, 20670893, 21527554, 23255128, 23800187, 23805287, 24416313, 25420528, 25485577, 25791281, 26959057, 27708228, 27746184, 28061480, 28351313, 28882183, 30016782, 30410074, 30710424, 31931863, 32098999, 32714081, 34719479	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	12007281, 19433578, 24019980, 24088390, 26862948, 29029516, 29194618, 30021836, 31261609, 31442917		★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	23340254	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	21527554	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	22302044, 22448750, 22728651, 23814050, 24416313, 28242208, 28720061, 28983625, 29630527, 30841449, 31056532, 32714081, 33955831, 34348664, 34981667, 35961004, 36308411, 37715252, 39617695	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	29147649, 30655755, 30868406		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	17624472, 19649206, 22986747, 23028940, 23704280, 25143434, 25738249, 25915617, 28498463, 28869605, 29029516, 29435152, 30016782, 30058691, 31043584		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	29050034, 34590923	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	24088390, 26121130, 27170223	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	30518708, 33907836, 38427808	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	37096064	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	19649206, 23354305, 25794641, 35212616	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	17180656, 30182136		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	26520143, 26862948, 28214851, 28365935, 28667895, 28878214, 28927063, 29050034, 29422491, 30058682, 31317367, 31572453		★☆☆☆☆ Found in Text Mining only
Cardiac defects	Cardiac Defects	BEFREE	30786847		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	25239805, 31393272		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	32460327, 35387565	Inhibit	★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	38012584	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	33303703	Inhibit	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Restrictive	Restrictive cardiomyopathy	Pubtator	18791640	Stimulate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Restrictive	Restrictive cardiomyopathy	Pubtator	19806227	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	28883902, 30216438, 30857947		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	21719763, 22939883, 24587358, 25233986, 25252293, 25582759, 25766107, 26122034, 26232232, 26477463, 27841908, 28419207, 28579512, 28661724, 28811647, 29115394, 29446717, 29952352, 30030618, 30165439, 30574122, 30805760, 30864731, 31106631, 31752013		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	24587358, 27841908, 32733639, 33249778, 35092334	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	Pubtator	25273948	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Artery Thrombosis	Carotid artery thrombosis	Pubtator	31450612	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Atherosclerosis	Carotid Atherosclerosis	BEFREE	25273948		★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	BEFREE	21700104, 23892278, 26716364, 30259675, 31338869, 31582653		★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	Pubtator	31287252, 31582653, 35184653	Associate	★☆☆☆☆ Found in Text Mining only
Central Core Myopathy (disorder)	Myopathy	BEFREE	29463997		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	23855981, 28527875, 28888980, 28937253, 29018134, 29039533, 29434685, 29614311, 30067864, 30532738, 30639123		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	28965081, 38245621	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	25186738, 29302794, 30145851, 30422362, 30519156, 31038184, 31298398, 31535381		★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular Disorders	BEFREE	26477463		★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular disorder	Pubtator	31257461, 35968712	Associate	★☆☆☆☆ Found in Text Mining only
Ceroid lipofuscinosis, neuronal 1, infantile	Neuronal ceroid lipofuscinosis	CTD_human_DG	21224254		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
cervical cancer	Cervical Cancer	BEFREE	28797320, 29029428, 29808798, 29844574, 31692593		★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	27720890, 29035878		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	28797320, 29029428, 29808798, 29844574, 31692593		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	25884180		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	19907922, 22537175, 25250818		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	39940750	Associate	★☆☆☆☆ Found in Text Mining only
Cholangitis Sclerosing	Sclerosing cholangitis	Pubtator	38302916	Associate	★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholestasis	BEFREE	27816442, 28553227, 29328070, 29360226, 30061734, 30229970, 30928103		★☆☆☆☆ Found in Text Mining only
Cholestasis of pregnancy	Cholestasis of pregnancy	BEFREE	29855113		★☆☆☆☆ Found in Text Mining only
Cholestatic liver disease	Cholestatic liver disease	BEFREE	30229970		★☆☆☆☆ Found in Text Mining only
Cholesterol gallstones	Cholesterol gallstones	BEFREE	22290433		★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	27484919, 28112277, 28600541		★☆☆☆☆ Found in Text Mining only
Chronic colitis	Colitis	BEFREE	27085036		★☆☆☆☆ Found in Text Mining only
Chronic heart failure	Heart Failure	BEFREE	20089851		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	23374890, 24356887, 28100503, 29702498, 30447351, 31688999		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	26794150, 28260932		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	LHGDN	18174544		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	22178470, 22546858, 22705731, 24039251, 24633890, 27559927, 27767101, 27784320, 28339038, 28588027, 29138552, 29411515, 29861836, 29976774, 29990691, 30156909, 30237706, 30673309, 30860857, 31242482, 31762195		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	BEFREE	31016751		★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	CTD_human_DG	20651248		★☆☆☆☆ Found in Text Mining only
Cleidocranial Dysplasia	Cleidocranial Dysplasia	BEFREE	29463997		★☆☆☆☆ Found in Text Mining only
Clinically Isolated Syndrome, CNS Demyelinating	Demyelinating Diseases	CTD_human_DG	23547115		★☆☆☆☆ Found in Text Mining only
Cockayne Syndrome	Cockayne Syndrome	BEFREE	23267107		★☆☆☆☆ Found in Text Mining only
Cockayne Syndrome	Cockayne syndrome	Pubtator	23267107	Associate	★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	28329314, 31305452	Associate	★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	28937253, 28979702, 30033800, 30196826, 30414004, 30716615, 30848530, 30972182		★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	31305452, 33447019	Associate	★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	CTD_human_DG	19940103, 24548422, 24782617		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colitis	Colitis	BEFREE	24850427, 28552621, 28655643, 31401159		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colitis Ulcerative	Ulcerative colitis	Pubtator	23473037, 38302916	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	18326939, 19430421, 19433578, 22640743, 24816737, 25779952, 28162896, 28526414, 28943452, 29203587, 29427626, 29706374, 30410074		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	27085036		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	27540973, 39494323	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	19430421, 22149272, 23045412, 23136189, 24816737, 25013930, 25307864, 25500546, 26959057, 26975631, 27085036, 27145368, 28182012, 28390310, 28923398, 28977971, 29807115, 29944017, 30016968, 30082156, 30191976, 30257253, 30410074, 30451820, 30460421, 30789361, 30864709, 31058315, 31068761, 31201065, 31213086, 31258845		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	16596166, 18755897, 19430421, 22190494, 23045412, 26959057, 28708932, 29363918, 30257253, 30410074, 30451820, 31213086, 32098999, 32393998, 32605336, 33455111, 34660182, 37575080, 38214831, 39494323	Associate	★☆☆☆☆ Found in Text Mining only
Complete atrioventricular block	Complete Atrioventricular Block	BEFREE	30501014		★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	24936455, 26455407		★☆☆☆☆ Found in Text Mining only
Congenital Heart Defects	Congenital heart defects	BEFREE	29535452		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	20089851, 22333581, 25766524, 26233702, 29593530, 29800064, 30786847, 31680473		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congestive heart failure	Congestive Heart Failure	CTD_human_DG	24535859		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	26499759, 28717923, 31201813		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	22364258, 23382833, 27033026, 27123454, 27841908, 28043667, 28601780, 29885463		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	22364258, 23382833, 25582759, 27033026, 27123454, 27841908, 28043667, 28601780, 29885463, 30192743, 30935928		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	23382833	Inhibit	★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	25342474, 27123454, 27841908, 28601780, 33249778, 35224092, 39680523	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	30192743, 35224092	Stimulate	★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	35038972	Inhibit	★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	35092334, 35469171, 36145164, 37730614, 39680523	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	22364258, 23382833, 27033026, 27123454, 27841908, 28043667, 28436940, 28601780, 29845299, 29885463, 30581189, 31486447, 31805818		★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	26342525, 29566363, 29767533		★☆☆☆☆ Found in Text Mining only
Craniosynostosis, Type 1	Craniosynostosis	BEFREE	31355422		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	29706374, 30050588		★☆☆☆☆ Found in Text Mining only
Cytochrome-c Oxidase Deficiency	Cytochrome-C Oxidase Deficiency	BEFREE	29059204		★☆☆☆☆ Found in Text Mining only
Deafness	Deafness	Pubtator	28329314	Associate	★☆☆☆☆ Found in Text Mining only
Deep Vein Thrombosis	Thrombosis	BEFREE	30616245		★☆☆☆☆ Found in Text Mining only
Degenerative Diseases, Central Nervous System	Degenerative Diseases, Central Nervous System	CTD_human_DG	17581637, 17652729		★☆☆☆☆ Found in Text Mining only
Degenerative Diseases, Spinal Cord	Degenerative Diseases, Central Nervous System	CTD_human_DG	17581637, 17652729		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	20131294, 21337390, 21742641, 22738809, 23276927, 24184155, 27077804, 27247228, 28213268, 28389425, 28586000, 28627522, 28666466, 28915567, 29138829, 29201214, 29413962, 29653943, 29922443, 30600470, 30854676, 30996115, 31072129, 31223428, 31366866		★☆☆☆☆ Found in Text Mining only
Dejerine-Sottas Disease (disorder)	Charcot-Marie-Tooth disease	BEFREE	30816479		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	28521305, 29523769, 30071285, 30361109, 30484407		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	28578695	Inhibit	★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	29855513	Associate	★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating Diseases	CTD_human_DG	23547115		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder	Major depressive disorder	Pubtator	26176920, 26509718	Associate	★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	26509718, 29643977, 30017261, 30361109, 30737982, 31096213, 31247244, 31431514, 31618623, 31819045		★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	33834065	Inhibit	★☆☆☆☆ Found in Text Mining only
Depressive Disorder Major	Major depressive disorder	Pubtator	26176920, 30482883	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	25445829		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	17901049, 19167483, 19286634, 20061622, 20375183, 21813271, 21858169, 22228742, 22470132, 22908267, 23070058, 23361587, 24141423, 24567379, 24740756, 26599598, 27009398, 27841908, 27852610, 28128062, 28263817, 28395272, 28409883, 28436095, 28533219, 28593583, 28810642, 29477240, 29524414, 29892266, 30030567, 30228292, 30333091, 30503839, 30513672, 30559718, 30578379, 30641085, 30675190, 30696833, 30707256, 30877853, 31032918, 31153040, 31557786		★☆☆☆☆ Found in Text Mining only
Diabetes Complications	Diabetes complications	Pubtator	27123454, 30901315	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	24549598, 30513672, 40243583	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	30125412, 32365792, 34149611, 38326276	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Insipidus	Diabetes Insipidus	BEFREE	18687325		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	17901049, 19167483, 19286634, 19455179, 20061622, 20375183, 21813271, 21858169, 22228742, 22470132, 22908267, 23070058, 23361587, 24141423, 24567379, 24740756, 26599598, 27009398, 27789474, 27841908, 27852610, 28043667, 28128062, 28263817, 28395272, 28409883, 28436095, 28533219, 28593583, 28810642, 29189984, 29199862, 29477240, 29524414, 29892266, 30030567, 30228292, 30333091, 30381241, 30503839, 30513672, 30559718, 30578379, 30599900, 30641085, 30675190, 30696833, 30707256, 30877853, 31032918, 31125554, 31153040, 31557786, 31715188		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus	Diabetes mellitus	Pubtator	19806227, 21813271, 21871827, 22228742, 26010513, 27841908, 29302057, 30513672, 32402066, 33249778, 38283900	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus	Diabetes Mellitus	CTD_human_DG	24894401		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus	Diabetes mellitus	Pubtator	25815791, 32627000	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus	Diabetes mellitus	Pubtator	30184318, 32887498, 34149611	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	21813271, 30736780	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	23473037, 29027826, 33249778, 34439776	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	19014491, 21331741, 21556116, 21871827, 22228742, 23133645, 25342474, 26637398, 27123454, 28860538, 29995800, 30139387, 30367115, 30504713, 30513672, 33577446, 35092334, 35365152, 35469171, 35778952	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	27904654, 29330620, 30736780	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	36915137	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	21813271, 23473037, 27207584, 27561793, 29027826, 29675132, 30228292, 30353656, 30487517, 30736780, 31583043		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	19014491, 19167483, 19581416, 19876588, 20503258, 20978007, 21321189, 21331741, 21871827, 22228742, 22476949, 22613205, 22885181, 23276927, 25342474, 25766107, 27101740, 27123454, 27749604, 27904654, 27909015, 28338182, 28444663, 28609708, 28721137, 28751004, 28810642, 28860538, 29164153, 29175667, 29330620, 29387206, 29402742, 29577959, 29957104, 29995800, 30072892, 30139387, 30196291, 30257324, 30367115, 30442237, 30448921, 30474134, 30483738, 30513672, 30649099, 30736780, 30935928, 30988688, 31256424, 31333735, 31377446, 31442509, 31486447, 31557786, 31759989, 31781938, 31799723		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	CTD_human_DG	23834033		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Cardiomyopathies	Diabetic cardiomyopathy	BEFREE	27561793, 28380414, 28714516, 28883902, 29288528, 30071860, 30119667, 30216438, 30857947, 31210844		★☆☆☆☆ Found in Text Mining only
Diabetic Foot	Diabetic Foot	BEFREE	29995800		★☆☆☆☆ Found in Text Mining only
Diabetic Foot	Diabetic foot	Pubtator	29995800, 33096729, 37985432	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	21331741, 28860538, 29848325, 33279869, 33577446, 38270305	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	32705273	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	21331741, 23361587, 23793837, 24608443, 28444663, 28860538, 28986066, 29104634, 29434819, 29477240, 29700282, 29848325, 30125566, 30187480, 30254426, 30386303, 30668374, 30707256, 30778838, 30798323, 30859351, 30959066, 30988688, 31402864, 31442509, 31647955		★☆☆☆☆ Found in Text Mining only
Diabetic Neuropathies	Diabetic Nephropathy	BEFREE	28528294, 31639451		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	24570140, 26238659, 26599598, 29091865, 29311218, 30333091, 31136205, 31646597, 31702814		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Retinopathy	Diabetic Retinopathy	CTD_human_DG	24894401		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	32572899, 32698791, 33022863, 33974755, 34937832, 36238483	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	28118604, 28324774, 30377410		★☆☆☆☆ Found in Text Mining only
Disorder of eye	Disorder Of Eye	BEFREE	29693113, 31105084		★☆☆☆☆ Found in Text Mining only
Dowling Degos Disease	Dowling degos disease	Pubtator	25503852	Associate	★☆☆☆☆ Found in Text Mining only
dowling-degos disease	Dowling-Degos Disease	BEFREE	22990594		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	23291000	Associate	★☆☆☆☆ Found in Text Mining only
Duane Retraction Syndrome	Duane retraction syndrome	Pubtator	33974755	Associate	★☆☆☆☆ Found in Text Mining only
Ductal Breast Carcinoma	Breast Carcinoma	BEFREE	27494892		★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	BEFREE	30304969		★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	29274033, 30355082		★☆☆☆☆ Found in Text Mining only
EAR, PATELLA, SHORT STATURE SYNDROME	Ear Diseases	BEFREE	29251317		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	25445829		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	25270091, 26701732, 30206735		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial Neoplasms	BEFREE	25270091		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	26701732, 31131636, 32388637	Associate	★☆☆☆☆ Found in Text Mining only
Endometrioma	Endometrioma	BEFREE	24320086		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	24320086, 26862948, 28754906		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	31906251	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	34698105	Stimulate	★☆☆☆☆ Found in Text Mining only
Enterocolitis Necrotizing	Enterocolitis	Pubtator	29276042	Associate	★☆☆☆☆ Found in Text Mining only
Enterocolitis Necrotizing	Enterocolitis	Pubtator	32657204	Inhibit	★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	30009381, 30548678, 31173166		★☆☆☆☆ Found in Text Mining only
Epiphyseal dysplasia multiple 1	Epiphyseal dysplasia	Pubtator	21337390	Inhibit	★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	26520143, 28927063		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	26662958, 29656187, 31684999		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	26662958, 29656187		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	30945643	Stimulate	★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	31684999	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	26662958, 29636061, 31170665, 32846774, 36510377	Associate	★☆☆☆☆ Found in Text Mining only
Fatigue Syndrome Chronic	Fatigue syndrome	Pubtator	34011981	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	20033348, 20071779, 21321189, 21540183, 22363635, 26323321, 26525891, 28439947, 28449683, 28467182, 28533219, 28533555, 28667519, 28808418, 28898508, 29402742, 29595075, 29681936, 29845302, 30154382, 30214535, 30232347, 30263038, 31105592, 31183612, 31256424, 31390551, 31842467		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fatty Liver	Fatty Liver	CTD_human_DG	21321189, 23834033, 24184811, 24210820, 24442997		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fatty Liver	Fatty liver	Pubtator	30154382, 31183612	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fatty Liver Disease	Fatty Liver	BEFREE	23703665, 27285989, 31256424, 31500354		★☆☆☆☆ Found in Text Mining only
Fatty Liver, Alcoholic	Alcoholic Fatty Liver	BEFREE	22308024, 24262277, 26278388, 28213273, 29189974, 31076642		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fibrosis, Liver	Liver Fibrosis	BEFREE	26435214, 27871879, 27888541, 28025657, 28919365, 28964808, 28970250, 29106960, 29162670, 29253500, 30455644, 30632134, 30928408, 30930169, 31533364, 31677501		★☆☆☆☆ Found in Text Mining only
Focal glomerulosclerosis	Glomerulosclerosis	BEFREE	27993241		★☆☆☆☆ Found in Text Mining only
Fragile X Syndrome	Fragile X Syndrome	BEFREE	18369442		★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	30945643		★☆☆☆☆ Found in Text Mining only
Gaucher Disease	Gaucher disease	Pubtator	32485674	Inhibit	★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	29249955, 29693113		★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	29384425		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	22318540, 26345416, 31319814, 32186433, 37100462	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	25250818, 26662303, 28440504, 28475330, 29207098, 29286123, 29991742, 31319814		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	26662303	Stimulate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	25250818, 26662303, 28440504, 28475330, 29207098, 29286123, 29991742, 31142741, 31207928, 31319814		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	21655185, 22318540, 22867969, 24488909, 25216517, 26898440, 27166997, 28554130, 29057547, 29308302, 29756546, 30506951, 30930981, 31186751, 31319814, 31490284		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	21655185, 22318540, 24488909, 25791281, 27166997, 31319814, 31957839, 37277492	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	32791747	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis (disorder)	Glomerulosclerosis	BEFREE	28615249		★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease IB	Glycogen storage disease	Pubtator	35961004	Associate	★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease Type I	Glycogen Storage Disease	BEFREE	29740774		★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease Type II	Glycogen storage disease	Pubtator	32051464, 35961004	Associate	★☆☆☆☆ Found in Text Mining only
Gout	Gout	BEFREE	30600470		★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	30514750		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	27245255, 30391932		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	27245255	Associate	★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	32485674	Inhibit	★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	27245255, 29336238		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	33916948, 34439776	Associate	★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	22370592, 22498017, 31118974		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Diseases	Heart Diseases	CTD_human_DG	23217256		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Diseases	Heart disease	Pubtator	32460327	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Diseases	Heart disease	Pubtator	34439776	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart failure	Heart Failure	BEFREE	20089851, 22333581, 25766524, 26233702, 29593530, 29800064, 30786847, 31680473		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart failure	Heart Failure	CTD_human_DG	24535859		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Failure	Heart failure	Pubtator	26233702	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Failure	Heart failure	Pubtator	32460327, 33576462, 35092334	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Failure, Right-Sided	Heart Failure	CTD_human_DG	24535859		★☆☆☆☆ Found in Text Mining only
Hemangioma	Hemangioma	BEFREE	30842143		★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Hemangiosarcoma	BEFREE	30842143		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	18774777, 24855208, 27725192, 31090265		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	27725192	Associate	★☆☆☆☆ Found in Text Mining only
Hematopoietic Neoplasms	Hematopoietic Neoplasms	BEFREE	28118604		★☆☆☆☆ Found in Text Mining only
Hemolytic Uremic Syndrome	Hemolytic uremic syndrome	Pubtator	39510246	Inhibit	★☆☆☆☆ Found in Text Mining only
Hepatic Encephalopathy	Hepatic encephalopathy	Pubtator	38062807	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis Alcoholic	Alcoholic hepatitis	Pubtator	27669435	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	32089410	Associate	★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	31646606		★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	Pubtator	31646606	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	16596166, 20160719	Associate	★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung disease	Pubtator	39494277	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	22200427		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	26722524	Associate	★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	18762557, 21513696, 22179316, 22179319, 22200427, 23417962, 23549885, 24252177, 24436303, 27590140, 29289683, 29742127, 30019499		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypercholesterolemia	Hypercholesterolemia	BEFREE	29516009, 30825513		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	19286634, 21778425, 21965330, 23070058, 24549598, 24702436, 27101740, 28380414, 28528294, 28765962, 30072892, 30144531, 30228292, 30458128, 30506571, 30696833, 30908696, 31068817, 31210844, 31583043, 31639451		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	27542238, 34509564, 34639171, 36073820	Associate	★☆☆☆☆ Found in Text Mining only
Hyperhomocysteinemia	Hyperhomocysteinemia	BEFREE	25982096, 29413962, 30394648, 31678650		★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	28950020, 29417372, 29634925, 30506571		★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	31295384		★☆☆☆☆ Found in Text Mining only
Hyperoxia	Hyperoxia	Pubtator	26465873	Associate	★☆☆☆☆ Found in Text Mining only
Hyperphosphatemia (disorder)	Hyperphosphatemia	BEFREE	21719763		★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	29784872	Inhibit	★☆☆☆☆ Found in Text Mining only
Hypersensitivity Immediate	Hypersensitivity	Pubtator	32840960	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	25273948, 32887498	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	25273948, 26284905, 26562529, 27259994, 27620389, 28043667, 28825991, 29593530, 29659128, 30677512, 30717220		★☆☆☆☆ Found in Text Mining only
Hypertrophy	Hypertrophy	Pubtator	21337390, 35703318	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperuricemia	Hyperuricemia	BEFREE	27022940, 30557833, 31252266		★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	BEFREE	30736780		★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	Pubtator	30736780	Inhibit	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	22302044, 22448750, 30843674, 33318474, 35042949, 36725745	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxic-Ischemic Encephalopathy	Hypoxic-Ischemic Encephalopathy	BEFREE	31362164		★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	28494457, 29369849, 31749139		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	30390331		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	32851507	Associate	★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	22249256		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	24567379, 25589773, 28521305, 28706491, 28937253, 28979702, 29104731, 29164153, 29245987, 29307666, 29325995, 29658582, 29892266, 29943083, 30186119, 30196826, 30414004, 30483738, 30716615, 30848530, 30972182, 31430865, 31672445		★☆☆☆☆ Found in Text Mining only
Infantile neuronal ceroid lipofuscinosis	Neuronal Ceroid Lipofuscinosis	BEFREE	21224254		★☆☆☆☆ Found in Text Mining only
Infertility Male	Male infertility	Pubtator	29359516	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	24850427, 25013930, 28552621, 28655643, 30147698		★☆☆☆☆ Found in Text Mining only
Inguinal Hernia, Indirect	Inguinal Hernia	BEFREE	24875419		★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	17908551, 26637398, 27955950, 29417372, 30385096, 34034759, 37862340	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	20068143	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	22152608, 27792110, 31582722		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	22152608, 22990594, 25503852, 26505388, 26940203, 32572902, 34222486, 35762319	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	26752489	Inhibit	★☆☆☆☆ Found in Text Mining only
Intervertebral disc disease	Intervertebral disc disease	Pubtator	22152608	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral disc disorder	Intervertebral Disc Disorder	BEFREE	27207584, 30353656, 30487517, 31583043		★☆☆☆☆ Found in Text Mining only
Intracranial Arteriovenous Malformations	Intracranial arteriovenous malformation	Pubtator	36292575	Associate	★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron Overload	BEFREE	29135935		★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	30147698		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	28527875, 28888980, 28965081, 29316653, 30196826, 30519156		★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	27708228		★☆☆☆☆ Found in Text Mining only
Kidney Calculi	Kidney stone	BEFREE	30714469		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	23361587, 23793837, 25587857, 27993241, 28339034, 28424160, 28425936, 28615249, 29393366, 29477240, 29723660, 30298020, 30641085, 30641941, 31378931, 31396333		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	30980521, 31719572, 32887498	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	35092334	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	CTD_human_DG	21416250		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure, Acute	Kidney Failure	BEFREE	27837177, 28852469, 29368247, 30447351, 30456546, 30980521, 31383361, 31400413, 31431003		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Neoplasms	Kidney neoplasm	Pubtator	37047552	Associate	★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	31781300		★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	22333581, 30230925		★☆☆☆☆ Found in Text Mining only
Left-Sided Heart Failure	Heart Failure	CTD_human_DG	24535859		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	21807113, 22322739, 24855208, 26049753		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	21818379, 32037392, 36322781	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	27725192	Stimulate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	28272704, 30134922, 32037392	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	16121216, 24855208, 25280219, 26049753, 27725192, 28213966, 28272704, 29501566, 29574276, 30134922, 31090265, 31261609		★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	22322739		★☆☆☆☆ Found in Text Mining only
Leukocyte adhesion deficiency type 1	Leukocyte adhesion deficiency	BEFREE	31765940		★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy body disease	Pubtator	28578695	Inhibit	★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	23800187, 25424420, 30655824		★☆☆☆☆ Found in Text Mining only
Lipid Metabolism Disorders	Lipid Metabolism Disorders	BEFREE	28732575, 28817690, 29379801		★☆☆☆☆ Found in Text Mining only
Liposarcoma	Liposarcoma	Pubtator	32493092	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	21527554, 21567102, 22146883, 22448750, 22479397, 22552445, 22562294, 23024800, 23137540, 23224434, 23339189, 23728341, 24416313, 25119660, 25131770, 25522783, 25926383, 26324025, 27090017, 27312708, 27748572, 28166203, 28417539, 28676953, 28677784, 28881735, 28964787, 28977971, 28983625, 29121714, 29344126, 29545174, 29630527, 30009356, 30237545, 30517713, 30546461, 30901096, 30909652, 31040695, 31394122, 31430957, 31587155, 31807195		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	31368578		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	32089410	Associate	★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	23510538, 24446069, 40268458	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure, Acute	Liver failure	BEFREE	28248534		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	22448750, 23024800, 25119660, 28334808		★☆☆☆☆ Found in Text Mining only
Liver Neoplasms	Liver neoplasm	Pubtator	28288414	Associate	★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	26212199, 28365154, 31299012		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	35042949	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	17624472		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	19649206, 24728004, 25915617, 26317794, 27528025, 28498463, 30016782, 30058691, 30988280, 33709560, 34947995, 39313797	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	22986747, 23028940		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	25184156	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	18398941, 28336124		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	31914379, 33584646	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	18398941, 28336124		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	18398941, 24570024, 28336124, 28346398, 29440621		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	29440621		★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	18398941, 28336124		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	23768087, 23805287, 26515337, 32846774	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	27170223	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	30930849		★☆☆☆☆ Found in Text Mining only
Lymphoid leukemia	Lymphoid leukemia	BEFREE	26416354, 31809874		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	23681230	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	27124741, 28324774, 29512706, 30059665		★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	28324774	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	28324774		★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	24343700		★☆☆☆☆ Found in Text Mining only
Lymphopenia	Lymphopenia	BEFREE	29411515		★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	24036938, 26656366, 27998274, 34982643	Associate	★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	20451257, 21349544, 26176920, 29158185, 30017261, 30482883, 30567608, 30705425, 31176830, 31819045		★☆☆☆☆ Found in Text Mining only
Malignant Bone Neoplasm	Malignant Bone Neoplasm	BEFREE	30579931, 30592048, 31270711		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	29756546		★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	25738249		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of brain	Brain Neoplasms	CTD_human_DG	22523472		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of brain	Brain Neoplasms	BEFREE	29991742		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	18851829, 20412117, 21596753, 21920899, 22470132, 22623155, 23340254, 23352644, 23583181, 24183459, 24897117, 25411356, 25826085, 26004371, 26225773, 26416354, 26902145, 26999517, 27080717, 27358235, 28327197, 28781618, 28845527, 28882183, 29340027, 29695913, 29752439, 29752474, 29807012, 29896286, 30038266, 30093977, 30319540, 30319549, 30380732, 30520099, 30620711, 30697969, 30826489, 30982660, 31063745, 31101119, 31220581, 31261609, 31357743, 31746308, 31781916		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	19839049		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	25270091, 26701732, 30206735		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	26662958, 29656187		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	28977971, 29706374		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	23024800, 25736100, 27312708, 28583374, 29029516, 30008835, 30569158, 30901096		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	17624472, 19649206, 22986747, 23028940, 23704280, 24240701, 25143434, 25738249, 25915617, 28498463, 28869605, 29029516, 29435152, 30016782, 30058691, 30319549, 31043584		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	23800187, 25424420, 30655824		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	26862948, 28214851, 28365935, 28667895, 28878214, 29050034, 29422491, 30058682, 31317367, 31572453		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	21677689, 22552606, 23370328, 24088390, 24484175, 25798752, 25843411, 26282546, 27170223, 27494892, 27993677, 28351313, 29706374		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	16923962, 17638871, 18573234, 18637271, 19377286, 22050448, 22249256, 23658738, 24127549, 24892674, 25557355, 26847404, 26988912, 26996298, 27686228, 29416748, 29574020, 29805651, 31092575		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	21062352		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	24441046		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	23768087, 24107295, 24278101, 25761483, 26612257, 28061480, 28383763, 29088792, 29581731, 29693338, 30250020, 30537988, 30710340, 30945643, 31352788, 31423013		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	22986535, 25109285		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	29147649, 30655755, 30868406		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12494881, 16269335, 16288004, 16596166, 17180656, 17638871, 17806102, 18723829, 18774777, 19017485, 19132007, 19166820, 19244112, 19364925, 19430421, 19433578, 19928762, 20097625, 20370686, 21471201, 21567102, 21947960, 22124156, 22159506, 22410779, 22552445, 22613205, 22885181, 22986535, 23045412, 23255128, 23354305, 23370328, 23370395, 23561972, 23583181, 23604120, 23681230, 23762270, 23800187, 23843607, 24019980, 24088390, 24107295, 24258275, 24386389, 24423936, 24441046, 24970682, 25189993, 25411356, 25483038, 25503141, 25516717, 25522783, 25798752, 25946975, 26055805, 26523671, 26862948, 27124741, 27345396, 27748572, 27793057, 27990725, 28025857, 28153032, 28162896, 28182012, 28273169, 28334808, 28351313, 28393212, 28465145, 28667895, 28721811, 28878214, 28904318, 28919418, 28923398, 28943955, 29029516, 29150734, 29194618, 29203587, 29250169, 29340027, 29476819, 29494161, 29581731, 29597027, 29632297, 29694959, 29991742, 30016782, 30058691, 30059665, 30237545, 30304565, 30319549, 30448921, 30451820, 30655824, 30710340, 30756332, 30842143, 30868406, 30881341, 30930849, 30945643, 31020545, 31056963, 31068761, 31092575, 31102152, 31209362, 31261609, 31321634, 31636473		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	28797320, 29029428, 29808798, 29844574, 31692593		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	18326939, 19430421, 19433578, 22640743, 24816737, 25779952, 28162896, 28526414, 28943452, 29203587, 29427626, 29706374, 30410074		★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	22228742, 30184230, 30887279		★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	Pubtator	22228742	Associate	★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	19839049		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	18235502		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	18850005, 29340027, 31077613		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	19839049		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	19839049		★☆☆☆☆ Found in Text Mining only
Mandibuloacral dysostosis	Mandibuloacral Dysostosis	BEFREE	25324471		★☆☆☆☆ Found in Text Mining only
Mandibuloacral dysplasia with type A lipodystrophy	Mandibuloacral dysplasia	Pubtator	25324471	Associate	★☆☆☆☆ Found in Text Mining only
Manic	Manic Disorder	BEFREE	28093238		★☆☆☆☆ Found in Text Mining only
Marfan Syndrome	Marfan Syndrome	BEFREE	27283746		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	19907922, 22537175, 25250818, 25348795		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	28440450	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	15821341, 24742694, 24743044, 24751483, 28882678, 28919418, 29374154, 29383100, 31261609, 31292999		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	24742694, 24751483, 24850177, 28882678, 31292999	Associate	★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	24743044, 29374154	Stimulate	★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	29643977, 30017261, 30361109, 30737982, 31096213, 31247244, 31431514, 31618623, 31819045		★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	28439078		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	18774777, 19474719, 19912989, 20689156, 21756203, 21813271, 22106091, 22939883, 23374725, 23510538, 23770291, 24240701, 24702436, 25356824, 26862948, 28270525, 28493443, 28732575, 28810642, 29147649, 29524414, 29533740, 30714469, 31093947, 31195981, 31284444		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	19786632, 21813271, 22064865, 22378745, 23636469, 37862340	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	19806227, 35365152	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Metabolic Syndrome	Metabolic syndrome	Pubtator	20068143	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	19455179, 20068143, 20503258, 22939883, 24451382, 24567379, 24702436, 27009398, 29402742, 30355082, 30512225, 31139863, 31512260		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Metabolic Syndrome X	Metabolic Syndrome	CTD_human_DG	20068143		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Metastatic melanoma	Metastatic Melanoma	BEFREE	29374154		★☆☆☆☆ Found in Text Mining only
Microvascular Angina	Microvascular angina	Pubtator	35968712	Associate	★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	19104446, 29439356, 31305452		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	20697895, 24446069, 25961951, 27998274, 30385096, 31881011, 32286137, 32692720, 34214916, 35364376	Associate	★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial Diseases	BEFREE	22834844		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	37949849	Inhibit	★☆☆☆☆ Found in Text Mining only
Mitral Valve Prolapse Syndrome	Mitral Valve Prolapse	BEFREE	30841577		★☆☆☆☆ Found in Text Mining only
Mitral Valve Stenosis	Mitral Valve Stenosis	BEFREE	30028960		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	PSYGENET_DG	20451257, 21349544		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood Disorder	BEFREE	21349544		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Motor neuron atrophy	Motor neuron atrophy	BEFREE	21896316		★☆☆☆☆ Found in Text Mining only
Motor Neuron Disease	Motor Neuron Disease	BEFREE	24507186		★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	37949849	Inhibit	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	21915620, 23759586, 31576013		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	23759586	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	24397908, 26679105, 27474445, 28109694, 29153609, 29494741, 30028960, 31812544		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	25136908, 36949521, 38003363	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis, Relapsing-Remitting	Multiple Sclerosis	BEFREE	24397908		★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Oculopharyngeal	Oculopharyngeal Muscular Dystrophy	BEFREE	18397876		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	30146412, 31090265		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	26646449		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	22207735, 22410779, 24855208, 24967705, 25449787, 26049753, 26282546, 31090265, 31180336, 31407410		★☆☆☆☆ Found in Text Mining only
Myocardial Failure	Myocardial Infarction	CTD_human_DG	24535859		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	18826227, 22935421, 25706717, 27696525, 28043667, 28361889, 28901505, 29566363, 30050588, 30608184, 31486508, 31847890		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	25342474	Inhibit	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	25654745, 25706717, 28329314, 29664427, 33879068, 35092334, 37930868	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	28271186, 29409011, 31223283		★☆☆☆☆ Found in Text Mining only
MYOTONIC DYSTROPHY 1	Myotonic dystrophy	BEFREE	29189984		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	26342525, 29767533		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	21144831		★☆☆☆☆ Found in Text Mining only
Native American myopathy	Native American Myopathy	BEFREE	23561972, 28477081		★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	38427808	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	16596166, 17638871, 17806102, 18203716, 18723112, 18835033, 19132007, 19166820, 19244112, 19430421, 19433578, 19509139, 19928762, 20412117, 21149730, 21527554, 21596753, 21677689, 21920899, 22146883, 22537175, 22552445, 22554968, 22986535, 22986747, 23024800, 23028940, 23224434, 23255128, 23339189, 23340254, 23354305, 23370328, 23799088, 23805287, 23970286, 24127549, 24223900, 24742694, 24855208, 24970682, 25143434, 25189993, 25270091, 25411356, 25500546, 25520062, 25522783, 25732823, 25779952, 25798752, 25826085, 25915617, 25946975, 26225773, 26523671, 26862948, 26975631, 26986234, 27080717, 27358235, 27725192, 27793039, 27793057, 28112277, 28162896, 28324774, 28334808, 28445726, 28498463, 28600541, 28755171, 28881735, 28943922, 28943955, 29050728, 29147649, 29306019, 29308302, 29416748, 29427626, 29435152, 29476819, 29535539, 29564694, 29574020, 29625788, 29693338, 29694959, 29896286, 29991742, 30021836, 30059665, 30092626, 30380732, 30448921, 30519106, 30555597, 30710340, 30739913, 30930849, 30930981, 30945643, 31056963, 31063745, 31082419, 31201813, 31317367, 31487876, 31587155, 31692593		★☆☆☆☆ Found in Text Mining only
Neoplasms, Intracranial	Intracranial Neoplasm	CTD_human_DG	22523472		★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	BEFREE	24570024		★☆☆☆☆ Found in Text Mining only
Nephrolithiasis	Nephrolithiasis	BEFREE	30714469		★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic syndrome	Pubtator	32270742	Associate	★☆☆☆☆ Found in Text Mining only
Nervous System Diseases	Nervous system disease	Pubtator	25991017	Associate	★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	29018134, 29134718, 29393101, 30145851		★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural Tube Defect	BEFREE	28434941		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	19285077, 23762270, 24874077, 24946089, 27522594, 29609003, 30350304, 30519106, 30835941, 31846093		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	19285077	Associate	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	37446264	Stimulate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	22584570, 28578695, 33834065, 36725745, 38283900	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	17581637, 18774777, 19912989, 20061622, 22613205, 22796962, 22885181, 23361587, 23417962, 23499872, 23549885, 24252177, 24496572, 24507186, 24946089, 26862948, 27590140, 28017962, 28033734, 28086917, 28356158, 28578695, 29102593, 29249955, 29375306, 29494741, 29523769, 29540553, 29571747, 29577959, 30416425, 30448921, 30532738, 30973934, 31016762, 31110473, 31373965, 31812544		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurodegenerative Disorders	Neurodegenerative Disorders	LHGDN	17581637		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurodegenerative Disorders	Neurodegenerative Disorders	CTD_human_DG	17581637, 17652729		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Niemann-Pick Disease, Type C	Niemann-Pick Disease	BEFREE	21144831		★☆☆☆☆ Found in Text Mining only
Nijmegen Breakage Syndrome	Nijmegen Breakage Syndrome	BEFREE	20097625, 23224247		★☆☆☆☆ Found in Text Mining only
Nodular glomerulosclerosis	Glomerulosclerosis	BEFREE	29477240		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	20033348, 22902550, 24473773, 26330104, 26525891, 27756894, 28473059, 28533219, 28534819, 28592311, 28789977, 28808418, 28817690, 28973994, 29104641, 29189974, 29447962, 29562725, 29574225, 29696666, 29845302, 30221089, 30235452, 30263038, 30473057, 30557833, 30664220, 30785444, 30861258, 31083505, 31139863, 31195981, 31252266, 31256424, 31296380, 31311301, 31361524, 31500354, 31558861, 31674780, 31683679		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	CTD_human_DG	26026874		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	21801305, 24223900, 24228097, 24240701, 25143434, 25915617, 26096576, 27074577, 27768839, 28977967, 29535539, 29552768, 29694959, 30021836, 30237737, 30464525, 30710424, 31410153		★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	CTD_human_DG	26026874		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	31139863		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	BEFREE	18820948, 19430421, 19474719, 19741164, 20335544, 21321189, 21540183, 21760635, 21871827, 22310473, 22613205, 22885181, 23374725, 23374890, 25404345, 25479240, 26368128, 27125385, 27181590, 28104916, 28445161, 28592311, 28808064, 28816006, 28950020, 29042127, 29050301, 29150224, 29236311, 29428938, 30178808, 30305620, 30374331, 30503839, 30506571, 30532738, 30794116, 30877853, 30889894, 30890694, 31083505, 31296102, 31302199, 31321239, 31462690, 31503544		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	19430421, 20335544, 21760635, 21871827, 22310473, 23933590, 27125385, 29428938, 33612619, 35811457, 38283900, 38533551	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	CTD_human_DG	24184811		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	29417372, 30409902, 35968712, 37862340	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity Abdominal	Obesity	Pubtator	23933590, 33612619	Associate	★☆☆☆☆ Found in Text Mining only
Obesity, Morbid	Obesity	BEFREE	21760635, 23298959, 23928404, 24675148		★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	30319540		★☆☆☆☆ Found in Text Mining only
Optic Atrophy	Optic Atrophy	BEFREE	23892278		★☆☆☆☆ Found in Text Mining only
Optic Neuritis	Optic neuritis	Pubtator	36949521	Associate	★☆☆☆☆ Found in Text Mining only
Oral Mucositis	Oral Mucositis	BEFREE	31497199		★☆☆☆☆ Found in Text Mining only
Oropharyngeal Neoplasms	Oropharyngeal neoplasm	Pubtator	38167952	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	19714620, 23143889, 32395770, 33942704, 35594394, 35894157, 36915137, 38554527	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	21337390, 27863529, 31072129	Inhibit	★☆☆☆☆ Found in Text Mining only
Osteoarthritis Knee	Osteoarthritis	Pubtator	27863529	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	27863529		★☆☆☆☆ Found in Text Mining only
Osteoglophonic dwarfism	Osteoglosphonic dysplasia	BEFREE	28888980		★☆☆☆☆ Found in Text Mining only
Osteoglophonic dwarfism	Osteoglophonic dwarfism	Pubtator	33355373	Inhibit	★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	21239502, 24949665, 30318050		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	21239502, 23276927, 24949665, 28339869, 28542607, 28937996, 28975701, 28988762, 29201210, 30318050, 30862606, 31486477, 31634777, 31804494		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	23255128, 23473037, 28339869, 28751929, 31486477, 34711685, 35159154, 36046997, 36682830, 36840968	Associate	★☆☆☆☆ Found in Text Mining only
Osteoporosis, Postmenopausal	Osteoporosis	BEFREE	30224934		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	23877372, 28059051, 28632727, 28810936, 31390921	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteosarcoma	Osteosarcoma	BEFREE	27216562, 27793039, 28059051, 28587420, 28632727, 28810936, 30304565, 30881341, 31390921		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteosarcoma	Osteosarcoma	CTD_human_DG	27793039		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	26862948, 28667895, 31317367		★☆☆☆☆ Found in Text Mining only
Ovarian Failure, Premature	Ovarian Failure	BEFREE	28469767, 31055719		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	28214851, 28365935, 28878214, 29050034, 29422491, 30058682, 31572453		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	25323003, 28214851, 28365935, 29050034, 31839623, 32388637, 33921111, 34590923	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	32541517	Inhibit	★☆☆☆☆ Found in Text Mining only
OVERLAP CONNECTIVE TISSUE DISEASE	MASS syndrome	BEFREE	28937996		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	21677689, 22552606, 23370328, 24088390, 24484175, 25798752, 25843411, 26282546, 27170223, 27494892, 27993677, 28351313, 29706374		★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	24088390, 25798752, 27170223		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	21909380, 24088390, 24484175, 25172416, 27170223, 28351313, 37138146	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	BEFREE	25349250		★☆☆☆☆ Found in Text Mining only
Pancreatitis Chronic	Pancreatitis	Pubtator	25172416	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis, Acute Necrotizing	Necrotizing pancreatitis	BEFREE	28586010		★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	22552606		★☆☆☆☆ Found in Text Mining only
Pancytopenia	Pancytopenia	BEFREE	31178326		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	27793057, 28393212		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	22613205, 23719790, 26130063, 26768367, 28578695, 28656548, 28840510, 28851138, 29523769, 29571747, 29849897, 30835941, 31214610, 31244600, 31737212, 31812544		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	25991017, 26768367, 30718471, 31214610, 34021216, 34204164, 36352829	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	28578695	Inhibit	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	37446264	Stimulate	★☆☆☆☆ Found in Text Mining only
Paroxysmal atrial fibrillation	Paroxysmal atrial fibrillation	CTD_human_DG	29892015		★☆☆☆☆ Found in Text Mining only
Pediatric Obesity	Childhood obesity	BEFREE	25233986, 28118644		★☆☆☆☆ Found in Text Mining only
Periapical Periodontitis	Periapical Periodontitis	BEFREE	29363137, 30101822		★☆☆☆☆ Found in Text Mining only
Periapical Periodontitis	Periapical periodontitis	Pubtator	30101822	Associate	★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	31749165		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	30026098, 31769563		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	35630070	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Disease	Peripheral arterial disease	Pubtator	35092334	Associate	★☆☆☆☆ Found in Text Mining only
Peroxisomal Disorders	Peroxisomal disorder	Pubtator	31257461	Associate	★☆☆☆☆ Found in Text Mining only
Pervasive Development Disorder	Autism spectrum disorder	BEFREE	28694700		★☆☆☆☆ Found in Text Mining only
PIGMENTARY DISORDER, RETICULATE, WITH SYSTEMIC MANIFESTATIONS	Pigmentary Disorder, Reticulate, With Systemic Manifestations	BEFREE	31136205		★☆☆☆☆ Found in Text Mining only
Pituitary Adenoma	Pituitary adenoma	BEFREE	28521414, 31747893		★☆☆☆☆ Found in Text Mining only
Pituitary Diseases	Pituitary Diseases	BEFREE	30405528		★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	31747893	Associate	★☆☆☆☆ Found in Text Mining only
Pleurisy	Pleuritis	BEFREE	30118661		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	27117143, 29447380, 29958542		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	36286390	Associate	★☆☆☆☆ Found in Text Mining only
Polyneuropathies	Polyneuropathy	Pubtator	37175520	Associate	★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	31421827		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	26416354, 31809874		★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	30273928		★☆☆☆☆ Found in Text Mining only
Premature aging syndrome	Premature aging	BEFREE	18337721, 20097625, 22178470, 22546858, 23439428, 31443469		★☆☆☆☆ Found in Text Mining only
Premature Menopause	Premature Menopause	BEFREE	28469767, 31055719		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	28521305, 29523769, 30071285, 30361109, 30484407		★☆☆☆☆ Found in Text Mining only
Primary malignant neoplasm of brain	Brain Neoplasms	CTD_human_DG	22523472		★☆☆☆☆ Found in Text Mining only
Progeria	Progeria	BEFREE	23217256		★☆☆☆☆ Found in Text Mining only
Progesterone Resistance	Progesterone Resistance	BEFREE	28754906		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	16923962, 17638871, 18573234, 19377286, 22050448, 22249256, 23658738, 24127549, 24892674, 25557355, 26847404, 26988912, 26996298, 27686228, 29416748, 29805651, 31092575		★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasia	Prostatic intraepithelial neoplasia	Pubtator	24127549	Inhibit	★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasias	Prostatic Neoplasms	BEFREE	25529796		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	15692560, 17505061, 17638871, 18573234		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	15692560, 17505061, 18637271, 19075016, 19377286, 22249256, 23169992, 23658738, 24127549, 24713434, 24892674, 25870236, 26439987, 26847404, 26988912, 30024932, 31092575, 34171447	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	17638871		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	21062352		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	BEFREE	21098725, 28257794, 29799444, 29937556, 31495284		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	26556603, 27496874	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	29369849, 30227325		★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	33143333, 35042949	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	18174544, 27767101, 27784320, 29861836, 32270742, 33762567	Inhibit	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	23897750, 25905433, 29138552, 29411515, 29976774, 33311978, 39682757	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	22178470, 22546858, 24039251, 29038519		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	27748907, 28273432, 28365154, 28800254, 30390331		★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	31028741		★☆☆☆☆ Found in Text Mining only
Recurrent Brain Neoplasm	Brain Neoplasms	CTD_human_DG	22523472		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	26499759, 28717923, 31201813		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	23583181, 24356887, 26257513, 28143892, 28339034, 28973641, 29723660, 30125566, 31118021, 31719572, 31842414		★☆☆☆☆ Found in Text Mining only
Renal glomerular disease	Renal Glomerular Disease	BEFREE	30254426		★☆☆☆☆ Found in Text Mining only
Renpenning syndrome 1	Renpenning Syndrome	BEFREE	20033348		★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	29351405, 30178862		★☆☆☆☆ Found in Text Mining only
Retinal Degeneration	Retinal degeneration	Pubtator	24036938	Associate	★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	CTD_human_DG	23217256		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	23395551, 24416337, 29523769, 30572719		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal detachment	Pubtator	27998274	Associate	★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis Pigmentosa	BEFREE	29062766		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	29914080, 30546451, 31571997		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	25341037		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	21239502, 21742641, 23239110, 26298564, 26987484, 28193684, 28288820, 28849139, 28966618, 29095837, 29179491, 29459717, 29784872, 30558548, 30988705, 31629819		★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic	Rhinitis	Pubtator	37274900	Associate	★☆☆☆☆ Found in Text Mining only
Right Ventricular Hypertrophy	Ventricular hypertrophy	BEFREE	28494457		★☆☆☆☆ Found in Text Mining only
Salivary Gland Pleomorphic Adenoma	Pleomorphic adenoma of salivary gland	BEFREE	25445714		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	24019980		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Sarcoma	Pubtator	24019980	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma Ewing	Sarcoma	Pubtator	26055805	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	20977650, 21882241, 31247244		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	20977650, 21882241		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	20977650	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Scleroderma	Scleroderma	BEFREE	28532580		★☆☆☆☆ Found in Text Mining only
Scoliosis	Scoliosis	Pubtator	22152608	Associate	★☆☆☆☆ Found in Text Mining only
Senile Plaques	Senile Plaques	BEFREE	27484949		★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	30980521	Associate	★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	21245135, 25088223, 25404738, 27878240, 28503576, 28993270, 29078895, 29277325, 29680657, 29867921, 30069485, 30186119, 30216989, 30379096, 30500551, 30980521, 31099043, 31234024, 31282985, 31393272, 31811786, 31844680		★☆☆☆☆ Found in Text Mining only
Severe Aplastic Anemia	Anemia	BEFREE	31141802		★☆☆☆☆ Found in Text Mining only
Shared Paranoid Disorder	Shared Paranoid Disorder	BEFREE	21882241		★☆☆☆☆ Found in Text Mining only
Situs Inversus	Situs Inversus	BEFREE	29280055		★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	25445829, 28532580		★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	BEFREE	21149730, 24441046		★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	31552414	Inhibit	★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	30030618		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	17180656, 19649206, 23354305, 23805287, 25424420, 25794641, 25915617, 27720890, 29050728		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	26662958, 29625788, 29636061, 31170665, 31684999		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	23475622, 23805287, 25946975, 31931863, 34384029, 34719479	Associate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	29050728	Inhibit	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	19649206		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	24441046, 31809227		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	23475622, 25503141, 25946975		★☆☆☆☆ Found in Text Mining only
ST segment elevation myocardial infarction	ST Segment Elevation Myocardial Infarction	BEFREE	31294459		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	20033348, 20071779, 21321189, 21540183, 22363635, 23374725, 24011073, 24262277, 24486702, 26323321, 26525891, 28232186, 28247434, 28439947, 28449683, 28467182, 28533219, 28533555, 28667519, 28808418, 28898508, 29402742, 29595075, 29681936, 29845302, 30154382, 30214535, 30232347, 30263038, 31105592, 31183612, 31241768, 31256424, 31321239, 31390551, 31842467		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	CTD_human_DG	21321189, 23834033, 24184811, 24210820, 24442997		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	19509139, 23768087, 24107295, 24278101, 25761483, 26612257, 28061480, 28383763, 29088792, 29581731, 29693338, 30250020, 30537988, 30710340, 30945643, 31352788, 31423013		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	22363646, 23768087, 25033286, 25146318, 25815791, 27384994, 28061480, 28070138, 28122359, 29363918, 29436693, 29693338, 30945643, 31352788, 31423013, 32508267, 35502827	Associate	★☆☆☆☆ Found in Text Mining only
Stomatitis	Stomatitis	BEFREE	31497199		★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	36725745	Associate	★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	26867656, 28017962, 29039533, 29397536, 29480757, 29710495, 30067508, 30149758		★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	25341037		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	25707573, 28532580, 28800254		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Systemic Scleroderma	Scleroderma	CTD_human_DG	25707573		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	30059665		★☆☆☆☆ Found in Text Mining only
Tauopathies	Tauopathies	BEFREE	24254769, 29226865, 29540553, 30243024, 30514854		★☆☆☆☆ Found in Text Mining only
Telomeric 22q13 Monosomy Syndrome	22q13 monosomy syndrome	Pubtator	21527554	Associate	★☆☆☆☆ Found in Text Mining only
Tendinitis	Tendinitis	BEFREE	22689577		★☆☆☆☆ Found in Text Mining only
Teratoma	Teratoma	BEFREE	24936455		★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	31450612	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	27793057	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	22986535, 25109285		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	25109285		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	27793057	Stimulate	★☆☆☆☆ Found in Text Mining only
Thyroiditis Autoimmune	Thyroiditis	Pubtator	27245255, 34439776	Associate	★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	31219487		★☆☆☆☆ Found in Text Mining only
Trichothiodystrophy Syndromes	Trichothiodystrophy	BEFREE	25340339		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	26004371, 26236947, 26459286, 30555597, 30876970, 30982660		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	26236947, 26459286, 26515337	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	30982660, 32681437	Inhibit	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	28552621, 31636473		★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	20451257, 30017261, 31176830		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	27367652, 31219487, 36314337	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	20157519, 25794641, 28275188, 28797320, 35587604, 40460909	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Neoplasms	Uterine neoplasm	Pubtator	32388637	Associate	★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	26940009	Associate	★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	BEFREE	23395551, 23892278		★☆☆☆☆ Found in Text Mining only
Van der Woude syndrome	Van Der Woude Syndrome	BEFREE	31741264		★☆☆☆☆ Found in Text Mining only
Varicocele	Varicocele	BEFREE	29359516, 31696601		★☆☆☆☆ Found in Text Mining only
Vascular Calcification	Vascular calcification	Pubtator	32402066, 38012555	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	19286634, 21474819, 22146233, 23499302, 24702436, 27578018, 27897112, 29371235, 31115479, 31704100		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	32627000, 34850960	Associate	★☆☆☆☆ Found in Text Mining only
Vascular System Injuries	Vascular system injury	Pubtator	37187128	Associate	★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	Pubtator	34950150	Inhibit	★☆☆☆☆ Found in Text Mining only
Ventricular Septal Defects	Ventricular septal defect	BEFREE	22885181		★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	Pubtator	24410795	Associate	★☆☆☆☆ Found in Text Mining only
Wolman Disease	Wolman disease	Pubtator	32365792	Associate	★☆☆☆☆ Found in Text Mining only
Xanthomatosis, Cerebrotendinous	Cholestanol storage disease	BEFREE	31197980		★☆☆☆☆ Found in Text Mining only
Xeroderma Pigmentosum	Xeroderma Pigmentosum	BEFREE	21149730, 24441046		★☆☆☆☆ Found in Text Mining only
Xeroderma Pigmentosum Complementation Group D	Xeroderma pigmentosum	Pubtator	23267107	Associate	★☆☆☆☆ Found in Text Mining only
Xeroderma Pigmentosum, Complementation Group D	Xeroderma Pigmentosum	BEFREE	23267107		★☆☆☆☆ Found in Text Mining only
Xeroderma pigmentosum, group A	Xeroderma Pigmentosum	BEFREE	30327428		★☆☆☆☆ Found in Text Mining only