Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Other IDs Associated diseases
Entrez ID	83439
Gene name	Transcription factor 7 like 1
Gene symbol	TCF7L1
Synonyms (NCBI Gene)	-
Chromosome	2
Chromosome location	2p11.2
Summary	This gene encodes a member of the T cell factor/lymphoid enhancer factor family of transcription factors. These transcription factors are activated by beta catenin, mediate the Wnt signaling pathway and are antagonized by the transforming growth factor be

262

Show/Hide all (262)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016640	hsa-miR-429	Reporter assay	20005803
MIRT020351	hsa-miR-200a-3p	Reporter assay	20005803
MIRT021073	hsa-miR-200c-3p	Reporter assay	20005803
MIRT021652	hsa-miR-141-3p	Reporter assay	20005803
MIRT024127	hsa-miR-200b-3p	Reporter assay	20005803
MIRT755664	hsa-miR-185-3p	Luciferase reporter assay	36271413
MIRT1416450	hsa-miR-1207-5p	CLIP-seq
MIRT1416451	hsa-miR-3915	CLIP-seq
MIRT1416452	hsa-miR-3928	CLIP-seq
MIRT1416453	hsa-miR-4269	CLIP-seq
MIRT1416454	hsa-miR-4736	CLIP-seq
MIRT1416455	hsa-miR-4763-3p	CLIP-seq
MIRT1416456	hsa-miR-4795-5p	CLIP-seq
MIRT1554521	hsa-miR-3160-5p	CLIP-seq
MIRT1554522	hsa-miR-3942-3p	CLIP-seq
MIRT1554523	hsa-miR-4257	CLIP-seq
MIRT1554524	hsa-miR-4315	CLIP-seq
MIRT1554525	hsa-miR-4751	CLIP-seq
MIRT1554526	hsa-miR-515-5p	CLIP-seq
MIRT2124881	hsa-miR-125a-3p	CLIP-seq
MIRT2124882	hsa-miR-1289	CLIP-seq
MIRT2124883	hsa-miR-132	CLIP-seq
MIRT2124884	hsa-miR-198	CLIP-seq
MIRT2124885	hsa-miR-212	CLIP-seq
MIRT2124886	hsa-miR-3158-5p	CLIP-seq
MIRT2124887	hsa-miR-3185	CLIP-seq
MIRT2124888	hsa-miR-3198	CLIP-seq
MIRT2124889	hsa-miR-4271	CLIP-seq
MIRT2124890	hsa-miR-4294	CLIP-seq
MIRT2124891	hsa-miR-4309	CLIP-seq
MIRT2124892	hsa-miR-4534	CLIP-seq
MIRT2124893	hsa-miR-455-3p	CLIP-seq
MIRT2124894	hsa-miR-4725-3p	CLIP-seq
MIRT2124895	hsa-miR-4726-3p	CLIP-seq
MIRT2124896	hsa-miR-4773	CLIP-seq
MIRT2124897	hsa-miR-4785	CLIP-seq
MIRT2124898	hsa-miR-520a-5p	CLIP-seq
MIRT2124899	hsa-miR-525-5p	CLIP-seq
MIRT2124900	hsa-miR-542-3p	CLIP-seq
MIRT2124901	hsa-miR-542-5p	CLIP-seq
MIRT2124902	hsa-miR-558	CLIP-seq
MIRT2124903	hsa-miR-564	CLIP-seq
MIRT2124904	hsa-miR-711	CLIP-seq
MIRT2124905	hsa-miR-759	CLIP-seq
MIRT1416450	hsa-miR-1207-5p	CLIP-seq
MIRT2124881	hsa-miR-125a-3p	CLIP-seq
MIRT2347291	hsa-miR-1285	CLIP-seq
MIRT2124882	hsa-miR-1289	CLIP-seq
MIRT2347292	hsa-miR-1909	CLIP-seq
MIRT2347293	hsa-miR-2467-3p	CLIP-seq
MIRT2347294	hsa-miR-31	CLIP-seq
MIRT2347295	hsa-miR-3128	CLIP-seq
MIRT2124886	hsa-miR-3158-5p	CLIP-seq
MIRT2347296	hsa-miR-3179	CLIP-seq
MIRT2124887	hsa-miR-3185	CLIP-seq
MIRT2347297	hsa-miR-3187-5p	CLIP-seq
MIRT2347298	hsa-miR-3192	CLIP-seq
MIRT2124888	hsa-miR-3198	CLIP-seq
MIRT2347299	hsa-miR-320e	CLIP-seq
MIRT2347300	hsa-miR-326	CLIP-seq
MIRT2347301	hsa-miR-330-5p	CLIP-seq
MIRT2347302	hsa-miR-342-3p	CLIP-seq
MIRT2347303	hsa-miR-3611	CLIP-seq
MIRT2347304	hsa-miR-3675-5p	CLIP-seq
MIRT2347305	hsa-miR-3937	CLIP-seq
MIRT2347306	hsa-miR-4252	CLIP-seq
MIRT2124889	hsa-miR-4271	CLIP-seq
MIRT2124890	hsa-miR-4294	CLIP-seq
MIRT2124891	hsa-miR-4309	CLIP-seq
MIRT2347307	hsa-miR-4314	CLIP-seq
MIRT2347308	hsa-miR-4461	CLIP-seq
MIRT2347309	hsa-miR-4468	CLIP-seq
MIRT2124892	hsa-miR-4534	CLIP-seq
MIRT2347310	hsa-miR-4646-5p	CLIP-seq
MIRT2124894	hsa-miR-4725-3p	CLIP-seq
MIRT2124895	hsa-miR-4726-3p	CLIP-seq
MIRT2347311	hsa-miR-4731-5p	CLIP-seq
MIRT2347312	hsa-miR-4757-5p	CLIP-seq
MIRT1416455	hsa-miR-4763-3p	CLIP-seq
MIRT2124897	hsa-miR-4785	CLIP-seq
MIRT2347313	hsa-miR-486-3p	CLIP-seq
MIRT2124900	hsa-miR-542-3p	CLIP-seq
MIRT2124901	hsa-miR-542-5p	CLIP-seq
MIRT2347314	hsa-miR-548b-3p	CLIP-seq
MIRT2124902	hsa-miR-558	CLIP-seq
MIRT2124903	hsa-miR-564	CLIP-seq
MIRT2347315	hsa-miR-591	CLIP-seq
MIRT2347316	hsa-miR-612	CLIP-seq
MIRT2124904	hsa-miR-711	CLIP-seq
MIRT2461240	hsa-miR-329	CLIP-seq
MIRT2461241	hsa-miR-362-3p	CLIP-seq
MIRT2461242	hsa-miR-3941	CLIP-seq
MIRT2461243	hsa-miR-548ac	CLIP-seq
MIRT2461244	hsa-miR-548ae	CLIP-seq
MIRT2461245	hsa-miR-548aj	CLIP-seq
MIRT2461246	hsa-miR-548am	CLIP-seq
MIRT2461247	hsa-miR-548d-3p	CLIP-seq
MIRT2461248	hsa-miR-548x	CLIP-seq
MIRT2461249	hsa-miR-548z	CLIP-seq
MIRT2461250	hsa-miR-603	CLIP-seq
MIRT1416450	hsa-miR-1207-5p	CLIP-seq
MIRT2124881	hsa-miR-125a-3p	CLIP-seq
MIRT2347291	hsa-miR-1285	CLIP-seq
MIRT2124882	hsa-miR-1289	CLIP-seq
MIRT2640266	hsa-miR-1321	CLIP-seq
MIRT2640267	hsa-miR-138	CLIP-seq
MIRT2640268	hsa-miR-1587	CLIP-seq
MIRT2347292	hsa-miR-1909	CLIP-seq
MIRT2640269	hsa-miR-194	CLIP-seq
MIRT2640270	hsa-miR-204	CLIP-seq
MIRT2640271	hsa-miR-211	CLIP-seq
MIRT2640272	hsa-miR-2114	CLIP-seq
MIRT2347293	hsa-miR-2467-3p	CLIP-seq
MIRT2347294	hsa-miR-31	CLIP-seq
MIRT2640273	hsa-miR-3126-5p	CLIP-seq
MIRT2347295	hsa-miR-3128	CLIP-seq
MIRT2124886	hsa-miR-3158-5p	CLIP-seq
MIRT1554521	hsa-miR-3160-5p	CLIP-seq
MIRT2347296	hsa-miR-3179	CLIP-seq
MIRT2640274	hsa-miR-3181	CLIP-seq
MIRT2124887	hsa-miR-3185	CLIP-seq
MIRT2347297	hsa-miR-3187-5p	CLIP-seq
MIRT2640275	hsa-miR-3191	CLIP-seq
MIRT2347298	hsa-miR-3192	CLIP-seq
MIRT2124888	hsa-miR-3198	CLIP-seq
MIRT2640276	hsa-miR-320a	CLIP-seq
MIRT2640277	hsa-miR-320b	CLIP-seq
MIRT2640278	hsa-miR-320c	CLIP-seq
MIRT2640279	hsa-miR-320d	CLIP-seq
MIRT2347299	hsa-miR-320e	CLIP-seq
MIRT2347300	hsa-miR-326	CLIP-seq
MIRT2347301	hsa-miR-330-5p	CLIP-seq
MIRT2347303	hsa-miR-3611	CLIP-seq
MIRT2640280	hsa-miR-3689a-3p	CLIP-seq
MIRT2640281	hsa-miR-3689c	CLIP-seq
MIRT1416452	hsa-miR-3928	CLIP-seq
MIRT2347305	hsa-miR-3937	CLIP-seq
MIRT1554522	hsa-miR-3942-3p	CLIP-seq
MIRT2640282	hsa-miR-3944-3p	CLIP-seq
MIRT2347306	hsa-miR-4252	CLIP-seq
MIRT1554523	hsa-miR-4257	CLIP-seq
MIRT2124889	hsa-miR-4271	CLIP-seq
MIRT2640283	hsa-miR-4283	CLIP-seq
MIRT2124890	hsa-miR-4294	CLIP-seq
MIRT2124891	hsa-miR-4309	CLIP-seq
MIRT2347307	hsa-miR-4314	CLIP-seq
MIRT1554524	hsa-miR-4315	CLIP-seq
MIRT2640284	hsa-miR-4419a	CLIP-seq
MIRT2640285	hsa-miR-4425	CLIP-seq
MIRT2640286	hsa-miR-4429	CLIP-seq
MIRT2640287	hsa-miR-4456	CLIP-seq
MIRT2347308	hsa-miR-4461	CLIP-seq
MIRT2347309	hsa-miR-4468	CLIP-seq
MIRT2640288	hsa-miR-4489	CLIP-seq
MIRT2640289	hsa-miR-4492	CLIP-seq
MIRT2640290	hsa-miR-4496	CLIP-seq
MIRT2640291	hsa-miR-4498	CLIP-seq
MIRT2640292	hsa-miR-4505	CLIP-seq
MIRT2640293	hsa-miR-4510	CLIP-seq
MIRT2124892	hsa-miR-4534	CLIP-seq
MIRT2347310	hsa-miR-4646-5p	CLIP-seq
MIRT2640294	hsa-miR-4649-5p	CLIP-seq
MIRT2640295	hsa-miR-4656	CLIP-seq
MIRT2640296	hsa-miR-4674	CLIP-seq
MIRT2640297	hsa-miR-4675	CLIP-seq
MIRT2640298	hsa-miR-4706	CLIP-seq
MIRT2124894	hsa-miR-4725-3p	CLIP-seq
MIRT2124895	hsa-miR-4726-3p	CLIP-seq
MIRT2640299	hsa-miR-4728-5p	CLIP-seq
MIRT2347311	hsa-miR-4731-5p	CLIP-seq
MIRT2640300	hsa-miR-4739	CLIP-seq
MIRT2640301	hsa-miR-4741	CLIP-seq
MIRT2640302	hsa-miR-4749-5p	CLIP-seq
MIRT2640303	hsa-miR-4750	CLIP-seq
MIRT1554525	hsa-miR-4751	CLIP-seq
MIRT2640304	hsa-miR-4756-5p	CLIP-seq
MIRT1416455	hsa-miR-4763-3p	CLIP-seq
MIRT2640305	hsa-miR-4766-5p	CLIP-seq
MIRT2124897	hsa-miR-4785	CLIP-seq
MIRT2640306	hsa-miR-4787-5p	CLIP-seq
MIRT2347313	hsa-miR-486-3p	CLIP-seq
MIRT1554526	hsa-miR-515-5p	CLIP-seq
MIRT2124900	hsa-miR-542-3p	CLIP-seq
MIRT2124901	hsa-miR-542-5p	CLIP-seq
MIRT2347314	hsa-miR-548b-3p	CLIP-seq
MIRT2640307	hsa-miR-555	CLIP-seq
MIRT2124902	hsa-miR-558	CLIP-seq
MIRT2124903	hsa-miR-564	CLIP-seq
MIRT2640308	hsa-miR-570	CLIP-seq
MIRT2347316	hsa-miR-612	CLIP-seq
MIRT2640309	hsa-miR-627	CLIP-seq
MIRT2640310	hsa-miR-635	CLIP-seq
MIRT2124904	hsa-miR-711	CLIP-seq
MIRT2640311	hsa-miR-744	CLIP-seq
MIRT2640312	hsa-miR-762	CLIP-seq
MIRT1416450	hsa-miR-1207-5p	CLIP-seq
MIRT2692839	hsa-miR-1253	CLIP-seq
MIRT2347291	hsa-miR-1285	CLIP-seq
MIRT2124882	hsa-miR-1289	CLIP-seq
MIRT2640268	hsa-miR-1587	CLIP-seq
MIRT2347292	hsa-miR-1909	CLIP-seq
MIRT2640269	hsa-miR-194	CLIP-seq
MIRT2640270	hsa-miR-204	CLIP-seq
MIRT2640271	hsa-miR-211	CLIP-seq
MIRT2640272	hsa-miR-2114	CLIP-seq
MIRT2347293	hsa-miR-2467-3p	CLIP-seq
MIRT2124886	hsa-miR-3158-5p	CLIP-seq
MIRT1554521	hsa-miR-3160-5p	CLIP-seq
MIRT2124887	hsa-miR-3185	CLIP-seq
MIRT2347297	hsa-miR-3187-5p	CLIP-seq
MIRT2124888	hsa-miR-3198	CLIP-seq
MIRT2640276	hsa-miR-320a	CLIP-seq
MIRT2640277	hsa-miR-320b	CLIP-seq
MIRT2640278	hsa-miR-320c	CLIP-seq
MIRT2640279	hsa-miR-320d	CLIP-seq
MIRT2347299	hsa-miR-320e	CLIP-seq
MIRT2640280	hsa-miR-3689a-3p	CLIP-seq
MIRT2640281	hsa-miR-3689c	CLIP-seq
MIRT2347305	hsa-miR-3937	CLIP-seq
MIRT1554522	hsa-miR-3942-3p	CLIP-seq
MIRT1554523	hsa-miR-4257	CLIP-seq
MIRT2124889	hsa-miR-4271	CLIP-seq
MIRT2124890	hsa-miR-4294	CLIP-seq
MIRT2124891	hsa-miR-4309	CLIP-seq
MIRT1554524	hsa-miR-4315	CLIP-seq
MIRT2640285	hsa-miR-4425	CLIP-seq
MIRT2640286	hsa-miR-4429	CLIP-seq
MIRT2347308	hsa-miR-4461	CLIP-seq
MIRT2347309	hsa-miR-4468	CLIP-seq
MIRT2640289	hsa-miR-4492	CLIP-seq
MIRT2640290	hsa-miR-4496	CLIP-seq
MIRT2640291	hsa-miR-4498	CLIP-seq
MIRT2640292	hsa-miR-4505	CLIP-seq
MIRT2124892	hsa-miR-4534	CLIP-seq
MIRT2640294	hsa-miR-4649-5p	CLIP-seq
MIRT2640295	hsa-miR-4656	CLIP-seq
MIRT2640296	hsa-miR-4674	CLIP-seq
MIRT2640297	hsa-miR-4675	CLIP-seq
MIRT2640298	hsa-miR-4706	CLIP-seq
MIRT2124894	hsa-miR-4725-3p	CLIP-seq
MIRT2640299	hsa-miR-4728-5p	CLIP-seq
MIRT2347311	hsa-miR-4731-5p	CLIP-seq
MIRT2640301	hsa-miR-4741	CLIP-seq
MIRT2640302	hsa-miR-4749-5p	CLIP-seq
MIRT1554525	hsa-miR-4751	CLIP-seq
MIRT1416455	hsa-miR-4763-3p	CLIP-seq
MIRT2640305	hsa-miR-4766-5p	CLIP-seq
MIRT2692840	hsa-miR-4768-3p	CLIP-seq
MIRT2124897	hsa-miR-4785	CLIP-seq
MIRT2640306	hsa-miR-4787-5p	CLIP-seq
MIRT2347313	hsa-miR-486-3p	CLIP-seq
MIRT1554526	hsa-miR-515-5p	CLIP-seq
MIRT2124901	hsa-miR-542-5p	CLIP-seq
MIRT2347314	hsa-miR-548b-3p	CLIP-seq
MIRT2640307	hsa-miR-555	CLIP-seq
MIRT2124902	hsa-miR-558	CLIP-seq
MIRT2640308	hsa-miR-570	CLIP-seq
MIRT2347316	hsa-miR-612	CLIP-seq
MIRT2640309	hsa-miR-627	CLIP-seq
MIRT2640310	hsa-miR-635	CLIP-seq
MIRT2640311	hsa-miR-744	CLIP-seq
MIRT2640312	hsa-miR-762	CLIP-seq

Show/Hide all (20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	NAS	1741298, 11085512
GO:0003700	Function	DNA-binding transcription factor activity	NAS	1741298, 11085512
GO:0005515	Function	Protein binding	IPI	19304756
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	1741298, 11085512
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005829	Component	Cytosol	IDA
GO:0006325	Process	Chromatin organization	NAS	1741298, 11085512
GO:0006355	Process	Regulation of DNA-templated transcription	NAS	1741298, 11085512
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0030111	Process	Regulation of Wnt signaling pathway	NAS	1741298, 11085512
GO:0060070	Process	Canonical Wnt signaling pathway	IBA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:1990907	Component	Beta-catenin-TCF complex	IBA

MIM	HGNC	e!Ensembl
604652	11640	ENSG00000152284

Q9HCS4

Protein name

Transcription factor 7-like 1 (HMG box transcription factor 3) (TCF-3)

Protein function

Participates in the Wnt signaling pathway. Binds to DNA and acts as a repressor in the absence of CTNNB1, and as an activator in its presence. Necessary for the terminal differentiation of epidermal cells, the formation of keratohyalin granules

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF08347	CTNNB1_binding	1 → 250	N-terminal CTNNB1 binding	Family
PF00505	HMG_box	346 → 414	HMG (high mobility group) box	Domain

Tissue specificity

TISSUE SPECIFICITY: Detected in hair follicles and skin keratinocytes, and at lower levels in stomach epithelium. {ECO:0000269|PubMed:9916915}.

Sequence

MPQLGGGGGGGGGGSGGGGGSSAGAAGGGDDLGANDELIPFQDEGGEEQEPSSDSASAQR
DLDEVKSSLVNESENQSSSSDSEAERRPQPVRDTFQKPRDYFAEVRRPQDSAFFKGPPYP
GYPFLMIPDLSSPYLSNGPLSPGGARTYLQMKWPLLDVPSSATVKDTRSPSPAHLSNKVP
VVQHPHHMHPLTPLITYSNDHFSPGSPPTHLSPEIDPKTGIPRPPHPSELSPYYPLSPGA
VGQIPHPLGWLVPQQGQPMYSLPPGGFRHPYPALAMNASMSSLVSSRFSPHMVAPAHPGL
PTSGIPHPAIVSPIVKQEPAPPSLSPAVSVKSPVTVKKEEEKKPHVKKPLNAFMLYMKEM
RAKVVAECTLKESAAINQILGRKWHNLSREEQAKYYELARKERQLHSQLYPTWSARDNYG
KKKKRKREKQLSQTQSQQQVQEAEGALASKSKKPCVQYLPPEKPCDSPASSHGSMLDSPA
TPSAALASPAAPAATHSEQAQPLSLTTKPETRAQLALHSAAFLSAKAAASSSGQMGSQPP
LLSRPLPLGSMPTALLASPPSFPATLHAHQALPVLQAQPLSLVTKSAH

Sequence length

588

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (10)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Cervical cancer	Benign	ClinVar GWAS catalog	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
CERVICAL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COMBINED PITUITARY HORMONE DEFICIENCIES, GENETIC FORM	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STROKE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THYROID NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (37)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	17311319, 24990612, 24997151		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Exstrophy	Bladder exstrophy	Pubtator	39500676	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	24492847		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	29658607	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	GWASCAT_DG	30412241		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	11700047		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	36181111	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	27333864, 28450117		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	36105798, 36833408, 38224823	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	18840782	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibromatosis, Aggressive	Fibromatosis	BEFREE	11437409		★★★★★ ★☆☆☆☆ Found in Text Mining only
Germ cell tumor	Tumor	BEFREE	31381875		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	27894958		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	29658607, 31322782		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	37307368	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	31322782		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	11085512, 30811526		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	30811526		★★★★★ ★☆☆☆☆ Found in Text Mining only
Marinesco-Sjogren syndrome	Marinesco-Sjogren Syndrome	BEFREE	20532534		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	35127947	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11437409, 20532534, 27333864, 28467300		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nongerminomatous Germ Cell Tumor	Nongerminomatous Tumor	BEFREE	31381875		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis of hip	Osteoarthritis Of Hip	BEFREE	23864140		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pre B-cell acute lymphoblastic leukemia	B-cell Lymphoma	BEFREE	11700047		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	17311319, 24997151		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	21490961	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	37307368	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	28467300		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	11085512, 30811526		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	30811526	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	CTD_human_DG	23811263		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Gland Follicular Adenoma	Thyroid Gland Follicular Adenoma	CTD_human_DG	23811263		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	CTD_human_DG	23811263		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Diseases	Urinary bladder diseases	Pubtator	39500676	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neurogenic	Neurogenic bladder	Pubtator	39500676	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	33824876	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

TCF7L1 (transcription factor 7 like 1)