NEU1 (neuraminidase 1)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 4758
• Gene name: Neuraminidase 1
• Gene symbol: NEU1
• Synonyms (NCBI Gene): NANH, NEU, SIAL1
• Chromosome: 6
• Chromosome location: 6p21.33
• Summary: The protein encoded by this gene is a lysosomal enzyme that cleaves terminal sialic acid residues from substrates such as glycoproteins and glycolipids. In the lysosome, this enzyme is part of a heterotrimeric complex together with beta-galactosidase and

SNPs Show/Hide all (20)

SNP ID	Visualize variation	Clinical significance	Consequence
rs28940583	C>T	Pathogenic-likely-pathogenic, pathogenic	Missense variant, coding sequence variant
rs104893971	C>A	Pathogenic	Coding sequence variant, stop gained
rs104893972	A>C,G	Pathogenic	Coding sequence variant, missense variant
rs104893977	A>T	Uncertain-significance, pathogenic	Coding sequence variant, missense variant
rs104893978	A>G	Pathogenic	Coding sequence variant, missense variant
rs104893979	G>A	Pathogenic	Coding sequence variant, missense variant
rs104893980	C>A,G,T	Pathogenic	Coding sequence variant, missense variant
rs104893981	G>A,C	Likely-pathogenic	Coding sequence variant, missense variant
rs104893983	C>T	Pathogenic	Coding sequence variant, missense variant
rs104893984	C>G,T	Pathogenic	Coding sequence variant, missense variant, stop gained
rs104893985	G>A	Pathogenic	Coding sequence variant, missense variant
rs193922915	A>G	Pathogenic	Coding sequence variant, missense variant
rs398123392	T>C,G	Uncertain-significance, pathogenic, likely-pathogenic	Missense variant, coding sequence variant
rs746607723	G>A,C,T	Pathogenic	Stop gained, synonymous variant, coding sequence variant
rs754405067	CA>-	Pathogenic	Coding sequence variant, frameshift variant
rs769765227	C>T	Pathogenic	Coding sequence variant, missense variant
rs864309513	T>C,G	Pathogenic	Splice acceptor variant
rs886042881	AGACA>TTTGGC	Likely-pathogenic	Frameshift variant, coding sequence variant
rs1486980139	C>G,T	Pathogenic	Splice donor variant
rs1581820081	C>-	Pathogenic	Coding sequence variant, frameshift variant

miRNA Show/Hide all (170)

miRTarBase ID	miRNA	Experiments	Reference
MIRT020584	hsa-miR-155-5p	Proteomics	18668040
MIRT1180937	hsa-miR-139-5p	CLIP-seq
MIRT1180938	hsa-miR-3140-5p	CLIP-seq
MIRT1180939	hsa-miR-323-5p	CLIP-seq
MIRT1180940	hsa-miR-34a	CLIP-seq
MIRT1180941	hsa-miR-34c-5p	CLIP-seq
MIRT1180942	hsa-miR-3616-3p	CLIP-seq
MIRT1180943	hsa-miR-3684	CLIP-seq
MIRT1180944	hsa-miR-3688-5p	CLIP-seq
MIRT1180945	hsa-miR-3714	CLIP-seq
MIRT1180946	hsa-miR-4436b-3p	CLIP-seq
MIRT1180947	hsa-miR-4449	CLIP-seq
MIRT1180948	hsa-miR-4493	CLIP-seq
MIRT1180949	hsa-miR-449a	CLIP-seq
MIRT1180950	hsa-miR-449b	CLIP-seq
MIRT1180951	hsa-miR-4532	CLIP-seq
MIRT1180952	hsa-miR-4700-3p	CLIP-seq
MIRT1180953	hsa-miR-4704-3p	CLIP-seq
MIRT1180954	hsa-miR-4728-5p	CLIP-seq
MIRT1180955	hsa-miR-876-3p	CLIP-seq
MIRT2052307	hsa-miR-125a-5p	CLIP-seq
MIRT2052308	hsa-miR-125b	CLIP-seq
MIRT2052309	hsa-miR-2355-5p	CLIP-seq
MIRT2052310	hsa-miR-23a	CLIP-seq
MIRT2052311	hsa-miR-23b	CLIP-seq
MIRT2052312	hsa-miR-23c	CLIP-seq
MIRT2052313	hsa-miR-24	CLIP-seq
MIRT2052314	hsa-miR-2467-5p	CLIP-seq
MIRT2052315	hsa-miR-3591-3p	CLIP-seq
MIRT2052316	hsa-miR-3614-3p	CLIP-seq
MIRT2052317	hsa-miR-4297	CLIP-seq
MIRT2052318	hsa-miR-4319	CLIP-seq
MIRT2052319	hsa-miR-4682	CLIP-seq
MIRT2052320	hsa-miR-4695-5p	CLIP-seq
MIRT2052321	hsa-miR-4732-3p	CLIP-seq
MIRT2052322	hsa-miR-583	CLIP-seq
MIRT2052323	hsa-miR-670	CLIP-seq
MIRT2281723	hsa-miR-1226	CLIP-seq
MIRT2281724	hsa-miR-1245b-3p	CLIP-seq
MIRT2052307	hsa-miR-125a-5p	CLIP-seq
MIRT2052308	hsa-miR-125b	CLIP-seq
MIRT2281725	hsa-miR-1286	CLIP-seq
MIRT2281726	hsa-miR-129-5p	CLIP-seq
MIRT2281727	hsa-miR-144	CLIP-seq
MIRT2281728	hsa-miR-146b-3p	CLIP-seq
MIRT2281729	hsa-miR-197	CLIP-seq
MIRT2281730	hsa-miR-2113	CLIP-seq
MIRT2052309	hsa-miR-2355-5p	CLIP-seq
MIRT2052310	hsa-miR-23a	CLIP-seq
MIRT2052311	hsa-miR-23b	CLIP-seq
MIRT2052312	hsa-miR-23c	CLIP-seq
MIRT2052313	hsa-miR-24	CLIP-seq
MIRT2052314	hsa-miR-2467-5p	CLIP-seq
MIRT2281731	hsa-miR-339-5p	CLIP-seq
MIRT2052316	hsa-miR-3614-3p	CLIP-seq
MIRT1180942	hsa-miR-3616-3p	CLIP-seq
MIRT2281732	hsa-miR-4265	CLIP-seq
MIRT2281733	hsa-miR-4296	CLIP-seq
MIRT2052317	hsa-miR-4297	CLIP-seq
MIRT2052318	hsa-miR-4319	CLIP-seq
MIRT2281734	hsa-miR-4322	CLIP-seq
MIRT2281735	hsa-miR-4330	CLIP-seq
MIRT1180946	hsa-miR-4436b-3p	CLIP-seq
MIRT2281736	hsa-miR-4648	CLIP-seq
MIRT2281737	hsa-miR-4654	CLIP-seq
MIRT2052319	hsa-miR-4682	CLIP-seq
MIRT2052320	hsa-miR-4695-5p	CLIP-seq
MIRT2281738	hsa-miR-4721	CLIP-seq
MIRT2052321	hsa-miR-4732-3p	CLIP-seq
MIRT2281739	hsa-miR-4733-3p	CLIP-seq
MIRT2281740	hsa-miR-4769-5p	CLIP-seq
MIRT2281741	hsa-miR-5096	CLIP-seq
MIRT2281742	hsa-miR-630	CLIP-seq
MIRT2052323	hsa-miR-670	CLIP-seq
MIRT2281723	hsa-miR-1226	CLIP-seq
MIRT2052307	hsa-miR-125a-5p	CLIP-seq
MIRT2052308	hsa-miR-125b	CLIP-seq
MIRT2281728	hsa-miR-146b-3p	CLIP-seq
MIRT2281729	hsa-miR-197	CLIP-seq
MIRT2052309	hsa-miR-2355-5p	CLIP-seq
MIRT2052310	hsa-miR-23a	CLIP-seq
MIRT2052311	hsa-miR-23b	CLIP-seq
MIRT2052312	hsa-miR-23c	CLIP-seq
MIRT2052313	hsa-miR-24	CLIP-seq
MIRT2052314	hsa-miR-2467-5p	CLIP-seq
MIRT2281731	hsa-miR-339-5p	CLIP-seq
MIRT2052315	hsa-miR-3591-3p	CLIP-seq
MIRT2052316	hsa-miR-3614-3p	CLIP-seq
MIRT2052317	hsa-miR-4297	CLIP-seq
MIRT2052318	hsa-miR-4319	CLIP-seq
MIRT2052319	hsa-miR-4682	CLIP-seq
MIRT2052320	hsa-miR-4695-5p	CLIP-seq
MIRT2052321	hsa-miR-4732-3p	CLIP-seq
MIRT2281739	hsa-miR-4733-3p	CLIP-seq
MIRT2281741	hsa-miR-5096	CLIP-seq
MIRT2052322	hsa-miR-583	CLIP-seq
MIRT2052323	hsa-miR-670	CLIP-seq
MIRT1180942	hsa-miR-3616-3p	CLIP-seq
MIRT1180946	hsa-miR-4436b-3p	CLIP-seq
MIRT1180947	hsa-miR-4449	CLIP-seq
MIRT1180951	hsa-miR-4532	CLIP-seq
MIRT1180954	hsa-miR-4728-5p	CLIP-seq
MIRT2281723	hsa-miR-1226	CLIP-seq
MIRT2052307	hsa-miR-125a-5p	CLIP-seq
MIRT2052308	hsa-miR-125b	CLIP-seq
MIRT2579911	hsa-miR-1283	CLIP-seq
MIRT1180937	hsa-miR-139-5p	CLIP-seq
MIRT2281728	hsa-miR-146b-3p	CLIP-seq
MIRT2281729	hsa-miR-197	CLIP-seq
MIRT2579912	hsa-miR-205	CLIP-seq
MIRT2052309	hsa-miR-2355-5p	CLIP-seq
MIRT2052310	hsa-miR-23a	CLIP-seq
MIRT2052311	hsa-miR-23b	CLIP-seq
MIRT2052312	hsa-miR-23c	CLIP-seq
MIRT2052313	hsa-miR-24	CLIP-seq
MIRT2052314	hsa-miR-2467-5p	CLIP-seq
MIRT2281731	hsa-miR-339-5p	CLIP-seq
MIRT2579913	hsa-miR-33a	CLIP-seq
MIRT2579914	hsa-miR-33b	CLIP-seq
MIRT2052315	hsa-miR-3591-3p	CLIP-seq
MIRT2052316	hsa-miR-3614-3p	CLIP-seq
MIRT1180942	hsa-miR-3616-3p	CLIP-seq
MIRT2579915	hsa-miR-362-5p	CLIP-seq
MIRT1180943	hsa-miR-3684	CLIP-seq
MIRT2579916	hsa-miR-3976	CLIP-seq
MIRT2052317	hsa-miR-4297	CLIP-seq
MIRT2052318	hsa-miR-4319	CLIP-seq
MIRT1180946	hsa-miR-4436b-3p	CLIP-seq
MIRT1180947	hsa-miR-4449	CLIP-seq
MIRT2579917	hsa-miR-4528	CLIP-seq
MIRT1180951	hsa-miR-4532	CLIP-seq
MIRT2052319	hsa-miR-4682	CLIP-seq
MIRT2052320	hsa-miR-4695-5p	CLIP-seq
MIRT1180952	hsa-miR-4700-3p	CLIP-seq
MIRT1180954	hsa-miR-4728-5p	CLIP-seq
MIRT2052321	hsa-miR-4732-3p	CLIP-seq
MIRT2281739	hsa-miR-4733-3p	CLIP-seq
MIRT2579918	hsa-miR-500b	CLIP-seq
MIRT2579919	hsa-miR-501-5p	CLIP-seq
MIRT2281741	hsa-miR-5096	CLIP-seq
MIRT2579920	hsa-miR-576-3p	CLIP-seq
MIRT2052322	hsa-miR-583	CLIP-seq
MIRT2579921	hsa-miR-664	CLIP-seq
MIRT2052323	hsa-miR-670	CLIP-seq
MIRT2281723	hsa-miR-1226	CLIP-seq
MIRT2052307	hsa-miR-125a-5p	CLIP-seq
MIRT2052308	hsa-miR-125b	CLIP-seq
MIRT1180937	hsa-miR-139-5p	CLIP-seq
MIRT2281728	hsa-miR-146b-3p	CLIP-seq
MIRT2281729	hsa-miR-197	CLIP-seq
MIRT2052309	hsa-miR-2355-5p	CLIP-seq
MIRT2052310	hsa-miR-23a	CLIP-seq
MIRT2052311	hsa-miR-23b	CLIP-seq
MIRT2052312	hsa-miR-23c	CLIP-seq
MIRT2052313	hsa-miR-24	CLIP-seq
MIRT2052314	hsa-miR-2467-5p	CLIP-seq
MIRT2281731	hsa-miR-339-5p	CLIP-seq
MIRT2052315	hsa-miR-3591-3p	CLIP-seq
MIRT2052316	hsa-miR-3614-3p	CLIP-seq
MIRT1180943	hsa-miR-3684	CLIP-seq
MIRT2052317	hsa-miR-4297	CLIP-seq
MIRT2052318	hsa-miR-4319	CLIP-seq
MIRT2052319	hsa-miR-4682	CLIP-seq
MIRT2052320	hsa-miR-4695-5p	CLIP-seq
MIRT1180952	hsa-miR-4700-3p	CLIP-seq
MIRT2052321	hsa-miR-4732-3p	CLIP-seq
MIRT2281739	hsa-miR-4733-3p	CLIP-seq
MIRT2281741	hsa-miR-5096	CLIP-seq
MIRT2052322	hsa-miR-583	CLIP-seq
MIRT2052323	hsa-miR-670	CLIP-seq

Gene ontology (GO) Show/Hide all (28)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004308	Function	Exo-alpha-sialidase activity	IBA
GO:0004308	Function	Exo-alpha-sialidase activity	IDA	8985184
GO:0004308	Function	Exo-alpha-sialidase activity	IEA
GO:0004308	Function	Exo-alpha-sialidase activity	TAS
GO:0005515	Function	Protein binding	IPI	25910212, 32296183
GO:0005576	Component	Extracellular region	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005764	Component	Lysosome	IBA
GO:0005764	Component	Lysosome	IDA	8985184, 25153125
GO:0005764	Component	Lysosome	IEA
GO:0005765	Component	Lysosomal membrane	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006689	Process	Ganglioside catabolic process	IBA
GO:0009313	Process	Oligosaccharide catabolic process	IBA
GO:0009313	Process	Oligosaccharide catabolic process	IMP	8985184
GO:0016020	Component	Membrane	IBA
GO:0016020	Component	Membrane	IEA
GO:0016042	Process	Lipid catabolic process	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0016798	Function	Hydrolase activity, acting on glycosyl bonds	IEA
GO:0016997	Function	Alpha-sialidase activity	IMP	25153125
GO:0030054	Component	Cell junction	IDA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0035580	Component	Specific granule lumen	TAS
GO:0043202	Component	Lysosomal lumen	IEA
GO:0043202	Component	Lysosomal lumen	TAS
GO:0070062	Component	Extracellular exosome	HDA	19199708, 23533145

Other IDs

• MIM: 608272
• HGNC: 7758
• e!Ensembl: ENSG00000204386

Protein

• UniProt ID: Q99519
• Protein name: Sialidase-1 (EC 3.2.1.18) (Acetylneuraminyl hydrolase) (G9 sialidase) (Lysosomal sialidase) (N-acetyl-alpha-neuraminidase 1)
• Protein function: Catalyzes the removal of sialic acid (N-acetylneuraminic acid) moieties from glycoproteins and glycolipids. To be active, it is strictly dependent on its presence in the multienzyme complex. Appears to have a preference for alpha 2-3 and alpha 2
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13088	BNR_2	88 → 382	BNR repeat-like domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Highly expressed in pancreas, followed by skeletal muscle, kidney, placenta, heart, lung and liver. Weakly expressed in brain. {ECO:0000269|PubMed:8985184, ECO:0000269|PubMed:9054950}.
• Sequence:

  MTGERPSTALPDRRWGPRILGFWGGCRVWVFAAIFLLLSLAASWSKAENDFGLVQPLVTM
  EQLLWVSGRQIGSVDTFRIPLITATPRGTLLAFAEARKMSSSDEGAKFIALRRSMDQGST
  WSPTAFIVNDGDVPDGLNLGAVVSDVETGVVFLFYSLCAHKAGCQVASTMLVWSKDDGVS
  WSTPRNLSLDIGTEVFAPGPGSGIQKQREPRKGRLIVCGHGTLERDGVFCLLSDDHGASW
  RYGSGVSGIPYGQPKQENDFNPDECQPYELPDGSVVINARNQNNYHCHCRIVLRSYDACD
  TLRPRDVTFDPELVDPVVAAGAVVTSSGIVFFSNPAHPEFRVNLTLRWSFSNGTSWRKET
  VQLWPGPSGYSSLATLEGSMDGEEQAPQLYVLYEKGRNHYTESISVAKISVYGTL

• Sequence length: 415

Pathways

KEGG Pathway	Reactome Pathway
Other glycan degradation	Glycosphingolipid metabolism
Sphingolipid metabolism	Sialic acid metabolism
Metabolic pathways	Defective NEU1 causes sialidosis
Lysosome	Neutrophil degranulation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
NEU1-related disorder	Likely pathogenic; Pathogenic	rs28940583, rs104893986	RCV004757093 RCV003964788	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Non-immune hydrops fetalis	Pathogenic	rs746607723, rs864309513	RCV000202594 RCV000202579	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Sialidosis	Pathogenic; Likely pathogenic	rs534846786, rs28940583, rs104893981, rs768958770, rs749996046, rs751458617, rs769765227, rs398123392, rs754405067, rs768711214, rs945372017, rs762400331, rs1762547799	RCV001806793 RCV002281689 RCV003323347 RCV002469977 RCV003155631 RCV003493356 RCV000587143 RCV000781657 RCV000503401 RCV002234170 RCV001175541 RCV003317457 RCV005408754 RCV001293567	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Sialidosis type 1	Pathogenic; Likely pathogenic	rs104893971, rs28940583, rs104893983, rs104893979	RCV000002547 RCV000002553 RCV000002554 RCV000002558	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Sialidosis type 2	Likely pathogenic; Pathogenic	rs2151544098, rs2151544199, rs104893972, rs1301852124, rs104893977, rs193922915, rs1581820081, rs104893984, rs104893985, rs104893978, rs1486980139, rs104893980, rs104893981, rs104893986, rs746607723, rs864309513, rs190549838, rs769765227, rs398123392, rs1310267862, rs751458617	RCV001782518 RCV001806380 RCV000002548 RCV000002549 RCV000002550 RCV000002551 RCV000002552 RCV000002555 RCV000002556 RCV000002557 RCV000002559 RCV000002560 RCV000002561 RCV000002562 RCV000202594 RCV000202579 RCV004690421 RCV001805111 RCV005869518 RCV001293240 RCV002499537	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (14)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
BASAL CELL CARCINOMA	—	GWAS catalog	27539887	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CELIAC DISEASE	—	GWAS catalog	39789286	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL SIALIDOSIS TYPE 2	—	Disgenet, Orphanet Disgenet, Orphanet Disgenet, Orphanet	14695530, 14695530, 19568825, 19568825	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DENTAL CARIES	—	GWAS catalog	39192244	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DESBUQUOIS SYNDROME	—	CTD	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EOSINOPHILIC ESOPHAGITIS	—	GWAS catalog	29904099	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYDROPS FETALIS, NON-IMMUNE	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MUCOLIPIDOSES	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	26198764	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SMALL CELL LUNG CARCINOMA	—	GWAS catalog	28604730	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	28604730	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	33272962	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE I MUCOLIPIDOSIS	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Related Genes

Sort by: Blended Diseases Pathways Evidence source

NEU3 4 shared pathwaysOther glycan degradation, Sphingolipid metabolism, Sialic acid metabolism, Glycosphingolipid metabolism Related via 4 shared pathways including Other glycan degradation, Sphingolipid metabolism. NEU4 4 shared pathwaysOther glycan degradation, Sphingolipid metabolism, Sialic acid metabolism, Glycosphingolipid metabolism Related via 4 shared pathways including Other glycan degradation, Sphingolipid metabolism. GBA 4 shared pathwaysOther glycan degradation, Sphingolipid metabolism, Lysosome, Glycosphingolipid metabolism Related via 4 shared pathways including Other glycan degradation, Sphingolipid metabolism. NEU2 4 shared pathwaysOther glycan degradation, Sphingolipid metabolism, Sialic acid metabolism, Glycosphingolipid metabolism Related via 4 shared pathways including Other glycan degradation, Sphingolipid metabolism. SLC17A1 2 shared diseasesCeliac disease, Dental caries 2 shared evidence sourcesGWAS catalog (Celiac disease), GWAS catalog (Dental caries) Related via 2 shared diseases including Celiac disease, Dental caries — evidence mostly GWAS catalog.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
NEU3	0	[]	4	["Other glycan degradation","Sphingolipid metabolism","Sialic acid metabolism","Glycosphingolipid metabolism"]	0	[]
NEU4	0	[]	4	["Other glycan degradation","Sphingolipid metabolism","Sialic acid metabolism","Glycosphingolipid metabolism"]	0	[]
GBA	0	[]	4	["Other glycan degradation","Sphingolipid metabolism","Lysosome","Glycosphingolipid metabolism"]	0	[]
NEU2	0	[]	4	["Other glycan degradation","Sphingolipid metabolism","Sialic acid metabolism","Glycosphingolipid metabolism"]	0	[]
SLC17A1	2	["Celiac disease","Dental caries"]	0	[]	2	["GWAS catalog (Celiac disease)","GWAS catalog (Dental caries)"]

Diseases Linked via Similar Genes

Eczema Linked via 1 of 5 related genesNEU4 Narcolepsy Linked via 1 of 5 related genesNEU4 Alzheimer disease Linked via 1 of 5 related genesSLC17A1 Gout Linked via 1 of 5 related genesSLC17A1 Insomnia Linked via 1 of 5 related genesSLC17A1

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Eczema	1	["NEU4"]
Narcolepsy	1	["NEU4"]
Alzheimer disease	1	["SLC17A1"]
Gout	1	["SLC17A1"]
Insomnia	1	["SLC17A1"]