NEU3 (neuraminidase 3)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 10825
• Gene name: Neuraminidase 3
• Gene symbol: NEU3
• Synonyms (NCBI Gene): SIAL3
• Chromosome: 11
• Chromosome location: 11q13.4
• Summary: This gene product belongs to a family of glycohydrolytic enzymes which remove sialic acid residues from glycoproteins and glycolipids. It is localized in the plasma membrane, and its activity is specific for gangliosides. It may play a role in modulating

miRNA Show/Hide all (135)

miRTarBase ID	miRNA	Experiments	Reference
MIRT052460	hsa-let-7a-5p	CLASH	23622248
MIRT036294	hsa-miR-1229-3p	CLASH	23622248
MIRT496469	hsa-miR-4731-3p	PAR-CLIP	22291592
MIRT496468	hsa-miR-4801	PAR-CLIP	22291592
MIRT496467	hsa-miR-1245b-5p	PAR-CLIP	22291592
MIRT496466	hsa-miR-3142	PAR-CLIP	22291592
MIRT496465	hsa-miR-1295b-3p	PAR-CLIP	22291592
MIRT442305	hsa-miR-4719	PAR-CLIP	22291592
MIRT496464	hsa-miR-2861	PAR-CLIP	22291592
MIRT442307	hsa-miR-580-5p	PAR-CLIP	22100165
MIRT442306	hsa-miR-6830-5p	PAR-CLIP	22100165
MIRT442305	hsa-miR-4719	PAR-CLIP	22100165
MIRT442304	hsa-miR-1303	PAR-CLIP	22100165
MIRT496469	hsa-miR-4731-3p	PAR-CLIP	22291592
MIRT496468	hsa-miR-4801	PAR-CLIP	22291592
MIRT496467	hsa-miR-1245b-5p	PAR-CLIP	22291592
MIRT496466	hsa-miR-3142	PAR-CLIP	22291592
MIRT496465	hsa-miR-1295b-3p	PAR-CLIP	22291592
MIRT442305	hsa-miR-4719	PAR-CLIP	22291592
MIRT496464	hsa-miR-2861	PAR-CLIP	22291592
MIRT442307	hsa-miR-580-5p	PAR-CLIP	22100165
MIRT442306	hsa-miR-6830-5p	PAR-CLIP	22100165
MIRT442305	hsa-miR-4719	PAR-CLIP	22100165
MIRT442304	hsa-miR-1303	PAR-CLIP	22100165
MIRT1180956	hsa-miR-3609	CLIP-seq
MIRT1180957	hsa-miR-4443	CLIP-seq
MIRT1180958	hsa-miR-4640-5p	CLIP-seq
MIRT1180959	hsa-miR-4667-5p	CLIP-seq
MIRT1180960	hsa-miR-4700-5p	CLIP-seq
MIRT1180961	hsa-miR-4726-5p	CLIP-seq
MIRT1180962	hsa-miR-513a-5p	CLIP-seq
MIRT1180963	hsa-miR-518d-5p	CLIP-seq
MIRT1180964	hsa-miR-519b-5p	CLIP-seq
MIRT1180965	hsa-miR-519c-5p	CLIP-seq
MIRT1180966	hsa-miR-520c-5p	CLIP-seq
MIRT1180967	hsa-miR-526a	CLIP-seq
MIRT1180968	hsa-miR-548ah	CLIP-seq
MIRT1180969	hsa-miR-548t	CLIP-seq
MIRT1180970	hsa-miR-601	CLIP-seq
MIRT1180971	hsa-miR-637	CLIP-seq
MIRT1180972	hsa-miR-765	CLIP-seq
MIRT1180973	hsa-miR-9	CLIP-seq
MIRT2052324	hsa-miR-1255a	CLIP-seq
MIRT2052325	hsa-miR-1255b	CLIP-seq
MIRT2052326	hsa-miR-224	CLIP-seq
MIRT2052327	hsa-miR-3120-5p	CLIP-seq
MIRT2052328	hsa-miR-3150a-5p	CLIP-seq
MIRT2052329	hsa-miR-3150b-5p	CLIP-seq
MIRT2052330	hsa-miR-3182	CLIP-seq
MIRT2052331	hsa-miR-3184	CLIP-seq
MIRT2052332	hsa-miR-342-3p	CLIP-seq
MIRT2052333	hsa-miR-3607-3p	CLIP-seq
MIRT2052334	hsa-miR-3607-5p	CLIP-seq
MIRT2052335	hsa-miR-3651	CLIP-seq
MIRT2052336	hsa-miR-3686	CLIP-seq
MIRT2052337	hsa-miR-423-5p	CLIP-seq
MIRT2052338	hsa-miR-425	CLIP-seq
MIRT2052339	hsa-miR-4421	CLIP-seq
MIRT2052340	hsa-miR-4652-3p	CLIP-seq
MIRT2052341	hsa-miR-4769-3p	CLIP-seq
MIRT2052342	hsa-miR-490-3p	CLIP-seq
MIRT2052343	hsa-miR-555	CLIP-seq
MIRT2052344	hsa-miR-649	CLIP-seq
MIRT2281743	hsa-miR-1256	CLIP-seq
MIRT2281744	hsa-miR-125a-3p	CLIP-seq
MIRT2281745	hsa-miR-193a-3p	CLIP-seq
MIRT2281746	hsa-miR-193b	CLIP-seq
MIRT2281747	hsa-miR-198	CLIP-seq
MIRT2281748	hsa-miR-199a-3p	CLIP-seq
MIRT2281749	hsa-miR-199b-3p	CLIP-seq
MIRT2052327	hsa-miR-3120-5p	CLIP-seq
MIRT2281750	hsa-miR-3129-5p	CLIP-seq
MIRT2281751	hsa-miR-3137	CLIP-seq
MIRT2052330	hsa-miR-3182	CLIP-seq
MIRT2281752	hsa-miR-3189-5p	CLIP-seq
MIRT2281753	hsa-miR-338-5p	CLIP-seq
MIRT2052332	hsa-miR-342-3p	CLIP-seq
MIRT2052333	hsa-miR-3607-3p	CLIP-seq
MIRT2052336	hsa-miR-3686	CLIP-seq
MIRT2281754	hsa-miR-3934	CLIP-seq
MIRT2281755	hsa-miR-3943	CLIP-seq
MIRT2281756	hsa-miR-4289	CLIP-seq
MIRT2281757	hsa-miR-4323	CLIP-seq
MIRT2052339	hsa-miR-4421	CLIP-seq
MIRT2281758	hsa-miR-4436a	CLIP-seq
MIRT2281759	hsa-miR-4461	CLIP-seq
MIRT1180958	hsa-miR-4640-5p	CLIP-seq
MIRT2052340	hsa-miR-4652-3p	CLIP-seq
MIRT2281760	hsa-miR-4712-5p	CLIP-seq
MIRT2281761	hsa-miR-4720-5p	CLIP-seq
MIRT1180961	hsa-miR-4726-5p	CLIP-seq
MIRT2281762	hsa-miR-4799-3p	CLIP-seq
MIRT2052342	hsa-miR-490-3p	CLIP-seq
MIRT2281763	hsa-miR-491-3p	CLIP-seq
MIRT2281764	hsa-miR-520a-5p	CLIP-seq
MIRT2281765	hsa-miR-525-5p	CLIP-seq
MIRT2281766	hsa-miR-548g	CLIP-seq
MIRT2281767	hsa-miR-587	CLIP-seq
MIRT2052344	hsa-miR-649	CLIP-seq
MIRT2281768	hsa-miR-720	CLIP-seq
MIRT2281769	hsa-miR-764	CLIP-seq
MIRT2281770	hsa-miR-770-5p	CLIP-seq
MIRT2281771	hsa-miR-892b	CLIP-seq
MIRT2281772	hsa-miR-936	CLIP-seq
MIRT2391501	hsa-miR-1253	CLIP-seq
MIRT2052324	hsa-miR-1255a	CLIP-seq
MIRT2052325	hsa-miR-1255b	CLIP-seq
MIRT2391502	hsa-miR-2355-3p	CLIP-seq
MIRT2391503	hsa-miR-676	CLIP-seq
MIRT2052324	hsa-miR-1255a	CLIP-seq
MIRT2052325	hsa-miR-1255b	CLIP-seq
MIRT2281743	hsa-miR-1256	CLIP-seq
MIRT2579922	hsa-miR-2117	CLIP-seq
MIRT1180956	hsa-miR-3609	CLIP-seq
MIRT2579923	hsa-miR-4273	CLIP-seq
MIRT2579924	hsa-miR-4287	CLIP-seq
MIRT2281756	hsa-miR-4289	CLIP-seq
MIRT1180957	hsa-miR-4443	CLIP-seq
MIRT2281759	hsa-miR-4461	CLIP-seq
MIRT2579925	hsa-miR-4469	CLIP-seq
MIRT2579926	hsa-miR-4677-5p	CLIP-seq
MIRT2579927	hsa-miR-4685-3p	CLIP-seq
MIRT2579928	hsa-miR-4713-5p	CLIP-seq
MIRT2579929	hsa-miR-548ag	CLIP-seq
MIRT1180968	hsa-miR-548ah	CLIP-seq
MIRT2579930	hsa-miR-548ai	CLIP-seq
MIRT1180969	hsa-miR-548t	CLIP-seq
MIRT1180972	hsa-miR-765	CLIP-seq
MIRT1180973	hsa-miR-9	CLIP-seq
MIRT1180956	hsa-miR-3609	CLIP-seq
MIRT1180957	hsa-miR-4443	CLIP-seq
MIRT1180968	hsa-miR-548ah	CLIP-seq
MIRT1180969	hsa-miR-548t	CLIP-seq
MIRT1180972	hsa-miR-765	CLIP-seq
MIRT1180973	hsa-miR-9	CLIP-seq

Gene ontology (GO) Show/Hide all (37)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004308	Function	Exo-alpha-sialidase activity	IBA
GO:0004308	Function	Exo-alpha-sialidase activity	IDA	10861246, 11298736, 15847605, 17334392
GO:0004308	Function	Exo-alpha-sialidase activity	IEA
GO:0004308	Function	Exo-alpha-sialidase activity	ISS
GO:0004308	Function	Exo-alpha-sialidase activity	TAS
GO:0005515	Function	Protein binding	IPI	17334392
GO:0005737	Component	Cytoplasm	IBA
GO:0005764	Component	Lysosome	IBA
GO:0005764	Component	Lysosome	IEA
GO:0005765	Component	Lysosomal membrane	IDA	26251452
GO:0005765	Component	Lysosomal membrane	IEA
GO:0005768	Component	Endosome	IEA
GO:0005886	Component	Plasma membrane	IDA	12730204, 26251452
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005901	Component	Caveola	IEA
GO:0005975	Process	Carbohydrate metabolic process	IDA	12730204
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006689	Process	Ganglioside catabolic process	IBA
GO:0006689	Process	Ganglioside catabolic process	IDA	10861246, 11298736, 15847605, 17334392
GO:0006689	Process	Ganglioside catabolic process	IEA
GO:0009313	Process	Oligosaccharide catabolic process	IBA
GO:0009313	Process	Oligosaccharide catabolic process	IDA	10861246
GO:0009313	Process	Oligosaccharide catabolic process	IEA
GO:0016020	Component	Membrane	IBA
GO:0016020	Component	Membrane	IEA
GO:0016042	Process	Lipid catabolic process	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0016798	Function	Hydrolase activity, acting on glycosyl bonds	IEA
GO:0016997	Function	Alpha-sialidase activity	IDA	12730204
GO:0031901	Component	Early endosome membrane	IDA	26251452
GO:0031901	Component	Early endosome membrane	IEA
GO:0045742	Process	Positive regulation of epidermal growth factor receptor signaling pathway	IMP	17334392
GO:0046479	Process	Glycosphingolipid catabolic process	TAS
GO:0055038	Component	Recycling endosome membrane	IDA	26251452
GO:0055038	Component	Recycling endosome membrane	IEA
GO:1900186	Process	Negative regulation of clathrin-dependent endocytosis	IDA	26251452

Other IDs

• MIM: 604617
• HGNC: 7760
• e!Ensembl: ENSG00000162139

Protein

• UniProt ID: Q9UQ49
• Protein name: Sialidase-3 (EC 3.2.1.18) (Ganglioside sialidasedis) (Membrane sialidase) (N-acetyl-alpha-neuraminidase 3)
• Protein function: Exo-alpha-sialidase that catalyzes the hydrolytic cleavage of the terminal sialic acid (N-acetylneuraminic acid, Neu5Ac) of a glycan moiety in the catabolism of glycolipids, glycoproteins and oligosacharides. Displays high catalytic efficiency f
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13088	BNR_2	36 → 384	BNR repeat-like domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Highly expressed in skeletal muscle, testis, adrenal gland and thymus, followed by pancreas, liver, heart and thymus. Weakly expressed in kidney, placenta, brain and lung. {ECO:0000269|PubMed:10861246}.
• Sequence:

  MEEVTTCSFNSPLFRQEDDRGITYRIPALLYIPPTHTFLAFAEKRSTRRDEDALHLVLRR
  GLRIGQLVQWGPLKPLMEATLPGHRTMNPCPVWEQKSGCVFLFFICVRGHVTERQQIVSG
  RNAARLCFIYSQDAGCSWSEVRDLTEEVIGSELKHWATFAVGPGHGIQLQSGRLVIPAYT
  YYIPSWFFCFQLPCKTRPHSLMIYSDDLGVTWHHGRLIRPMVTVECEVAEVTGRAGHPVL
  YCSARTPNRCRAEALSTDHGEGFQRLALSRQLCEPPHGCQGSVVSFRPLEIPHRCQDSSS
  KDAPTIQQSSPGSSLRLEEEAGTPSESWLLYSHPTSRKQRVDLGIYLNQTPLEAACWSRP
  WILHCGPCGYSDLAALEEEGLFGCLFECGTKQECEQIAFRLFTHREILSHLQGDCTSPGR
  NPSQFKSN

• Sequence length: 428

Pathways

KEGG Pathway	Reactome Pathway
Other glycan degradation	Glycosphingolipid metabolism
Sphingolipid metabolism	Sialic acid metabolism
Metabolic pathways

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Marfanoid habitus and intellectual disability	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (43)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	19588508		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Clear Cell	Adenocarcinoma	BEFREE	17476974		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	19588508		★☆☆☆☆ Found in Text Mining only
Amnesia	Amnesia	BEFREE	28442549		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	30259272	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	18023981		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	16428383	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	23139422	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	29278877		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	19588508		★☆☆☆☆ Found in Text Mining only
Clear cell adenocarcinoma of ovary	Ovarian adenocarcinoma	BEFREE	17476974		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	12149448		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	12149448		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	12149448, 17270019, 21895867	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	29278877	Stimulate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	28038803		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	28760640, 30466783		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	28760640, 30466783		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	28038803	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	26470851	Stimulate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	29278877		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	21681193, 22093819		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	17334392, 18023981, 23139422, 29039925, 29278877, 30466783		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	12149448, 21895867		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	21895867		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	21895867	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	32102576	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	21681193, 25803810, 30466783		★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	30359429		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	11451961, 15179041, 9556610	Associate	★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	29088281		★☆☆☆☆ Found in Text Mining only
Ovarian adenocarcinoma	Ovarian adenocarcinoma	BEFREE	17476974		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	29278877		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	29278877	Stimulate	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	21681193, 22093819		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	31617733		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary fibrosis	Pubtator	32102576	Associate	★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	LHGDN	16428383		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	23139422		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	30913115		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	26470851	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	36172711	Stimulate	★☆☆☆☆ Found in Text Mining only
Tay-Sachs Disease	Tay-Sachs Disease	BEFREE	28442549, 28974375		★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

NEU4 4 shared pathwaysOther glycan degradation, Sphingolipid metabolism, Sialic acid metabolism, Glycosphingolipid metabolism Related via 4 shared pathways including Other glycan degradation, Sphingolipid metabolism. NEU2 4 shared pathwaysOther glycan degradation, Sphingolipid metabolism, Sialic acid metabolism, Glycosphingolipid metabolism Related via 4 shared pathways including Other glycan degradation, Sphingolipid metabolism. GBA2 3 shared pathwaysOther glycan degradation, Sphingolipid metabolism, Glycosphingolipid metabolism Related via 3 shared pathways including Other glycan degradation, Sphingolipid metabolism. NEU1 4 shared pathwaysOther glycan degradation, Sphingolipid metabolism, Sialic acid metabolism, Glycosphingolipid metabolism Related via 4 shared pathways including Other glycan degradation, Sphingolipid metabolism. GBA 3 shared pathwaysOther glycan degradation, Sphingolipid metabolism, Glycosphingolipid metabolism Related via 3 shared pathways including Other glycan degradation, Sphingolipid metabolism.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
NEU4	0	[]	4	["Other glycan degradation","Sphingolipid metabolism","Sialic acid metabolism","Glycosphingolipid metabolism"]	0	[]
NEU2	0	[]	4	["Other glycan degradation","Sphingolipid metabolism","Sialic acid metabolism","Glycosphingolipid metabolism"]	0	[]
GBA2	0	[]	3	["Other glycan degradation","Sphingolipid metabolism","Glycosphingolipid metabolism"]	0	[]
NEU1	0	[]	4	["Other glycan degradation","Sphingolipid metabolism","Sialic acid metabolism","Glycosphingolipid metabolism"]	0	[]
GBA	0	[]	3	["Other glycan degradation","Sphingolipid metabolism","Glycosphingolipid metabolism"]	0	[]

Diseases Linked via Similar Genes

Eczema Linked via 1 of 5 related genesNEU4 Narcolepsy Linked via 1 of 5 related genesNEU4 Cerebellar ataxia Linked via 1 of 5 related genesGBA2 Spastic paraplegia Linked via 1 of 5 related genesGBA2 Dilated cardiomyopathy Linked via 1 of 5 related genesGBA2

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Eczema	1	["NEU4"]
Narcolepsy	1	["NEU4"]
Cerebellar ataxia	1	["GBA2"]
Spastic paraplegia	1	["GBA2"]
Dilated cardiomyopathy	1	["GBA2"]