MRPL51 (mitochondrial ribosomal protein L51)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 51258
• Gene name: Mitochondrial ribosomal protein L51
• Gene symbol: MRPL51
• Synonyms (NCBI Gene): CDA09, HSPC241, MRP64, bMRP64, mL51
• Chromosome: 12
• Chromosome location: 12p13.31
• Summary: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% prot

miRNA Show/Hide all (150)

miRTarBase ID	miRNA	Experiments	Reference
MIRT051716	hsa-let-7d-5p	CLASH	23622248
MIRT050125	hsa-miR-26a-5p	CLASH	23622248
MIRT667351	hsa-miR-4524a-3p	HITS-CLIP	23824327
MIRT667350	hsa-miR-3934-3p	HITS-CLIP	23824327
MIRT667349	hsa-miR-6802-3p	HITS-CLIP	23824327
MIRT667348	hsa-miR-1178-3p	HITS-CLIP	23824327
MIRT504894	hsa-miR-3125	PAR-CLIP	20371350
MIRT504893	hsa-miR-3916	PAR-CLIP	20371350
MIRT504892	hsa-miR-6859-5p	PAR-CLIP	20371350
MIRT504891	hsa-miR-520g-5p	PAR-CLIP	20371350
MIRT504890	hsa-miR-570-3p	PAR-CLIP	20371350
MIRT504889	hsa-miR-1827	PAR-CLIP	20371350
MIRT504888	hsa-miR-103a-3p	PAR-CLIP	20371350
MIRT504887	hsa-miR-107	PAR-CLIP	20371350
MIRT504885	hsa-miR-877-5p	PAR-CLIP	20371350
MIRT504884	hsa-miR-6866-5p	PAR-CLIP	20371350
MIRT504881	hsa-miR-518d-5p	PAR-CLIP	20371350
MIRT504880	hsa-miR-518e-5p	PAR-CLIP	20371350
MIRT504879	hsa-miR-518f-5p	PAR-CLIP	20371350
MIRT504878	hsa-miR-519a-5p	PAR-CLIP	20371350
MIRT504877	hsa-miR-519b-5p	PAR-CLIP	20371350
MIRT504876	hsa-miR-519c-5p	PAR-CLIP	20371350
MIRT504875	hsa-miR-520c-5p	PAR-CLIP	20371350
MIRT504874	hsa-miR-522-5p	PAR-CLIP	20371350
MIRT504873	hsa-miR-523-5p	PAR-CLIP	20371350
MIRT504872	hsa-miR-526a	PAR-CLIP	20371350
MIRT504871	hsa-miR-6869-5p	PAR-CLIP	20371350
MIRT504894	hsa-miR-3125	PAR-CLIP	23446348
MIRT504893	hsa-miR-3916	PAR-CLIP	23446348
MIRT504892	hsa-miR-6859-5p	PAR-CLIP	23446348
MIRT504891	hsa-miR-520g-5p	PAR-CLIP	23446348
MIRT504890	hsa-miR-570-3p	PAR-CLIP	23446348
MIRT504889	hsa-miR-1827	PAR-CLIP	23446348
MIRT504888	hsa-miR-103a-3p	PAR-CLIP	23446348
MIRT504887	hsa-miR-107	PAR-CLIP	23446348
MIRT504886	hsa-miR-3618	PAR-CLIP	23446348
MIRT504885	hsa-miR-877-5p	PAR-CLIP	23446348
MIRT504884	hsa-miR-6866-5p	PAR-CLIP	23446348
MIRT504883	hsa-miR-376a-3p	PAR-CLIP	23446348
MIRT504882	hsa-miR-376b-3p	PAR-CLIP	23446348
MIRT504881	hsa-miR-518d-5p	PAR-CLIP	23446348
MIRT504880	hsa-miR-518e-5p	PAR-CLIP	23446348
MIRT504879	hsa-miR-518f-5p	PAR-CLIP	23446348
MIRT504878	hsa-miR-519a-5p	PAR-CLIP	23446348
MIRT504877	hsa-miR-519b-5p	PAR-CLIP	23446348
MIRT504876	hsa-miR-519c-5p	PAR-CLIP	23446348
MIRT504875	hsa-miR-520c-5p	PAR-CLIP	23446348
MIRT504874	hsa-miR-522-5p	PAR-CLIP	23446348
MIRT504873	hsa-miR-523-5p	PAR-CLIP	23446348
MIRT504872	hsa-miR-526a	PAR-CLIP	23446348
MIRT504871	hsa-miR-6869-5p	PAR-CLIP	23446348
MIRT667351	hsa-miR-4524a-3p	PAR-CLIP	27292025
MIRT667349	hsa-miR-6802-3p	PAR-CLIP	27292025
MIRT667351	hsa-miR-4524a-3p	HITS-CLIP	23824327
MIRT667350	hsa-miR-3934-3p	HITS-CLIP	23824327
MIRT667349	hsa-miR-6802-3p	HITS-CLIP	23824327
MIRT667348	hsa-miR-1178-3p	HITS-CLIP	23824327
MIRT504894	hsa-miR-3125	PAR-CLIP	20371350
MIRT504893	hsa-miR-3916	PAR-CLIP	20371350
MIRT504892	hsa-miR-6859-5p	PAR-CLIP	20371350
MIRT504891	hsa-miR-520g-5p	PAR-CLIP	20371350
MIRT504890	hsa-miR-570-3p	PAR-CLIP	20371350
MIRT504889	hsa-miR-1827	PAR-CLIP	20371350
MIRT504888	hsa-miR-103a-3p	PAR-CLIP	20371350
MIRT504887	hsa-miR-107	PAR-CLIP	20371350
MIRT504885	hsa-miR-877-5p	PAR-CLIP	20371350
MIRT504884	hsa-miR-6866-5p	PAR-CLIP	20371350
MIRT504881	hsa-miR-518d-5p	PAR-CLIP	20371350
MIRT504880	hsa-miR-518e-5p	PAR-CLIP	20371350
MIRT504879	hsa-miR-518f-5p	PAR-CLIP	20371350
MIRT504878	hsa-miR-519a-5p	PAR-CLIP	20371350
MIRT504877	hsa-miR-519b-5p	PAR-CLIP	20371350
MIRT504876	hsa-miR-519c-5p	PAR-CLIP	20371350
MIRT504875	hsa-miR-520c-5p	PAR-CLIP	20371350
MIRT504874	hsa-miR-522-5p	PAR-CLIP	20371350
MIRT504873	hsa-miR-523-5p	PAR-CLIP	20371350
MIRT504872	hsa-miR-526a	PAR-CLIP	20371350
MIRT504871	hsa-miR-6869-5p	PAR-CLIP	20371350
MIRT504894	hsa-miR-3125	PAR-CLIP	23446348
MIRT504893	hsa-miR-3916	PAR-CLIP	23446348
MIRT504892	hsa-miR-6859-5p	PAR-CLIP	23446348
MIRT504891	hsa-miR-520g-5p	PAR-CLIP	23446348
MIRT504890	hsa-miR-570-3p	PAR-CLIP	23446348
MIRT504889	hsa-miR-1827	PAR-CLIP	23446348
MIRT504888	hsa-miR-103a-3p	PAR-CLIP	23446348
MIRT504887	hsa-miR-107	PAR-CLIP	23446348
MIRT504886	hsa-miR-3618	PAR-CLIP	23446348
MIRT504885	hsa-miR-877-5p	PAR-CLIP	23446348
MIRT504884	hsa-miR-6866-5p	PAR-CLIP	23446348
MIRT504883	hsa-miR-376a-3p	PAR-CLIP	23446348
MIRT504882	hsa-miR-376b-3p	PAR-CLIP	23446348
MIRT504881	hsa-miR-518d-5p	PAR-CLIP	23446348
MIRT504880	hsa-miR-518e-5p	PAR-CLIP	23446348
MIRT504879	hsa-miR-518f-5p	PAR-CLIP	23446348
MIRT504878	hsa-miR-519a-5p	PAR-CLIP	23446348
MIRT504877	hsa-miR-519b-5p	PAR-CLIP	23446348
MIRT504876	hsa-miR-519c-5p	PAR-CLIP	23446348
MIRT504875	hsa-miR-520c-5p	PAR-CLIP	23446348
MIRT504874	hsa-miR-522-5p	PAR-CLIP	23446348
MIRT504873	hsa-miR-523-5p	PAR-CLIP	23446348
MIRT504872	hsa-miR-526a	PAR-CLIP	23446348
MIRT504871	hsa-miR-6869-5p	PAR-CLIP	23446348
MIRT1159553	hsa-miR-1245b-3p	CLIP-seq
MIRT1159554	hsa-miR-3925-3p	CLIP-seq
MIRT1159555	hsa-miR-4685-5p	CLIP-seq
MIRT1159556	hsa-miR-515-5p	CLIP-seq
MIRT1159557	hsa-miR-542-3p	CLIP-seq
MIRT1159558	hsa-miR-766	CLIP-seq
MIRT2045804	hsa-miR-1238	CLIP-seq
MIRT1159553	hsa-miR-1245b-3p	CLIP-seq
MIRT2045805	hsa-miR-204	CLIP-seq
MIRT2045806	hsa-miR-211	CLIP-seq
MIRT1159554	hsa-miR-3925-3p	CLIP-seq
MIRT2045807	hsa-miR-4446-5p	CLIP-seq
MIRT2045808	hsa-miR-4668-5p	CLIP-seq
MIRT2045809	hsa-miR-4671-5p	CLIP-seq
MIRT1159555	hsa-miR-4685-5p	CLIP-seq
MIRT2045810	hsa-miR-4755-5p	CLIP-seq
MIRT2045811	hsa-miR-513a-5p	CLIP-seq
MIRT1159556	hsa-miR-515-5p	CLIP-seq
MIRT2045812	hsa-miR-520d-5p	CLIP-seq
MIRT2045813	hsa-miR-524-5p	CLIP-seq
MIRT1159557	hsa-miR-542-3p	CLIP-seq
MIRT2045814	hsa-miR-548k	CLIP-seq
MIRT2045815	hsa-miR-582-5p	CLIP-seq
MIRT2045816	hsa-miR-623	CLIP-seq
MIRT1159558	hsa-miR-766	CLIP-seq
MIRT2045804	hsa-miR-1238	CLIP-seq
MIRT1159553	hsa-miR-1245b-3p	CLIP-seq
MIRT2045805	hsa-miR-204	CLIP-seq
MIRT2045806	hsa-miR-211	CLIP-seq
MIRT1159554	hsa-miR-3925-3p	CLIP-seq
MIRT2045807	hsa-miR-4446-5p	CLIP-seq
MIRT1159555	hsa-miR-4685-5p	CLIP-seq
MIRT2045810	hsa-miR-4755-5p	CLIP-seq
MIRT2045811	hsa-miR-513a-5p	CLIP-seq
MIRT1159556	hsa-miR-515-5p	CLIP-seq
MIRT2045812	hsa-miR-520d-5p	CLIP-seq
MIRT2045813	hsa-miR-524-5p	CLIP-seq
MIRT1159557	hsa-miR-542-3p	CLIP-seq
MIRT2045814	hsa-miR-548k	CLIP-seq
MIRT2045815	hsa-miR-582-5p	CLIP-seq
MIRT2045816	hsa-miR-623	CLIP-seq
MIRT1159558	hsa-miR-766	CLIP-seq
MIRT1159553	hsa-miR-1245b-3p	CLIP-seq
MIRT2573762	hsa-miR-3160-5p	CLIP-seq
MIRT2045809	hsa-miR-4671-5p	CLIP-seq
MIRT2573763	hsa-miR-4768-5p	CLIP-seq
MIRT1159553	hsa-miR-1245b-3p	CLIP-seq
MIRT2045809	hsa-miR-4671-5p	CLIP-seq

Gene ontology (GO) Show/Hide all (22)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003735	Function	Structural constituent of ribosome	IBA
GO:0003735	Function	Structural constituent of ribosome	IEA
GO:0003735	Function	Structural constituent of ribosome	ISS	11402041
GO:0005515	Function	Protein binding	IPI	20601428
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IDA	28892042
GO:0005739	Component	Mitochondrion	IEA
GO:0005743	Component	Mitochondrial inner membrane	NAS	27023846
GO:0005743	Component	Mitochondrial inner membrane	TAS
GO:0005761	Component	Mitochondrial ribosome	IDA	20601428
GO:0005761	Component	Mitochondrial ribosome	IEA
GO:0005762	Component	Mitochondrial large ribosomal subunit	IBA
GO:0005762	Component	Mitochondrial large ribosomal subunit	IDA	25278503, 28892042
GO:0005762	Component	Mitochondrial large ribosomal subunit	ISS
GO:0005762	Component	Mitochondrial large ribosomal subunit	NAS	25278503
GO:0005840	Component	Ribosome	IEA
GO:0006412	Process	Translation	IBA
GO:0006412	Process	Translation	IEA
GO:0006412	Process	Translation	ISS
GO:0032543	Process	Mitochondrial translation	ISS	11402041
GO:0032543	Process	Mitochondrial translation	NAS	27023846
GO:1990904	Component	Ribonucleoprotein complex	IEA

Other IDs

• MIM: 611855
• HGNC: 14044
• e!Ensembl: ENSG00000111639

Protein

• UniProt ID: Q4U2R6
• Protein name: Large ribosomal subunit protein mL51 (39S ribosomal protein L51, mitochondrial) (L51mt) (MRP-L51) (bMRP-64) (bMRP64)
• PDB: 3J7Y , 3J9M , 5OOL , 5OOM , 6I9R , 6NU2 , 6NU3 , 6VLZ , 6VMI , 6ZM5 , 6ZM6 , 6ZS9 , 6ZSA , 6ZSB , 6ZSC , 6ZSD , 6ZSE , 6ZSG , 7A5F , 7A5G , 7A5H , 7A5I , 7A5J , 7A5K , 7L08 , 7L20 , 7O9K , 7O9M , 7ODR , 7ODS , 7ODT , 7OF0 , 7OF2 , 7OF3 , 7OF4 , 7OF5 , 7OF6 , 7OF7 , 7OG4 , 7OI6 , 7OI7 , 7OI8 , 7OI9 , 7OIA , 7OIB , 7OIC , 7OID , 7OIE , 7PD3 , 7PO4 , 7QH6
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF10244	MRP-L51	38 → 126	Mitochondrial ribosomal subunit	Family

• Sequence:

  MAGNLLSGAGRRLWDWVPLACRSFSLGVPRLIGIRLTLPPPKVVDRWNEKRAMFGVYDNI
  GILGNFEKHPKELIRGPIWLRGWKGNELQRCIRKRKMVGSRMFADDLHNLNKRIRYLYKH
  FNRHGKFR

• Sequence length: 128

Pathways

Reactome Pathway

Mitochondrial translation elongation

Mitochondrial translation termination

Related Genes

Sort by: Blended Diseases Pathways Evidence source

MRPS31 2 shared pathwaysMitochondrial translation elongation, Mitochondrial translation termination Related via 2 shared pathways including Mitochondrial translation elongation, Mitochondrial translation termination. MRPS30 2 shared pathwaysMitochondrial translation elongation, Mitochondrial translation termination Related via 2 shared pathways including Mitochondrial translation elongation, Mitochondrial translation termination. MRPL53 2 shared pathwaysMitochondrial translation elongation, Mitochondrial translation termination Related via 2 shared pathways including Mitochondrial translation elongation, Mitochondrial translation termination. MRPL54 2 shared pathwaysMitochondrial translation elongation, Mitochondrial translation termination Related via 2 shared pathways including Mitochondrial translation elongation, Mitochondrial translation termination. CHCHD1 2 shared pathwaysMitochondrial translation elongation, Mitochondrial translation termination Related via 2 shared pathways including Mitochondrial translation elongation, Mitochondrial translation termination.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
MRPS31	0	[]	2	["Mitochondrial translation elongation","Mitochondrial translation termination"]	0	[]
MRPS30	0	[]	2	["Mitochondrial translation elongation","Mitochondrial translation termination"]	0	[]
MRPL53	0	[]	2	["Mitochondrial translation elongation","Mitochondrial translation termination"]	0	[]
MRPL54	0	[]	2	["Mitochondrial translation elongation","Mitochondrial translation termination"]	0	[]
CHCHD1	0	[]	2	["Mitochondrial translation elongation","Mitochondrial translation termination"]	0	[]

Diseases Linked via Similar Genes

Myeloproliferative disorder Linked via 1 of 5 related genesMRPS31 Alzheimer disease Linked via 1 of 5 related genesMRPS30 Anorexia nervosa Linked via 1 of 5 related genesMRPS30 Attention deficit hyperactivity disorder Linked via 1 of 5 related genesMRPS30 Breast cancer Linked via 1 of 5 related genesMRPS30

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Myeloproliferative disorder	1	["MRPS31"]
Alzheimer disease	1	["MRPS30"]
Anorexia nervosa	1	["MRPS30"]
Attention deficit hyperactivity disorder	1	["MRPS30"]
Breast cancer	1	["MRPS30"]