Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	116540
Gene name	Mitochondrial ribosomal protein L53
Gene symbol	MRPL53
Synonyms (NCBI Gene)	L53MTmL53
Chromosome	2
Chromosome location	2p13.1
Summary	Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% prot

22 Show/Hide all (22)

miRTarBase ID	miRNA	Experiments	Reference
MIRT050764	hsa-miR-17-3p	CLASH	23622248
MIRT040558	hsa-miR-92b-3p	CLASH	23622248
MIRT1159580	hsa-miR-1245	CLIP-seq
MIRT1159581	hsa-miR-3942-3p	CLIP-seq
MIRT1159582	hsa-miR-450a	CLIP-seq
MIRT1159583	hsa-miR-4725-5p	CLIP-seq
MIRT1159584	hsa-miR-504	CLIP-seq
MIRT1159580	hsa-miR-1245	CLIP-seq
MIRT2045820	hsa-miR-154	CLIP-seq
MIRT2045821	hsa-miR-3605-3p	CLIP-seq
MIRT1159581	hsa-miR-3942-3p	CLIP-seq
MIRT1159582	hsa-miR-450a	CLIP-seq
MIRT1159583	hsa-miR-4725-5p	CLIP-seq
MIRT1159584	hsa-miR-504	CLIP-seq
MIRT2045822	hsa-miR-595	CLIP-seq
MIRT2045823	hsa-miR-676	CLIP-seq
MIRT2045820	hsa-miR-154	CLIP-seq
MIRT2573772	hsa-miR-4738-3p	CLIP-seq
MIRT2573773	hsa-miR-4778-3p	CLIP-seq
MIRT2573774	hsa-miR-554	CLIP-seq
MIRT2045822	hsa-miR-595	CLIP-seq
MIRT2045823	hsa-miR-676	CLIP-seq

13 Show/Hide all (13)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	25416956, 32296183, 35271311
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IDA	28892042
GO:0005739	Component	Mitochondrion	IEA
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005743	Component	Mitochondrial inner membrane	NAS	27023846
GO:0005743	Component	Mitochondrial inner membrane	TAS
GO:0005762	Component	Mitochondrial large ribosomal subunit	IBA
GO:0005762	Component	Mitochondrial large ribosomal subunit	IDA	25278503, 28892042
GO:0005762	Component	Mitochondrial large ribosomal subunit	NAS	25278503
GO:0005840	Component	Ribosome	IEA
GO:0032543	Process	Mitochondrial translation	NAS	27023846
GO:1990904	Component	Ribonucleoprotein complex	IEA

MIM	HGNC	e!Ensembl
611857	16684	ENSG00000204822

Q96EL3

Protein name

Large ribosomal subunit protein mL53 (39S ribosomal protein L53, mitochondrial) (L53mt) (MRP-L53)

PDB

3J7Y , 3J9M , 5OOL , 5OOM , 6I9R , 6NU2 , 6NU3 , 6VLZ , 6VMI , 6ZM5 , 6ZM6 , 6ZS9 , 6ZSA , 6ZSB , 6ZSC , 6ZSD , 6ZSE , 6ZSG , 7A5F , 7A5G , 7A5H , 7A5I , 7A5J , 7A5K , 7L08 , 7L20 , 7O9K , 7O9M , 7ODR , 7ODS , 7ODT , 7OF0 , 7OF2 , 7OF3 , 7OF4 , 7OF5 , 7OF6 , 7OF7 , 7OG4 , 7OI6 , 7OI7 , 7OI8 , 7OI9 , 7OIA , 7OIB , 7OIC , 7OID , 7OIE , 7PD3 , 7PO4 , 7QI4

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF10780	MRP_L53	20 → 71	39S ribosomal protein L53/MRP-L53	Family

Sequence

MAAALARLGLRPVKQVRVQFCPFEKNVESTRTFLQTVSSEKVRSTNLNCSVIADVRHDGS
EPCVDVLFGDGHRLIMRGAHLTALEMLTAFASHIRARDAAGSGDKPGADTGR

Sequence length

112

Interactions

View interactions

Reactome Pathway
Mitochondrial translation elongation
Mitochondrial translation termination

MRPL53 (mitochondrial ribosomal protein L53)

Bookmark This Gene