MRPL47 (mitochondrial ribosomal protein L47)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 57129
Gene name Mitochondrial ribosomal protein L47
Gene symbol MRPL47
Synonyms (NCBI Gene)
CGI-204L47mtMRP-L47NCM1uL29m
Chromosome 3
Chromosome location 3q26.33
Summary Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% prot
miRNA miRNA information provided by mirtarbase database.
2
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT032272 hsa-let-7b-5p Proteomics 18668040
MIRT2045751 hsa-miR-4803 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
16 Show/Hide all (16)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0003735 Function Structural constituent of ribosome IBA
GO:0003735 Function Structural constituent of ribosome IEA
GO:0005739 Component Mitochondrion HTP 34800366
GO:0005739 Component Mitochondrion IDA 28892042
GO:0005739 Component Mitochondrion IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
611852 16652 ENSG00000136522
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9HD33
Protein name Large ribosomal subunit protein uL29m (39S ribosomal protein L47, mitochondrial) (L47mt) (MRP-L47) (Nasopharyngeal carcinoma metastasis-related protein 1)
PDB 3J7Y , 3J9M , 5OOL , 5OOM , 6I9R , 6NU2 , 6NU3 , 6VLZ , 6VMI , 6ZM5 , 6ZM6 , 6ZS9 , 6ZSA , 6ZSB , 6ZSC , 6ZSD , 6ZSE , 6ZSG , 7A5F , 7A5G , 7A5H , 7A5I , 7A5J , 7A5K , 7L08 , 7L20 , 7O9K , 7O9M , 7ODR , 7ODS , 7ODT , 7OF0 , 7OF2 , 7OF3 , 7OF4 , 7OF5 , 7OF6 , 7OF7 , 7OG4 , 7OI6 , 7OI7 , 7OI8 , 7OI9 , 7OIA , 7OIB , 7OIC , 7OID , 7OIE , 7PD3 , 7PO4 , 7QH6
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF06984 MRP-L47 64 → 149 Mitochondrial 39-S ribosomal protein L47 (MRP-L47) Family
Sequence 
MAAAGLALLCRRVSSALKSSRSLITPQVPACTGFFLSLLPKSTPNVTSFHQYRLLHTTLS
RKGLEEFFDDPKNWGQEKVKSGAAWTCQQLRNKSNEDLHKLWYVLLKERNMLLTLEQEAK
RQRLPMPSPERLDKVVDSMDALDKVVQEREDALRLLQTGQERARPGAWRRDIFGRIIWHK
FKQWVIPWHLNKRYNRKRFFALPYVDHFLRLEREKRARIKARKENLERKKAKILLKKFPH
LAEAQKSSLV
Sequence length 250
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
Reactome Pathway
Mitochondrial translation elongation
Mitochondrial translation termination
Sort by:
MRPS31 2 shared pathwaysMitochondrial translation elongation, Mitochondrial translation termination Related via 2 shared pathways including Mitochondrial translation elongation, Mitochondrial translation termination. MRPS30 2 shared pathwaysMitochondrial translation elongation, Mitochondrial translation termination Related via 2 shared pathways including Mitochondrial translation elongation, Mitochondrial translation termination. MRPL53 2 shared pathwaysMitochondrial translation elongation, Mitochondrial translation termination Related via 2 shared pathways including Mitochondrial translation elongation, Mitochondrial translation termination. MRPL54 2 shared pathwaysMitochondrial translation elongation, Mitochondrial translation termination Related via 2 shared pathways including Mitochondrial translation elongation, Mitochondrial translation termination. CHCHD1 2 shared pathwaysMitochondrial translation elongation, Mitochondrial translation termination Related via 2 shared pathways including Mitochondrial translation elongation, Mitochondrial translation termination.
Myeloproliferative disorder Linked via 1 of 5 related genesMRPS31 Alzheimer disease Linked via 1 of 5 related genesMRPS30 Anorexia nervosa Linked via 1 of 5 related genesMRPS30 Attention deficit hyperactivity disorder Linked via 1 of 5 related genesMRPS30 Breast cancer Linked via 1 of 5 related genesMRPS30