Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	84545
Gene name	Mitochondrial ribosomal protein L43
Gene symbol	MRPL43
Synonyms (NCBI Gene)	L43mtMRP-L43bMRP36amL43
Chromosome	10
Chromosome location	10q24.31
Summary	Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% prot

48 Show/Hide all (48)

miRTarBase ID	miRNA	Experiments	Reference
MIRT024695	hsa-miR-215-5p	Microarray	19074876
MIRT026434	hsa-miR-192-5p	Microarray	19074876
MIRT440214	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT440214	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT1159378	hsa-miR-1245b-3p	CLIP-seq
MIRT1159379	hsa-miR-125a-3p	CLIP-seq
MIRT1159380	hsa-miR-2116	CLIP-seq
MIRT1159381	hsa-miR-2355-5p	CLIP-seq
MIRT1159382	hsa-miR-24	CLIP-seq
MIRT1159383	hsa-miR-376a	CLIP-seq
MIRT1159384	hsa-miR-376b	CLIP-seq
MIRT1159385	hsa-miR-4330	CLIP-seq
MIRT1159386	hsa-miR-4677-5p	CLIP-seq
MIRT1159387	hsa-miR-4726-3p	CLIP-seq
MIRT1159388	hsa-miR-4792	CLIP-seq
MIRT1159389	hsa-miR-577	CLIP-seq
MIRT1159390	hsa-miR-605	CLIP-seq
MIRT2045717	hsa-miR-1208	CLIP-seq
MIRT2045718	hsa-miR-140-5p	CLIP-seq
MIRT2045719	hsa-miR-153	CLIP-seq
MIRT2045720	hsa-miR-2052	CLIP-seq
MIRT2045721	hsa-miR-2909	CLIP-seq
MIRT2045722	hsa-miR-3162-5p	CLIP-seq
MIRT2045723	hsa-miR-3194-5p	CLIP-seq
MIRT2045724	hsa-miR-3614-3p	CLIP-seq
MIRT2045725	hsa-miR-3662	CLIP-seq
MIRT2045726	hsa-miR-4252	CLIP-seq
MIRT2045727	hsa-miR-4457	CLIP-seq
MIRT2045728	hsa-miR-448	CLIP-seq
MIRT2045729	hsa-miR-4481	CLIP-seq
MIRT2045730	hsa-miR-4528	CLIP-seq
MIRT2045731	hsa-miR-4745-5p	CLIP-seq
MIRT2045732	hsa-miR-4758-5p	CLIP-seq
MIRT2045733	hsa-miR-4786-3p	CLIP-seq
MIRT2045734	hsa-miR-4795-3p	CLIP-seq
MIRT2045735	hsa-miR-513b	CLIP-seq
MIRT2045736	hsa-miR-548c-3p	CLIP-seq
MIRT2045737	hsa-miR-624	CLIP-seq
MIRT2045738	hsa-miR-892a	CLIP-seq
MIRT2274696	hsa-miR-4266	CLIP-seq
MIRT2274697	hsa-miR-4695-5p	CLIP-seq
MIRT2274698	hsa-miR-4779	CLIP-seq
MIRT2431262	hsa-miR-4652-5p	CLIP-seq
MIRT2454473	hsa-miR-3126-5p	CLIP-seq
MIRT2454474	hsa-miR-3153	CLIP-seq
MIRT2454475	hsa-miR-4419a	CLIP-seq
MIRT2454476	hsa-miR-4510	CLIP-seq
MIRT2454477	hsa-miR-759	CLIP-seq

20 Show/Hide all (20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003723	Function	RNA binding	HDA	22658674
GO:0003735	Function	Structural constituent of ribosome	IBA
GO:0003735	Function	Structural constituent of ribosome	IEA
GO:0003735	Function	Structural constituent of ribosome	NAS	11543634
GO:0005515	Function	Protein binding	IPI	25416956, 32814053
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IDA	28892042
GO:0005739	Component	Mitochondrion	IEA
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005743	Component	Mitochondrial inner membrane	NAS	27023846
GO:0005743	Component	Mitochondrial inner membrane	TAS
GO:0005761	Component	Mitochondrial ribosome	NAS	11543634
GO:0005762	Component	Mitochondrial large ribosomal subunit	IBA
GO:0005762	Component	Mitochondrial large ribosomal subunit	IDA	25278503, 28892042
GO:0005762	Component	Mitochondrial large ribosomal subunit	NAS	25278503
GO:0005840	Component	Ribosome	IEA
GO:0006412	Process	Translation	NAS	11543634
GO:0032543	Process	Mitochondrial translation	IEA
GO:0032543	Process	Mitochondrial translation	NAS	27023846
GO:1990904	Component	Ribonucleoprotein complex	IEA

MIM	HGNC	e!Ensembl
611848	14517	ENSG00000055950

Q8N983

Protein name

Large ribosomal subunit protein mL43 (39S ribosomal protein L43, mitochondrial) (L43mt) (MRP-L43) (Mitochondrial ribosomal protein bMRP36a)

PDB

3J7Y , 3J9M , 5OOL , 5OOM , 6I9R , 6NU2 , 6NU3 , 6VLZ , 6VMI , 6ZM5 , 6ZM6 , 6ZS9 , 6ZSA , 6ZSB , 6ZSC , 6ZSD , 6ZSE , 6ZSG , 7A5F , 7A5G , 7A5H , 7A5I , 7A5J , 7A5K , 7L08 , 7L20 , 7O9K , 7O9M , 7ODR , 7ODS , 7ODT , 7OF0 , 7OF2 , 7OF3 , 7OF4 , 7OF5 , 7OF6 , 7OF7 , 7OG4 , 7OI6 , 7OI7 , 7OI8 , 7OI9 , 7OIA , 7OIB , 7OIC , 7OID , 7OIE , 7PD3 , 7PO4 , 7QH6

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF05047	L51_S25_CI-B8	43 → 95	Mitochondrial ribosomal protein L51 / S25 / CI-B8 domain	Domain

Tissue specificity

TISSUE SPECIFICITY: High relative levels in skeletal muscle and testis. Lower levels of expression in the heart, brain, placenta, lung, liver, kidney, pancreas, spleen, thymus, prostate, ovary, small intestine, colon and leukocytes. Expression is coregula

Sequence

MTARGTPSRFLASVLHNGLGRYVQQLQRLSFSVSRDGASSRGAREFVEREVIDFARRNPG
VVIYVNSRPCCVPRVVAEYLNGAVREESIHCKSVEEISTLVQKLADQSGLDVIRIRKPFH
TDNPSIQGQWHPFTNKPTTFRGLRPREVQDPAPAQDTGLRLSAVAPQILLPGWPDPPDLP
TVDPISSSLTSAPAPMLSAVSCLPIVPALTTVCSA

Sequence length

215

Interactions

View interactions

Reactome Pathway
Mitochondrial translation elongation
Mitochondrial translation termination

MRPL43 (mitochondrial ribosomal protein L43)

Bookmark This Gene