MOV10 (Mov10 RNA helicase)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 4343
• Gene name: Mov10 RNA helicase
• Gene symbol: MOV10
• Synonyms (NCBI Gene): fSAP113, gb110
• Chromosome: 1
• Chromosome location: 1p13.2

miRNA Show/Hide all (108)

miRTarBase ID	miRNA	Experiments	Reference
MIRT001356	hsa-miR-1-3p	pSILAC	18668040
MIRT020999	hsa-miR-155-5p	Proteomics	18668040
MIRT023156	hsa-miR-124-3p	Microarray	18668037
MIRT001356	hsa-miR-1-3p	Proteomics;Microarray	18668037
MIRT001356	hsa-miR-1-3p	Proteomics	18668040
MIRT025576	hsa-miR-34a-5p	Sequencing	20371350
MIRT032076	hsa-miR-16-5p	Proteomics	18668040
MIRT032076	hsa-miR-16-5p	Sequencing	20371350
MIRT052355	hsa-let-7b-5p	CLASH	23622248
MIRT040443	hsa-miR-615-3p	CLASH	23622248
MIRT040443	hsa-miR-615-3p	CLASH	23622248
MIRT1155859	hsa-miR-1207-3p	CLIP-seq
MIRT1155860	hsa-miR-15a	CLIP-seq
MIRT1155861	hsa-miR-15b	CLIP-seq
MIRT1155862	hsa-miR-16	CLIP-seq
MIRT1155863	hsa-miR-195	CLIP-seq
MIRT1155864	hsa-miR-3127-3p	CLIP-seq
MIRT1155865	hsa-miR-3184	CLIP-seq
MIRT1155866	hsa-miR-361-3p	CLIP-seq
MIRT1155867	hsa-miR-3667-3p	CLIP-seq
MIRT1155868	hsa-miR-3679-3p	CLIP-seq
MIRT1155869	hsa-miR-3942-3p	CLIP-seq
MIRT1155870	hsa-miR-423-5p	CLIP-seq
MIRT1155871	hsa-miR-424	CLIP-seq
MIRT1155872	hsa-miR-432	CLIP-seq
MIRT1155873	hsa-miR-4443	CLIP-seq
MIRT1155874	hsa-miR-4524	CLIP-seq
MIRT1155875	hsa-miR-4659a-3p	CLIP-seq
MIRT1155876	hsa-miR-4659b-3p	CLIP-seq
MIRT1155877	hsa-miR-4688	CLIP-seq
MIRT1155878	hsa-miR-4780	CLIP-seq
MIRT1155879	hsa-miR-486-3p	CLIP-seq
MIRT1155880	hsa-miR-497	CLIP-seq
MIRT1155881	hsa-miR-503	CLIP-seq
MIRT1155882	hsa-miR-592	CLIP-seq
MIRT1155883	hsa-miR-597	CLIP-seq
MIRT1155884	hsa-miR-616	CLIP-seq
MIRT1155885	hsa-miR-623	CLIP-seq
MIRT1155886	hsa-miR-646	CLIP-seq
MIRT1155887	hsa-miR-759	CLIP-seq
MIRT1155859	hsa-miR-1207-3p	CLIP-seq
MIRT1155865	hsa-miR-3184	CLIP-seq
MIRT1155870	hsa-miR-423-5p	CLIP-seq
MIRT1155872	hsa-miR-432	CLIP-seq
MIRT1155873	hsa-miR-4443	CLIP-seq
MIRT1155877	hsa-miR-4688	CLIP-seq
MIRT1155878	hsa-miR-4780	CLIP-seq
MIRT1155879	hsa-miR-486-3p	CLIP-seq
MIRT1155885	hsa-miR-623	CLIP-seq
MIRT2273764	hsa-miR-1	CLIP-seq
MIRT2273765	hsa-miR-135a	CLIP-seq
MIRT2273766	hsa-miR-135b	CLIP-seq
MIRT2273767	hsa-miR-1470	CLIP-seq
MIRT1155860	hsa-miR-15a	CLIP-seq
MIRT1155861	hsa-miR-15b	CLIP-seq
MIRT1155862	hsa-miR-16	CLIP-seq
MIRT2273768	hsa-miR-1909	CLIP-seq
MIRT1155863	hsa-miR-195	CLIP-seq
MIRT2273769	hsa-miR-206	CLIP-seq
MIRT2273770	hsa-miR-214	CLIP-seq
MIRT2273771	hsa-miR-2355-5p	CLIP-seq
MIRT2273772	hsa-miR-30a	CLIP-seq
MIRT2273773	hsa-miR-30b	CLIP-seq
MIRT2273774	hsa-miR-30c	CLIP-seq
MIRT2273775	hsa-miR-30d	CLIP-seq
MIRT2273776	hsa-miR-30e	CLIP-seq
MIRT1155864	hsa-miR-3127-3p	CLIP-seq
MIRT1155866	hsa-miR-361-3p	CLIP-seq
MIRT2273777	hsa-miR-3614-3p	CLIP-seq
MIRT2273778	hsa-miR-3619-5p	CLIP-seq
MIRT1155867	hsa-miR-3667-3p	CLIP-seq
MIRT2273779	hsa-miR-3673	CLIP-seq
MIRT1155868	hsa-miR-3679-3p	CLIP-seq
MIRT2273780	hsa-miR-3940-5p	CLIP-seq
MIRT1155869	hsa-miR-3942-3p	CLIP-seq
MIRT1155871	hsa-miR-424	CLIP-seq
MIRT2273781	hsa-miR-4297	CLIP-seq
MIRT2273782	hsa-miR-4421	CLIP-seq
MIRT2273783	hsa-miR-4469	CLIP-seq
MIRT2273784	hsa-miR-4507	CLIP-seq
MIRT1155874	hsa-miR-4524	CLIP-seq
MIRT2273785	hsa-miR-4530	CLIP-seq
MIRT2273786	hsa-miR-4651	CLIP-seq
MIRT1155875	hsa-miR-4659a-3p	CLIP-seq
MIRT1155876	hsa-miR-4659b-3p	CLIP-seq
MIRT2273787	hsa-miR-4667-3p	CLIP-seq
MIRT2273788	hsa-miR-4713-5p	CLIP-seq
MIRT2273789	hsa-miR-4728-5p	CLIP-seq
MIRT1155878	hsa-miR-4780	CLIP-seq
MIRT1155880	hsa-miR-497	CLIP-seq
MIRT1155881	hsa-miR-503	CLIP-seq
MIRT1155882	hsa-miR-592	CLIP-seq
MIRT1155883	hsa-miR-597	CLIP-seq
MIRT2273790	hsa-miR-608	CLIP-seq
MIRT2273791	hsa-miR-613	CLIP-seq
MIRT1155884	hsa-miR-616	CLIP-seq
MIRT1155885	hsa-miR-623	CLIP-seq
MIRT1155886	hsa-miR-646	CLIP-seq
MIRT1155887	hsa-miR-759	CLIP-seq
MIRT2273792	hsa-miR-761	CLIP-seq
MIRT2273768	hsa-miR-1909	CLIP-seq
MIRT2273770	hsa-miR-214	CLIP-seq
MIRT2273771	hsa-miR-2355-5p	CLIP-seq
MIRT2273778	hsa-miR-3619-5p	CLIP-seq
MIRT2273785	hsa-miR-4530	CLIP-seq
MIRT2273788	hsa-miR-4713-5p	CLIP-seq
MIRT2273789	hsa-miR-4728-5p	CLIP-seq
MIRT2273792	hsa-miR-761	CLIP-seq

Gene ontology (GO) Show/Hide all (38)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000932	Component	P-body	IDA	16289642, 24726324, 27974568
GO:0000932	Component	P-body	IEA
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0003723	Function	RNA binding	IBA
GO:0003723	Function	RNA binding	IDA	23093941, 24726324
GO:0003723	Function	RNA binding	IEA
GO:0003724	Function	RNA helicase activity	IEA
GO:0004386	Function	Helicase activity	IEA
GO:0005515	Function	Protein binding	IPI	16289642, 17507929, 18552826, 20543829, 21282530, 21903422, 23093941, 23125361, 24726324, 25220460, 25464849, 27974568, 30122351, 32353859, 32707033, 33060197, 33961781, 34029587, 34316702, 34517762, 34578187, 35107372, 35271311, 35709258, 36217030
GO:0005524	Function	ATP binding	IEA
GO:0005615	Component	Extracellular space	HDA	22664934
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0010494	Component	Cytoplasmic stress granule	IEA
GO:0010526	Process	Transposable element silencing	IDA	23093941
GO:0010526	Process	Transposable element silencing	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0016887	Function	ATP hydrolysis activity	IEA
GO:0031047	Process	Regulatory ncRNA-mediated gene silencing	IEA
GO:0032574	Function	5'-3' RNA helicase activity	IDA	24726324
GO:0032574	Function	5'-3' RNA helicase activity	IEA
GO:0035194	Process	Regulatory ncRNA-mediated post-transcriptional gene silencing	IBA
GO:0035195	Process	MiRNA-mediated post-transcriptional gene silencing	IMP	17507929
GO:0035279	Process	MiRNA-mediated gene silencing by mRNA destabilization	IDA	16289642
GO:0036464	Component	Cytoplasmic ribonucleoprotein granule	IDA	30122351
GO:0036464	Component	Cytoplasmic ribonucleoprotein granule	IEA
GO:0043186	Component	P granule	IBA
GO:0051607	Process	Defense response to virus	IMP	27974568
GO:0061014	Process	Positive regulation of mRNA catabolic process	IDA	24726324
GO:0061158	Process	3'-UTR-mediated mRNA destabilization	IDA	24726324
GO:0141008	Process	Transposable element silencing by mRNA destabilization	IDA	30122351
GO:0150011	Process	Regulation of neuron projection arborization	ISS

Other IDs

• MIM: 610742
• HGNC: 7200
• e!Ensembl: ENSG00000155363

Protein

• UniProt ID: Q9HCE1
• Protein name: Helicase MOV-10 (EC 3.6.4.13) (Armitage homolog) (Moloney leukemia virus 10 protein)
• Protein function: 5' to 3' RNA helicase that is involved in a number of cellular roles ranging from mRNA metabolism and translation, modulation of viral infectivity, inhibition of retrotransposition, or regulation of synaptic transmission (PubMed:23093941). Plays
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13087	AAA_12	698 → 923	AAA domain	Domain
  PF13604	AAA_30	498 → 696		Domain

• Sequence:

  MPSKFSCRQLREAGQCFESFLVVRGLDMETDRERLRTIYNRDFKISFGTPAPGFSSMLYG
  MKIANLAYVTKTRVRFFRLDRWADVRFPEKRRMKLGSDISKHHKSLLAKIFYDRAEYLHG
  KHGVDVEVQGPHEARDGQLLIRLDLNRKEVLTLRLRNGGTQSVTLTHLFPLCRTPQFAFY
  NEDQELPCPLGPGECYELHVHCKTSFVGYFPATVLWELLGPGESGSEGAGTFYIARFLAA
  VAHSPLAAQLKPMTPFKRTRITGNPVVTNRIEEGERPDRAKGYDLELSMALGTYYPPPRL
  RQLLPMLLQGTSIFTAPKEIAEIKAQLETALKWRNYEVKLRLLLHLEELQMEHDIRHYDL
  ESVPMTWDPVDQNPRLLTLEVPGVTESRPSVLRGDHLFALLSSETHQEDPITYKGFVHKV
  ELDRVKLSFSMSLLSRFVDGLTFKVNFTFNRQPLRVQHRALELTGRWLLWPMLFPVAPRD
  VPLLPSDVKLKLYDRSLESNPEQLQAMRHIVTGTTRPAPYIIFGPPGTGKTVTLVEAIKQ
  VVKHLPKAHILACAPSNSGADLLCQRLRVHLPSSIYRLLAPSRDIRMVPEDIKPCCNWDA
  KKGEYVFPAKKKLQEYRVLITTLITAGRLVSAQFPIDHFTHIFIDEAGHCMEPESLVAIA
  GLMEVKETGDPGGQLVLAGDPRQLGPVLRSPLTQKHGLGYSLLERLLTYNSLYKKGPDGY
  DPQFITKLLRNYRSHPTILDIPNQLYYEGELQACADVVDRERFCRWAGLPRQGFPIIFHG
  VMGKDEREGNSPSFFNPEEAATVTSYLKLLLAPSSKKGKARLSPRSVGVISPYRKQVEKI
  RYCITKLDRELRGLDDIKDLKVGSVEEFQGQERSVILISTVRSSQSFVQLDLDFNLGFLK
  NPKRFNVAVTRAKALLIIVGNPLLLGHDPDWKVFLEFCKENGGYTGCPFPAKLDLQQGQN
  LLQGLSKLSPSTSGPHSHDYLPQEREGEGGLSLQVEPEWRNEL

• Sequence length: 1003

Pathways

Reactome Pathway

Pre-NOTCH Transcription and Translation

Oxidative Stress Induced Senescence

Oncogene Induced Senescence

Ca2+ pathway

TP53 Regulates Metabolic Genes

MAPK6/MAPK4 signaling

Transcriptional Regulation by VENTX

Regulation of RUNX1 Expression and Activity

RUNX1 regulates genes involved in megakaryocyte differentiation and platelet function

Regulation of PTEN mRNA translation

Competing endogenous RNAs (ceRNAs) regulate PTEN translation

Transcriptional Regulation by MECP2

Estrogen-dependent gene expression

NR1H3 & NR1H2 regulate gene expression linked to cholesterol transport and efflux

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (8)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
HYPERTENSION	—	GWAS catalog	21909115, 30487518, 36187959	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOV10-related disorder	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OPEN-ANGLE GLAUCOMA	—	GWAS catalog	33627673, 37386247, 38382466	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN FAILURE, PREMATURE	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Premature ovarian failure	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (11)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	29315404	Inhibit	★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	28662698		★☆☆☆☆ Found in Text Mining only
Complete atrioventricular block	Complete Atrioventricular Block	BEFREE	24871977		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	30621721		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	GWASCAT_DG	21909115, 30487518		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	GWASDB_DG	21909115		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	BEFREE	24338417		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	20215113		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	20215113		★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	28662698		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	31693728	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

TNRC6B 14 shared pathwaysTP53 Regulates Metabolic Genes, Pre-NOTCH Transcription and Translation, Oxidative Stress Induced Senescence, NR1H3 & NR1H2 regulate gene expression linked to cholesterol transport and efflux, Oncogene Induced Senescence, MAPK6/MAPK4 signaling, Regulation of RUNX1 Expression and Activity, Estrogen-dependent gene expression, RUNX1 regulates genes involved in megakaryocyte differentiation and platelet function, Transcriptional Regulation by VENTX, Ca2+ pathway, Regulation of PTEN mRNA translation +2 more Related via 14 shared pathways including TP53 Regulates Metabolic Genes, Pre-NOTCH Transcription and Translation. TNRC6C 14 shared pathwaysTP53 Regulates Metabolic Genes, Pre-NOTCH Transcription and Translation, Oxidative Stress Induced Senescence, NR1H3 & NR1H2 regulate gene expression linked to cholesterol transport and efflux, Oncogene Induced Senescence, MAPK6/MAPK4 signaling, Regulation of RUNX1 Expression and Activity, Estrogen-dependent gene expression, RUNX1 regulates genes involved in megakaryocyte differentiation and platelet function, Transcriptional Regulation by VENTX, Ca2+ pathway, Regulation of PTEN mRNA translation +2 more Related via 14 shared pathways including TP53 Regulates Metabolic Genes, Pre-NOTCH Transcription and Translation. TNRC6A 14 shared pathwaysTP53 Regulates Metabolic Genes, Pre-NOTCH Transcription and Translation, Oxidative Stress Induced Senescence, NR1H3 & NR1H2 regulate gene expression linked to cholesterol transport and efflux, Oncogene Induced Senescence, MAPK6/MAPK4 signaling, Regulation of RUNX1 Expression and Activity, Estrogen-dependent gene expression, RUNX1 regulates genes involved in megakaryocyte differentiation and platelet function, Transcriptional Regulation by VENTX, Ca2+ pathway, Regulation of PTEN mRNA translation +2 more Related via 14 shared pathways including TP53 Regulates Metabolic Genes, Pre-NOTCH Transcription and Translation. AGO3 14 shared pathwaysTP53 Regulates Metabolic Genes, Pre-NOTCH Transcription and Translation, Oxidative Stress Induced Senescence, NR1H3 & NR1H2 regulate gene expression linked to cholesterol transport and efflux, Oncogene Induced Senescence, MAPK6/MAPK4 signaling, Regulation of RUNX1 Expression and Activity, Estrogen-dependent gene expression, RUNX1 regulates genes involved in megakaryocyte differentiation and platelet function, Transcriptional Regulation by VENTX, Ca2+ pathway, Regulation of PTEN mRNA translation +2 more Related via 14 shared pathways including TP53 Regulates Metabolic Genes, Pre-NOTCH Transcription and Translation. AGO4 14 shared pathwaysTP53 Regulates Metabolic Genes, Pre-NOTCH Transcription and Translation, Oxidative Stress Induced Senescence, NR1H3 & NR1H2 regulate gene expression linked to cholesterol transport and efflux, Oncogene Induced Senescence, MAPK6/MAPK4 signaling, Regulation of RUNX1 Expression and Activity, Estrogen-dependent gene expression, RUNX1 regulates genes involved in megakaryocyte differentiation and platelet function, Transcriptional Regulation by VENTX, Ca2+ pathway, Regulation of PTEN mRNA translation +2 more Related via 14 shared pathways including TP53 Regulates Metabolic Genes, Pre-NOTCH Transcription and Translation.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
TNRC6B	0	[]	14	["TP53 Regulates Metabolic Genes","Pre-NOTCH Transcription and Translation","Oxidative Stress Induced Senescence","NR1H3 & NR1H2 regulate gene expression linked to cholesterol transport and efflux","Oncogene Induced Senescence","MAPK6\/MAPK4 signaling","Regulation of RUNX1 Expression and Activity","Estrogen-dependent gene expression","RUNX1 regulates genes involved in megakaryocyte differentiation and platelet function","Transcriptional Regulation by VENTX","Ca2+ pathway","Regulation of PTEN mRNA translation"]	0	[]
TNRC6C	0	[]	14	["TP53 Regulates Metabolic Genes","Pre-NOTCH Transcription and Translation","Oxidative Stress Induced Senescence","NR1H3 & NR1H2 regulate gene expression linked to cholesterol transport and efflux","Oncogene Induced Senescence","MAPK6\/MAPK4 signaling","Regulation of RUNX1 Expression and Activity","Estrogen-dependent gene expression","RUNX1 regulates genes involved in megakaryocyte differentiation and platelet function","Transcriptional Regulation by VENTX","Ca2+ pathway","Regulation of PTEN mRNA translation"]	0	[]
TNRC6A	0	[]	14	["TP53 Regulates Metabolic Genes","Pre-NOTCH Transcription and Translation","Oxidative Stress Induced Senescence","NR1H3 & NR1H2 regulate gene expression linked to cholesterol transport and efflux","Oncogene Induced Senescence","MAPK6\/MAPK4 signaling","Regulation of RUNX1 Expression and Activity","Estrogen-dependent gene expression","RUNX1 regulates genes involved in megakaryocyte differentiation and platelet function","Transcriptional Regulation by VENTX","Ca2+ pathway","Regulation of PTEN mRNA translation"]	0	[]
AGO3	0	[]	14	["TP53 Regulates Metabolic Genes","Pre-NOTCH Transcription and Translation","Oxidative Stress Induced Senescence","NR1H3 & NR1H2 regulate gene expression linked to cholesterol transport and efflux","Oncogene Induced Senescence","MAPK6\/MAPK4 signaling","Regulation of RUNX1 Expression and Activity","Estrogen-dependent gene expression","RUNX1 regulates genes involved in megakaryocyte differentiation and platelet function","Transcriptional Regulation by VENTX","Ca2+ pathway","Regulation of PTEN mRNA translation"]	0	[]
AGO4	0	[]	14	["TP53 Regulates Metabolic Genes","Pre-NOTCH Transcription and Translation","Oxidative Stress Induced Senescence","NR1H3 & NR1H2 regulate gene expression linked to cholesterol transport and efflux","Oncogene Induced Senescence","MAPK6\/MAPK4 signaling","Regulation of RUNX1 Expression and Activity","Estrogen-dependent gene expression","RUNX1 regulates genes involved in megakaryocyte differentiation and platelet function","Transcriptional Regulation by VENTX","Ca2+ pathway","Regulation of PTEN mRNA translation"]	0	[]

Diseases Linked via Similar Genes

Metabolic syndrome Linked via 3 of 5 related genesTNRC6B, TNRC6C, TNRC6A Diabetes mellitus type 2 Linked via 3 of 5 related genesTNRC6B, TNRC6C, TNRC6A Autism Linked via 2 of 5 related genesTNRC6B, TNRC6A Alzheimer disease Linked via 2 of 5 related genesTNRC6C, TNRC6A Breast cancer Linked via 1 of 5 related genesTNRC6B

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Metabolic syndrome	3	["TNRC6B","TNRC6C","TNRC6A"]
Diabetes mellitus type 2	3	["TNRC6B","TNRC6C","TNRC6A"]
Autism	2	["TNRC6B","TNRC6A"]
Alzheimer disease	2	["TNRC6C","TNRC6A"]
Breast cancer	1	["TNRC6B"]