MED19 (mediator complex subunit 19)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 219541
• Gene name: Mediator complex subunit 19
• Gene symbol: MED19
• Synonyms (NCBI Gene): DT2P1G7, LCMR1, MED19AS
• Chromosome: 11
• Chromosome location: 11q12.1
• Summary: The protein encoded by this gene is a subunit of the Mediator complex, which binds to gene-specific regulatory factors and provides support for the basal RNA polymerase II transcription machinery. This gene has been implicated in the growth of several typ

miRNA Show/Hide all (213)

miRTarBase ID	miRNA	Experiments	Reference
MIRT028266	hsa-miR-32-5p	Sequencing	20371350
MIRT036344	hsa-miR-1229-3p	CLASH	23622248
MIRT544665	hsa-miR-4311	PAR-CLIP	21572407
MIRT551208	hsa-miR-551b-5p	PAR-CLIP	21572407
MIRT544666	hsa-miR-100-3p	PAR-CLIP	21572407
MIRT544664	hsa-miR-25-3p	PAR-CLIP	21572407
MIRT028266	hsa-miR-32-5p	PAR-CLIP	21572407
MIRT544663	hsa-miR-363-3p	PAR-CLIP	21572407
MIRT544662	hsa-miR-367-3p	PAR-CLIP	21572407
MIRT544661	hsa-miR-92a-3p	PAR-CLIP	21572407
MIRT544660	hsa-miR-92b-3p	PAR-CLIP	21572407
MIRT544659	hsa-miR-1324	PAR-CLIP	21572407
MIRT544658	hsa-miR-1253	PAR-CLIP	21572407
MIRT544657	hsa-miR-516a-3p	PAR-CLIP	21572407
MIRT544656	hsa-miR-516b-3p	PAR-CLIP	21572407
MIRT544655	hsa-miR-7162-5p	PAR-CLIP	21572407
MIRT544665	hsa-miR-4311	PAR-CLIP	21572407
MIRT544666	hsa-miR-100-3p	PAR-CLIP	21572407
MIRT544664	hsa-miR-25-3p	PAR-CLIP	21572407
MIRT028266	hsa-miR-32-5p	PAR-CLIP	21572407
MIRT544663	hsa-miR-363-3p	PAR-CLIP	21572407
MIRT544662	hsa-miR-367-3p	PAR-CLIP	21572407
MIRT544661	hsa-miR-92a-3p	PAR-CLIP	21572407
MIRT544660	hsa-miR-92b-3p	PAR-CLIP	21572407
MIRT544659	hsa-miR-1324	PAR-CLIP	21572407
MIRT544658	hsa-miR-1253	PAR-CLIP	21572407
MIRT544657	hsa-miR-516a-3p	PAR-CLIP	21572407
MIRT544656	hsa-miR-516b-3p	PAR-CLIP	21572407
MIRT544655	hsa-miR-7162-5p	PAR-CLIP	21572407
MIRT544665	hsa-miR-4311	PAR-CLIP	21572407
MIRT551208	hsa-miR-551b-5p	PAR-CLIP	21572407
MIRT544666	hsa-miR-100-3p	PAR-CLIP	21572407
MIRT544664	hsa-miR-25-3p	PAR-CLIP	21572407
MIRT028266	hsa-miR-32-5p	PAR-CLIP	21572407
MIRT544663	hsa-miR-363-3p	PAR-CLIP	21572407
MIRT544662	hsa-miR-367-3p	PAR-CLIP	21572407
MIRT544661	hsa-miR-92a-3p	PAR-CLIP	21572407
MIRT544660	hsa-miR-92b-3p	PAR-CLIP	21572407
MIRT544659	hsa-miR-1324	PAR-CLIP	21572407
MIRT544658	hsa-miR-1253	PAR-CLIP	21572407
MIRT544657	hsa-miR-516a-3p	PAR-CLIP	21572407
MIRT544656	hsa-miR-516b-3p	PAR-CLIP	21572407
MIRT544655	hsa-miR-7162-5p	PAR-CLIP	21572407
MIRT544665	hsa-miR-4311	PAR-CLIP	21572407
MIRT544666	hsa-miR-100-3p	PAR-CLIP	21572407
MIRT544664	hsa-miR-25-3p	PAR-CLIP	21572407
MIRT028266	hsa-miR-32-5p	PAR-CLIP	21572407
MIRT544663	hsa-miR-363-3p	PAR-CLIP	21572407
MIRT544662	hsa-miR-367-3p	PAR-CLIP	21572407
MIRT544661	hsa-miR-92a-3p	PAR-CLIP	21572407
MIRT544660	hsa-miR-92b-3p	PAR-CLIP	21572407
MIRT544659	hsa-miR-1324	PAR-CLIP	21572407
MIRT544658	hsa-miR-1253	PAR-CLIP	21572407
MIRT544657	hsa-miR-516a-3p	PAR-CLIP	21572407
MIRT544656	hsa-miR-516b-3p	PAR-CLIP	21572407
MIRT544655	hsa-miR-7162-5p	PAR-CLIP	21572407
MIRT1141179	hsa-miR-1205	CLIP-seq
MIRT1141180	hsa-miR-1225-3p	CLIP-seq
MIRT1141181	hsa-miR-1233	CLIP-seq
MIRT1141182	hsa-miR-1286	CLIP-seq
MIRT1141183	hsa-miR-1293	CLIP-seq
MIRT1141184	hsa-miR-22	CLIP-seq
MIRT1141185	hsa-miR-25	CLIP-seq
MIRT1141186	hsa-miR-28-5p	CLIP-seq
MIRT1141187	hsa-miR-3139	CLIP-seq
MIRT1141188	hsa-miR-3176	CLIP-seq
MIRT1141189	hsa-miR-3192	CLIP-seq
MIRT1141190	hsa-miR-32	CLIP-seq
MIRT1141191	hsa-miR-323-5p	CLIP-seq
MIRT1141192	hsa-miR-363	CLIP-seq
MIRT1141193	hsa-miR-367	CLIP-seq
MIRT1141194	hsa-miR-378	CLIP-seq
MIRT1141195	hsa-miR-378b	CLIP-seq
MIRT1141196	hsa-miR-378c	CLIP-seq
MIRT1141197	hsa-miR-378d	CLIP-seq
MIRT1141198	hsa-miR-378e	CLIP-seq
MIRT1141199	hsa-miR-378f	CLIP-seq
MIRT1141200	hsa-miR-378h	CLIP-seq
MIRT1141201	hsa-miR-378i	CLIP-seq
MIRT1141202	hsa-miR-3922-3p	CLIP-seq
MIRT1141203	hsa-miR-422a	CLIP-seq
MIRT1141204	hsa-miR-4300	CLIP-seq
MIRT1141205	hsa-miR-4483	CLIP-seq
MIRT1141206	hsa-miR-4487	CLIP-seq
MIRT1141207	hsa-miR-4527	CLIP-seq
MIRT1141208	hsa-miR-4638-3p	CLIP-seq
MIRT1141209	hsa-miR-4641	CLIP-seq
MIRT1141210	hsa-miR-4722-5p	CLIP-seq
MIRT1141211	hsa-miR-4757-5p	CLIP-seq
MIRT1141212	hsa-miR-558	CLIP-seq
MIRT1141213	hsa-miR-619	CLIP-seq
MIRT1141214	hsa-miR-661	CLIP-seq
MIRT1141215	hsa-miR-708	CLIP-seq
MIRT1141216	hsa-miR-920	CLIP-seq
MIRT1141217	hsa-miR-92a	CLIP-seq
MIRT1141218	hsa-miR-92b	CLIP-seq
MIRT2040005	hsa-miR-214	CLIP-seq
MIRT1141188	hsa-miR-3176	CLIP-seq
MIRT2040006	hsa-miR-3619-5p	CLIP-seq
MIRT1141202	hsa-miR-3922-3p	CLIP-seq
MIRT2040007	hsa-miR-761	CLIP-seq
MIRT2269851	hsa-miR-1343	CLIP-seq
MIRT2269852	hsa-miR-1825	CLIP-seq
MIRT2269853	hsa-miR-199a-5p	CLIP-seq
MIRT2269854	hsa-miR-199b-5p	CLIP-seq
MIRT2040005	hsa-miR-214	CLIP-seq
MIRT1141185	hsa-miR-25	CLIP-seq
MIRT2269855	hsa-miR-2964a-5p	CLIP-seq
MIRT2269856	hsa-miR-3120-3p	CLIP-seq
MIRT2269857	hsa-miR-3125	CLIP-seq
MIRT2269858	hsa-miR-3128	CLIP-seq
MIRT1141188	hsa-miR-3176	CLIP-seq
MIRT1141189	hsa-miR-3192	CLIP-seq
MIRT1141190	hsa-miR-32	CLIP-seq
MIRT2269859	hsa-miR-3202	CLIP-seq
MIRT2269860	hsa-miR-3545-5p	CLIP-seq
MIRT2269861	hsa-miR-361-5p	CLIP-seq
MIRT2040006	hsa-miR-3619-5p	CLIP-seq
MIRT1141192	hsa-miR-363	CLIP-seq
MIRT1141193	hsa-miR-367	CLIP-seq
MIRT2269862	hsa-miR-3714	CLIP-seq
MIRT2269863	hsa-miR-3916	CLIP-seq
MIRT1141202	hsa-miR-3922-3p	CLIP-seq
MIRT2269864	hsa-miR-4291	CLIP-seq
MIRT2269865	hsa-miR-4470	CLIP-seq
MIRT2269866	hsa-miR-4533	CLIP-seq
MIRT2269867	hsa-miR-4793-5p	CLIP-seq
MIRT2269868	hsa-miR-657	CLIP-seq
MIRT2040007	hsa-miR-761	CLIP-seq
MIRT2269869	hsa-miR-922	CLIP-seq
MIRT1141217	hsa-miR-92a	CLIP-seq
MIRT1141218	hsa-miR-92b	CLIP-seq
MIRT2040005	hsa-miR-214	CLIP-seq
MIRT2040006	hsa-miR-3619-5p	CLIP-seq
MIRT2390782	hsa-miR-3929	CLIP-seq
MIRT2390783	hsa-miR-4419b	CLIP-seq
MIRT2390784	hsa-miR-4478	CLIP-seq
MIRT2040007	hsa-miR-761	CLIP-seq
MIRT1141179	hsa-miR-1205	CLIP-seq
MIRT1141182	hsa-miR-1286	CLIP-seq
MIRT1141210	hsa-miR-4722-5p	CLIP-seq
MIRT1141211	hsa-miR-4757-5p	CLIP-seq
MIRT1141179	hsa-miR-1205	CLIP-seq
MIRT1141180	hsa-miR-1225-3p	CLIP-seq
MIRT1141181	hsa-miR-1233	CLIP-seq
MIRT2568984	hsa-miR-1248	CLIP-seq
MIRT1141182	hsa-miR-1286	CLIP-seq
MIRT2568985	hsa-miR-150	CLIP-seq
MIRT1141184	hsa-miR-22	CLIP-seq
MIRT2568986	hsa-miR-2682	CLIP-seq
MIRT1141186	hsa-miR-28-5p	CLIP-seq
MIRT1141187	hsa-miR-3139	CLIP-seq
MIRT1141188	hsa-miR-3176	CLIP-seq
MIRT1141189	hsa-miR-3192	CLIP-seq
MIRT2568987	hsa-miR-34a	CLIP-seq
MIRT2568988	hsa-miR-34c-5p	CLIP-seq
MIRT2269862	hsa-miR-3714	CLIP-seq
MIRT1141202	hsa-miR-3922-3p	CLIP-seq
MIRT1141204	hsa-miR-4300	CLIP-seq
MIRT1141206	hsa-miR-4487	CLIP-seq
MIRT2568989	hsa-miR-449a	CLIP-seq
MIRT2568990	hsa-miR-449b	CLIP-seq
MIRT2568991	hsa-miR-449c	CLIP-seq
MIRT2568992	hsa-miR-4659a-3p	CLIP-seq
MIRT2568993	hsa-miR-4659b-3p	CLIP-seq
MIRT1141210	hsa-miR-4722-5p	CLIP-seq
MIRT2568994	hsa-miR-4724-3p	CLIP-seq
MIRT2568995	hsa-miR-4753-3p	CLIP-seq
MIRT1141211	hsa-miR-4757-5p	CLIP-seq
MIRT2568996	hsa-miR-4778-3p	CLIP-seq
MIRT1141212	hsa-miR-558	CLIP-seq
MIRT1141214	hsa-miR-661	CLIP-seq
MIRT1141215	hsa-miR-708	CLIP-seq
MIRT1141216	hsa-miR-920	CLIP-seq
MIRT2568997	hsa-miR-942	CLIP-seq
MIRT1141179	hsa-miR-1205	CLIP-seq
MIRT1141180	hsa-miR-1225-3p	CLIP-seq
MIRT1141181	hsa-miR-1233	CLIP-seq
MIRT2568984	hsa-miR-1248	CLIP-seq
MIRT1141182	hsa-miR-1286	CLIP-seq
MIRT2269851	hsa-miR-1343	CLIP-seq
MIRT2568985	hsa-miR-150	CLIP-seq
MIRT1141184	hsa-miR-22	CLIP-seq
MIRT2568986	hsa-miR-2682	CLIP-seq
MIRT1141186	hsa-miR-28-5p	CLIP-seq
MIRT1141187	hsa-miR-3139	CLIP-seq
MIRT1141188	hsa-miR-3176	CLIP-seq
MIRT1141189	hsa-miR-3192	CLIP-seq
MIRT2568987	hsa-miR-34a	CLIP-seq
MIRT2568988	hsa-miR-34c-5p	CLIP-seq
MIRT2684793	hsa-miR-3647-3p	CLIP-seq
MIRT2269862	hsa-miR-3714	CLIP-seq
MIRT1141202	hsa-miR-3922-3p	CLIP-seq
MIRT2390782	hsa-miR-3929	CLIP-seq
MIRT1141204	hsa-miR-4300	CLIP-seq
MIRT2390783	hsa-miR-4419b	CLIP-seq
MIRT2390784	hsa-miR-4478	CLIP-seq
MIRT1141206	hsa-miR-4487	CLIP-seq
MIRT2568989	hsa-miR-449a	CLIP-seq
MIRT2568990	hsa-miR-449b	CLIP-seq
MIRT2568991	hsa-miR-449c	CLIP-seq
MIRT2568992	hsa-miR-4659a-3p	CLIP-seq
MIRT2568993	hsa-miR-4659b-3p	CLIP-seq
MIRT1141210	hsa-miR-4722-5p	CLIP-seq
MIRT2568994	hsa-miR-4724-3p	CLIP-seq
MIRT2568995	hsa-miR-4753-3p	CLIP-seq
MIRT1141211	hsa-miR-4757-5p	CLIP-seq
MIRT2568996	hsa-miR-4778-3p	CLIP-seq
MIRT1141212	hsa-miR-558	CLIP-seq
MIRT1141214	hsa-miR-661	CLIP-seq
MIRT1141215	hsa-miR-708	CLIP-seq
MIRT1141216	hsa-miR-920	CLIP-seq
MIRT2568997	hsa-miR-942	CLIP-seq

Gene ontology (GO) Show/Hide all (13)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003712	Function	Transcription coregulator activity	IEA
GO:0005515	Function	Protein binding	IPI	14576168, 14638676, 15175163, 21729782, 24882805, 32296183, 32814053, 33961781, 35271311
GO:0005634	Component	Nucleus	IDA	24882805
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0016592	Component	Mediator complex	IBA
GO:0016592	Component	Mediator complex	IEA
GO:0032968	Process	Positive regulation of transcription elongation by RNA polymerase II	NAS	11559591
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA
GO:0051123	Process	RNA polymerase II preinitiation complex assembly	NAS	11559591
GO:0060261	Process	Positive regulation of transcription initiation by RNA polymerase II	NAS	11559591
GO:0070847	Component	Core mediator complex	IPI	24882805

Other IDs

• MIM: 612385
• HGNC: 29600
• e!Ensembl: ENSG00000156603

Protein

• UniProt ID: A0JLT2
• Protein name: Mediator of RNA polymerase II transcription subunit 19 (Lung cancer metastasis-related protein 1) (Mediator complex subunit 19)
• Protein function: Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RN
• PDB: 7EMF , 7ENA , 7ENC , 7ENJ , 7LBM , 7NVR , 8GXQ , 8GXS , 8TQW , 8TRH
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF10278	Med19	63 → 234	Mediator of RNA pol II transcription subunit 19	Family

• Sequence:

  MENFTALFGAQADPPPPPTALGFGPGKPPPPPPPPAGGGPGTAPPPTAATAPPGADKSGA
  GCGPFYLMRELPGSTELTGSTNLITHYNLEQAYNKFCGKKVKEKLSNFLPDLPGMIDLPG
  SHDNSSLRSLIEKPPILSSSFNPITGTMLAGFRLHTGPLPEQCRLMHIQPPKKKNKHKHK
  QSRTQDPVPPETPSDSDHKKKKKKKEEDPDRKRKKKEKKKKKNRHSPDHPGMGSSQASSS
  SSLR

• Sequence length: 244

Pathways

Reactome Pathway

PPARA activates gene expression

Transcriptional regulation of white adipocyte differentiation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Familial cancer of breast	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Intellectual disability	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (43)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	23098456		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	27537704		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	21478038, 23276457, 28631286		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	20890603, 27572702, 27584910, 27684037, 30161287, 30583076		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	25735376, 39369139	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	21871180, 27375018		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	35069777, 39369139	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	21478038, 23276457, 28631286		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	21306606, 21519921, 25735376, 28765911		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	22961438		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	30473219		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	30473219		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	27467457		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	21732059, 27811858		★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	27467457		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	27513194		★☆☆☆☆ Found in Text Mining only
DICER1 syndrome	Pleuropulmonary Blastoma Tumor Susceptibility Syndrome	BEFREE	27441995		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	35044082	Associate	★☆☆☆☆ Found in Text Mining only
Juvenile Myoclonic Epilepsy	Myoclonic Epilepsy	BEFREE	27467453		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	21372827		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	21306606, 23098456, 25735376	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	20890603, 27572702, 27584910, 27684037, 30161287, 30583076		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	21306606, 21519921, 25735376, 28765911		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	22961438		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	21834715		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	21871180, 28125713		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	22565189		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of tongue	Malignant Neoplasm Of Tongue	BEFREE	23705783		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	21478038, 23276457, 28631286		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	21372827, 21834715, 22565189, 22961438, 25735376, 27171545, 28337304		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	30473219		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	27375018, 28628117		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	20890603, 21372827, 21871180, 22565189, 22961438, 23276457, 24565852, 27811858, 28631286, 30583076		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	21306606, 25735376		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	21542455, 24565852, 29795113		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	22961438		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	21834715		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	21871180, 28125713		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	33513133, 35184651, 37880276	Associate	★☆☆☆☆ Found in Text Mining only
Rett Syndrome	Rett Syndrome	BEFREE	27171548		★☆☆☆☆ Found in Text Mining only
Smith-Lemli-Opitz Syndrome	Smith-Lemli-Opitz Syndrome	BEFREE	27513191		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	22565189		★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	23276457		★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

MED6 2 shared pathwaysPPARA activates gene expression, Transcriptional regulation of white adipocyte differentiation Related via 2 shared pathways including PPARA activates gene expression, Transcriptional regulation of white adipocyte differentiation. MED8 2 shared pathwaysPPARA activates gene expression, Transcriptional regulation of white adipocyte differentiation Related via 2 shared pathways including PPARA activates gene expression, Transcriptional regulation of white adipocyte differentiation. CDK19 2 shared pathwaysPPARA activates gene expression, Transcriptional regulation of white adipocyte differentiation Related via 2 shared pathways including PPARA activates gene expression, Transcriptional regulation of white adipocyte differentiation. MED11 2 shared pathwaysPPARA activates gene expression, Transcriptional regulation of white adipocyte differentiation Related via 2 shared pathways including PPARA activates gene expression, Transcriptional regulation of white adipocyte differentiation. MED31 2 shared pathwaysPPARA activates gene expression, Transcriptional regulation of white adipocyte differentiation Related via 2 shared pathways including PPARA activates gene expression, Transcriptional regulation of white adipocyte differentiation.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
MED6	0	[]	2	["PPARA activates gene expression","Transcriptional regulation of white adipocyte differentiation"]	0	[]
MED8	0	[]	2	["PPARA activates gene expression","Transcriptional regulation of white adipocyte differentiation"]	0	[]
CDK19	0	[]	2	["PPARA activates gene expression","Transcriptional regulation of white adipocyte differentiation"]	0	[]
MED11	0	[]	2	["PPARA activates gene expression","Transcriptional regulation of white adipocyte differentiation"]	0	[]
MED31	0	[]	2	["PPARA activates gene expression","Transcriptional regulation of white adipocyte differentiation"]	0	[]

Diseases Linked via Similar Genes

Neurodevelopmental disorder Linked via 2 of 5 related genesCDK19, MED11 Attention deficit hyperactivity disorder Linked via 1 of 5 related genesMED8 Autism Linked via 1 of 5 related genesMED8 Developmental and epileptic encephalopathy Linked via 1 of 5 related genesCDK19 Major depressive disorder Linked via 1 of 5 related genesCDK19

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Neurodevelopmental disorder	2	["CDK19","MED11"]
Attention deficit hyperactivity disorder	1	["MED8"]
Autism	1	["MED8"]
Developmental and epileptic encephalopathy	1	["CDK19"]
Major depressive disorder	1	["CDK19"]