KLRC3 (killer cell lectin like receptor C3)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 3823
Gene name Killer cell lectin like receptor C3
Gene symbol KLRC3
Synonyms (NCBI Gene)
NKG2-ENKG2E
Chromosome 12
Chromosome location 12p13.2
Summary Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity. NK cells preferentially express several calci
miRNA miRNA information provided by mirtarbase database.
78 Show/Hide all (78)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT018845 hsa-miR-335-5p Microarray 18185580
MIRT544025 hsa-miR-548a-3p PAR-CLIP 21572407
MIRT544024 hsa-miR-548ar-3p PAR-CLIP 21572407
MIRT544023 hsa-miR-548az-3p PAR-CLIP 21572407
MIRT544022 hsa-miR-548e-3p PAR-CLIP 21572407
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
12 Show/Hide all (12)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0002223 Process Stimulatory C-type lectin receptor signaling pathway IBA
GO:0004888 Function Transmembrane signaling receptor activity IBA
GO:0004888 Function Transmembrane signaling receptor activity TAS 9683661
GO:0005886 Component Plasma membrane ISO
GO:0006968 Process Cellular defense response IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
602892 6376 ENSG00000205810
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q07444
Protein name NKG2-E type II integral membrane protein (NK cell receptor E) (NKG2-E-activating NK receptor)
Protein function Plays a role as a receptor for the recognition of MHC class I HLA-E molecules by NK cells and some cytotoxic T-cells.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00059 Lectin_C 134 → 226 Lectin C-type domain Domain
Tissue specificity TISSUE SPECIFICITY: Natural killer cells.
Sequence 
MSKQRGTFSEVSLAQDPKWQQRKPKGNKSSISGTEQEIFQVELNLQNASLNHQGIDKIYD
CQGLLPPPEKLTAEVLGIICIVLMATVLKTIVLIPFLEQNNSSPNARTQKARHCGHCPEE
WITYSNSCYYIGKERRTWEESLQACASKNSSSLLCIDNEEEMKFLASILPSSWIGVFRNS
SHHPWVTINGLAFKHEIKDSDHAERNCAMLHVRGLISDQCGSSRIIRRGFIMLTRLVLNS
Sequence length 240
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
KEGG Pathway
Antigen processing and presentation
Natural killer cell mediated cytotoxicity
Sort by:
KIR2DS3 2 shared pathwaysAntigen processing and presentation, Natural killer cell mediated cytotoxicity Related via 2 shared pathways including Antigen processing and presentation, Natural killer cell mediated cytotoxicity. KIR2DS4 2 shared pathwaysAntigen processing and presentation, Natural killer cell mediated cytotoxicity Related via 2 shared pathways including Antigen processing and presentation, Natural killer cell mediated cytotoxicity. KIR2DS5 2 shared pathwaysAntigen processing and presentation, Natural killer cell mediated cytotoxicity Related via 2 shared pathways including Antigen processing and presentation, Natural killer cell mediated cytotoxicity. KIR2DL5A 2 shared pathwaysAntigen processing and presentation, Natural killer cell mediated cytotoxicity Related via 2 shared pathways including Antigen processing and presentation, Natural killer cell mediated cytotoxicity. KIR2DS2 2 shared pathwaysAntigen processing and presentation, Natural killer cell mediated cytotoxicity Related via 2 shared pathways including Antigen processing and presentation, Natural killer cell mediated cytotoxicity.

No additional diseases found yet through genes similar to KLRC3.